From f6fae21de93456b373aeb203bb56a779cd78009c Mon Sep 17 00:00:00 2001 From: "dependabot[bot]" <49699333+dependabot[bot]@users.noreply.github.com> Date: Thu, 26 Oct 2023 13:31:30 +0000 Subject: [PATCH] Bump github.com/thanos-io/thanos from 0.25.2 to 0.32.5 Bumps [github.com/thanos-io/thanos](https://github.com/thanos-io/thanos) from 0.25.2 to 0.32.5. - [Release notes](https://github.com/thanos-io/thanos/releases) - [Changelog](https://github.com/thanos-io/thanos/blob/main/CHANGELOG.md) - [Commits](https://github.com/thanos-io/thanos/compare/v0.25.2...v0.32.5) --- updated-dependencies: - dependency-name: github.com/thanos-io/thanos dependency-type: direct:production update-type: version-update:semver-minor ... Signed-off-by: dependabot[bot] <support@github.com> --- go.mod | 77 +- go.sum | 167 +- .../go/compute/internal/version.go | 2 +- .../asaskevich/govalidator/validator.go | 33 +- .../aws/aws-sdk-go/aws/auth/bearer/token.go | 50 + .../github.com/aws/aws-sdk-go/aws/config.go | 64 +- .../aws/credentials/processcreds/provider.go | 24 +- .../aws/credentials/ssocreds/provider.go | 75 +- .../credentials/ssocreds/sso_cached_token.go | 237 + .../credentials/ssocreds/token_provider.go | 148 + .../stscreds/assume_role_provider.go | 12 +- .../aws/aws-sdk-go/aws/ec2metadata/service.go | 10 +- .../aws/ec2metadata/token_provider.go | 25 +- .../aws/aws-sdk-go/aws/endpoints/defaults.go | 5982 ++++++++++++++++- .../aws/aws-sdk-go/aws/session/credentials.go | 36 +- .../aws/aws-sdk-go/aws/session/session.go | 62 +- .../aws-sdk-go/aws/session/shared_config.go | 168 +- .../aws/aws-sdk-go/aws/signer/v4/v4.go | 14 +- .../github.com/aws/aws-sdk-go/aws/version.go | 2 +- .../protocol/jsonrpc/unmarshal_error.go | 63 +- .../aws-sdk-go/private/protocol/rest/build.go | 4 + .../protocol/restjson/unmarshal_error.go | 133 +- .../aws/aws-sdk-go/service/ssooidc/api.go | 1682 +++++ .../aws/aws-sdk-go/service/ssooidc/doc.go | 66 + .../aws/aws-sdk-go/service/ssooidc/errors.go | 107 + .../aws/aws-sdk-go/service/ssooidc/service.go | 106 + .../aws/aws-sdk-go/service/sts/api.go | 231 +- .../aws/aws-sdk-go/service/sts/doc.go | 7 +- .../efficientgo/core/backoff/backoff.go | 2 + .../efficientgo/core/errcapture/doc.go | 30 +- .../github.com/efficientgo/core/errors/doc.go | 3 +- .../efficientgo/core/merrors/doc.go | 28 +- vendor/github.com/efficientgo/e2e/Makefile | 6 +- vendor/github.com/efficientgo/e2e/README.md | 19 +- vendor/github.com/efficientgo/e2e/env.go | 16 + .../github.com/efficientgo/e2e/env_docker.go | 50 +- vendor/github.com/efficientgo/e2e/env_kind.go | 826 +++ .../github.com/efficientgo/e2e/host/host.go | 32 + .../e2e/interactive/interactive.go | 18 +- .../efficientgo/e2e/monitoring/metrics.go | 11 + .../efficientgo/e2e/monitoring/monitoring.go | 41 +- .../github.com/go-logfmt/logfmt/CHANGELOG.md | 46 +- vendor/github.com/go-logfmt/logfmt/README.md | 30 +- vendor/github.com/go-logfmt/logfmt/decode.go | 17 + vendor/github.com/go-logr/logr/.golangci.yaml | 3 - vendor/github.com/go-logr/logr/discard.go | 32 +- vendor/github.com/go-logr/logr/funcr/funcr.go | 27 +- vendor/github.com/go-logr/logr/logr.go | 166 +- vendor/github.com/go-logr/logr/testr/testr.go | 103 +- vendor/github.com/go-openapi/errors/api.go | 2 +- .../go-openapi/jsonpointer/.travis.yml | 15 - .../go-openapi/jsonpointer/pointer.go | 147 +- .../go-openapi/jsonreference/.golangci.yml | 13 +- .../go-openapi/jsonreference/.travis.yml | 24 - .../jsonreference/internal/normalize_url.go | 22 +- vendor/github.com/go-openapi/spec/info.go | 19 + .../github.com/go-openapi/spec/properties.go | 6 +- .../github.com/go-openapi/spec/responses.go | 27 +- .../go-openapi/strfmt/.golangci.yml | 59 +- vendor/github.com/go-openapi/strfmt/bson.go | 2 +- vendor/github.com/go-openapi/strfmt/date.go | 6 +- vendor/github.com/go-openapi/strfmt/format.go | 2 +- vendor/github.com/go-openapi/strfmt/time.go | 27 +- vendor/github.com/go-openapi/strfmt/ulid.go | 11 +- vendor/github.com/go-openapi/swag/util.go | 16 +- .../github.com/go-openapi/validate/values.go | 8 +- .../github.com/klauspost/cpuid/v2/.gitignore | 24 + .../klauspost/cpuid/v2/.goreleaser.yml | 74 + .../klauspost/cpuid/v2/CONTRIBUTING.txt | 35 + vendor/github.com/klauspost/cpuid/v2/LICENSE | 22 + .../github.com/klauspost/cpuid/v2/README.md | 493 ++ vendor/github.com/klauspost/cpuid/v2/cpuid.go | 1427 ++++ .../github.com/klauspost/cpuid/v2/cpuid_386.s | 47 + .../klauspost/cpuid/v2/cpuid_amd64.s | 72 + .../klauspost/cpuid/v2/cpuid_arm64.s | 26 + .../klauspost/cpuid/v2/detect_arm64.go | 247 + .../klauspost/cpuid/v2/detect_ref.go | 15 + .../klauspost/cpuid/v2/detect_x86.go | 36 + .../klauspost/cpuid/v2/featureid_string.go | 272 + .../klauspost/cpuid/v2/os_darwin_arm64.go | 121 + .../klauspost/cpuid/v2/os_linux_arm64.go | 130 + .../klauspost/cpuid/v2/os_other_arm64.go | 16 + .../klauspost/cpuid/v2/os_safe_linux_arm64.go | 8 + .../cpuid/v2/os_unsafe_linux_arm64.go | 11 + .../klauspost/cpuid/v2/test-architectures.sh | 15 + .../github.com/minio/sha256-simd/.gitignore | 1 + vendor/github.com/minio/sha256-simd/LICENSE | 202 + vendor/github.com/minio/sha256-simd/README.md | 137 + .../minio/sha256-simd/cpuid_other.go | 50 + vendor/github.com/minio/sha256-simd/sha256.go | 468 ++ .../sha256-simd/sha256blockAvx512_amd64.asm | 686 ++ .../sha256-simd/sha256blockAvx512_amd64.go | 501 ++ .../sha256-simd/sha256blockAvx512_amd64.s | 267 + .../minio/sha256-simd/sha256block_amd64.go | 31 + .../minio/sha256-simd/sha256block_amd64.s | 266 + .../minio/sha256-simd/sha256block_arm64.go | 37 + .../minio/sha256-simd/sha256block_arm64.s | 192 + .../minio/sha256-simd/sha256block_other.go | 29 + .../minio/sha256-simd/test-architectures.sh | 15 + .../client_golang/api/prometheus/v1/api.go | 396 +- .../collectors/go_collector_latest.go | 2 + .../client_golang/prometheus/counter.go | 26 +- .../client_golang/prometheus/desc.go | 46 +- .../client_golang/prometheus/doc.go | 44 +- .../client_golang/prometheus/gauge.go | 26 +- .../prometheus/go_collector_latest.go | 7 +- .../client_golang/prometheus/histogram.go | 61 +- .../client_golang/prometheus/labels.go | 72 + .../client_golang/prometheus/metric.go | 6 +- .../client_golang/prometheus/promauto/auto.go | 28 +- .../client_golang/prometheus/promhttp/http.go | 19 +- .../prometheus/promhttp/instrument_client.go | 26 +- .../prometheus/promhttp/instrument_server.go | 101 +- .../prometheus/promhttp/option.go | 38 +- .../client_golang/prometheus/registry.go | 17 +- .../client_golang/prometheus/summary.go | 39 +- .../prometheus/testutil/promlint/promlint.go | 20 +- .../prometheus/testutil/testutil.go | 1 + .../client_golang/prometheus/timer.go | 28 +- .../client_golang/prometheus/value.go | 10 +- .../client_golang/prometheus/vec.go | 79 +- .../client_golang/prometheus/vnext.go | 23 + .../client_golang/prometheus/wrap.go | 8 +- .../prometheus/client_model/go/metrics.pb.go | 1530 +++-- .../prometheus/common/config/http_config.go | 311 +- .../prometheus/common/expfmt/decode.go | 5 +- .../prometheus/common/expfmt/encode.go | 13 +- .../prometheus/common/expfmt/expfmt.go | 26 +- .../prometheus/common/expfmt/text_parse.go | 2 +- .../prometheus/common/model/time.go | 89 +- .../prometheus/common/version/info.go | 5 +- .../prometheus/common/version/info_default.go | 4 + .../prometheus/common/version/info_go118.go | 19 +- .../prometheus/procfs/.golangci.yml | 3 + .../prometheus/procfs/Makefile.common | 27 +- vendor/github.com/prometheus/procfs/README.md | 4 +- vendor/github.com/prometheus/procfs/arp.go | 6 +- .../github.com/prometheus/procfs/buddyinfo.go | 6 +- .../github.com/prometheus/procfs/cpuinfo.go | 53 +- .../prometheus/procfs/cpuinfo_loong64.go | 19 + .../prometheus/procfs/cpuinfo_others.go | 4 +- vendor/github.com/prometheus/procfs/crypto.go | 7 +- vendor/github.com/prometheus/procfs/doc.go | 51 +- vendor/github.com/prometheus/procfs/fs.go | 11 +- .../prometheus/procfs/fs_statfs_notype.go | 23 + .../prometheus/procfs/fs_statfs_type.go | 33 + .../github.com/prometheus/procfs/fscache.go | 6 +- .../prometheus/procfs/internal/util/parse.go | 15 + vendor/github.com/prometheus/procfs/ipvs.go | 7 +- .../github.com/prometheus/procfs/loadavg.go | 4 +- vendor/github.com/prometheus/procfs/mdstat.go | 36 +- .../github.com/prometheus/procfs/meminfo.go | 4 +- .../github.com/prometheus/procfs/mountinfo.go | 10 +- .../prometheus/procfs/mountstats.go | 41 +- .../prometheus/procfs/net_conntrackstat.go | 91 +- .../prometheus/procfs/net_ip_socket.go | 32 +- .../prometheus/procfs/net_protocols.go | 4 +- .../github.com/prometheus/procfs/net_route.go | 143 + .../prometheus/procfs/net_sockstat.go | 9 +- .../prometheus/procfs/net_softnet.go | 79 +- .../github.com/prometheus/procfs/net_unix.go | 16 +- .../prometheus/procfs/net_wireless.go | 182 + .../github.com/prometheus/procfs/net_xfrm.go | 2 +- .../github.com/prometheus/procfs/netstat.go | 54 +- vendor/github.com/prometheus/procfs/proc.go | 37 +- .../prometheus/procfs/proc_cgroup.go | 6 +- .../prometheus/procfs/proc_cgroups.go | 8 +- .../prometheus/procfs/proc_fdinfo.go | 2 +- .../prometheus/procfs/proc_interrupts.go | 98 + .../prometheus/procfs/proc_limits.go | 4 +- .../github.com/prometheus/procfs/proc_maps.go | 8 +- .../prometheus/procfs/proc_netstat.go | 495 +- .../github.com/prometheus/procfs/proc_ns.go | 6 +- .../github.com/prometheus/procfs/proc_psi.go | 6 +- .../prometheus/procfs/proc_smaps.go | 4 +- .../github.com/prometheus/procfs/proc_snmp.go | 322 +- .../prometheus/procfs/proc_snmp6.go | 364 +- .../github.com/prometheus/procfs/proc_stat.go | 12 +- .../prometheus/procfs/proc_status.go | 38 +- .../github.com/prometheus/procfs/proc_sys.go | 2 +- vendor/github.com/prometheus/procfs/slab.go | 2 +- .../github.com/prometheus/procfs/softirqs.go | 24 +- vendor/github.com/prometheus/procfs/stat.go | 50 +- vendor/github.com/prometheus/procfs/swaps.go | 8 +- vendor/github.com/prometheus/procfs/thread.go | 80 + vendor/github.com/prometheus/procfs/vm.go | 6 +- .../github.com/prometheus/procfs/zoneinfo.go | 4 +- .../testify/assert/assertion_compare.go | 36 +- .../testify/assert/assertion_format.go | 216 +- .../testify/assert/assertion_forward.go | 432 +- .../testify/assert/assertion_order.go | 24 +- .../stretchr/testify/assert/assertions.go | 384 +- .../github.com/stretchr/testify/assert/doc.go | 43 +- .../testify/assert/http_assertions.go | 12 +- .../stretchr/testify/require/doc.go | 23 +- .../stretchr/testify/require/require.go | 444 +- .../testify/require/require_forward.go | 432 +- .../thanos/pkg/errutil/multierror.go | 26 + .../thanos-io/thanos/pkg/reloader/reloader.go | 72 +- .../thanos-io/thanos/pkg/runutil/runutil.go | 35 +- .../bson/bsoncodec/array_codec.go | 10 +- .../mongo-driver/bson/bsoncodec/bsoncodec.go | 156 +- .../bson/bsoncodec/byte_slice_codec.go | 20 +- .../bson/bsoncodec/default_value_decoders.go | 126 +- .../bson/bsoncodec/default_value_encoders.go | 122 +- .../mongo-driver/bson/bsoncodec/doc.go | 73 +- .../bson/bsoncodec/empty_interface_codec.go | 16 +- .../mongo-driver/bson/bsoncodec/map_codec.go | 36 +- .../bson/bsoncodec/pointer_codec.go | 6 + .../mongo-driver/bson/bsoncodec/registry.go | 456 +- .../bson/bsoncodec/slice_codec.go | 30 +- .../bson/bsoncodec/string_codec.go | 21 +- .../bson/bsoncodec/struct_codec.go | 157 +- .../bson/bsoncodec/struct_tag_parser.go | 11 +- .../mongo-driver/bson/bsoncodec/time_codec.go | 16 +- .../mongo-driver/bson/bsoncodec/uint_codec.go | 13 +- .../bsonoptions/byte_slice_codec_options.go | 11 + .../empty_interface_codec_options.go | 11 + .../bson/bsonoptions/map_codec_options.go | 15 + .../bson/bsonoptions/slice_codec_options.go | 11 + .../bson/bsonoptions/string_codec_options.go | 11 + .../bson/bsonoptions/struct_codec_options.go | 20 + .../bson/bsonoptions/time_codec_options.go | 11 + .../bson/bsonoptions/uint_codec_options.go | 11 + .../mongo-driver/bson/bsonrw/copier.go | 43 + .../bson/bsonrw/extjson_reader.go | 8 + .../bson/bsonrw/extjson_writer.go | 23 +- .../mongo-driver/bson/bsonrw/reader.go | 2 + .../mongo-driver/bson/bsonrw/value_reader.go | 8 + .../mongo-driver/bson/bsonrw/value_writer.go | 10 + .../mongo-driver/bson/bsonrw/writer.go | 9 + .../mongo-driver/bson/bsontype/bsontype.go | 9 +- .../mongo-driver/bson/decoder.go | 79 +- .../go.mongodb.org/mongo-driver/bson/doc.go | 5 +- .../mongo-driver/bson/encoder.go | 110 +- .../mongo-driver/bson/marshal.go | 193 +- .../mongo-driver/bson/primitive/decimal.go | 14 + .../mongo-driver/bson/primitive/objectid.go | 8 +- .../mongo-driver/bson/primitive/primitive.go | 46 +- .../mongo-driver/bson/primitive_codecs.go | 26 +- .../go.mongodb.org/mongo-driver/bson/raw.go | 23 +- .../mongo-driver/bson/raw_element.go | 7 +- .../mongo-driver/bson/raw_value.go | 13 +- .../mongo-driver/bson/registry.go | 15 +- .../go.mongodb.org/mongo-driver/bson/types.go | 15 +- .../mongo-driver/bson/unmarshal.go | 92 +- .../mongo-driver/x/bsonx/bsoncore/array.go | 10 +- .../mongo-driver/x/bsonx/bsoncore/bsoncore.go | 19 - .../mongo-driver/x/bsonx/bsoncore/doc.go | 29 + .../mongo-driver/x/bsonx/bsoncore/document.go | 10 +- .../mongo-driver/x/bsonx/bsoncore/element.go | 2 +- .../mongo-driver/x/bsonx/bsoncore/value.go | 25 +- .../go.opentelemetry.io/otel/.codespellignore | 5 + vendor/go.opentelemetry.io/otel/.codespellrc | 10 + vendor/go.opentelemetry.io/otel/.gitignore | 3 + vendor/go.opentelemetry.io/otel/.golangci.yml | 4 +- vendor/go.opentelemetry.io/otel/.lycheeignore | 3 + vendor/go.opentelemetry.io/otel/CHANGELOG.md | 432 +- vendor/go.opentelemetry.io/otel/CODEOWNERS | 2 +- .../go.opentelemetry.io/otel/CONTRIBUTING.md | 108 +- vendor/go.opentelemetry.io/otel/Makefile | 65 +- vendor/go.opentelemetry.io/otel/README.md | 12 +- vendor/go.opentelemetry.io/otel/RELEASING.md | 16 +- .../go.opentelemetry.io/otel/attribute/set.go | 20 +- .../otel/attribute/value.go | 16 +- .../otel/baggage/baggage.go | 56 +- vendor/go.opentelemetry.io/otel/codes/doc.go | 2 +- vendor/go.opentelemetry.io/otel/handler.go | 65 +- .../otel/internal/attribute/attribute.go | 82 +- .../otel/internal/global/handler.go | 103 + .../otel/internal/global/instruments.go | 359 + .../otel/internal/global/internal_logging.go | 45 +- .../otel/internal/global/meter.go | 354 + .../otel/internal/global/state.go | 45 +- vendor/go.opentelemetry.io/otel/metric.go | 53 + .../go.opentelemetry.io/otel/metric/LICENSE | 201 + .../otel/metric/asyncfloat64.go | 271 + .../otel/metric/asyncint64.go | 269 + .../go.opentelemetry.io/otel/metric/config.go | 92 + vendor/go.opentelemetry.io/otel/metric/doc.go | 170 + .../otel/metric/embedded/embedded.go | 234 + .../otel/metric/instrument.go | 332 + .../go.opentelemetry.io/otel/metric/meter.go | 210 + .../otel/metric/syncfloat64.go | 179 + .../otel/metric/syncint64.go | 179 + .../go.opentelemetry.io/otel/requirements.txt | 1 + .../go.opentelemetry.io/otel/trace/config.go | 17 + vendor/go.opentelemetry.io/otel/trace/noop.go | 4 +- vendor/go.opentelemetry.io/otel/version.go | 2 +- vendor/go.opentelemetry.io/otel/versions.yaml | 15 +- vendor/go.uber.org/atomic/CHANGELOG.md | 10 + vendor/go.uber.org/atomic/bool.go | 2 +- vendor/go.uber.org/atomic/duration.go | 2 +- vendor/go.uber.org/atomic/error.go | 14 +- vendor/go.uber.org/atomic/float32.go | 2 +- vendor/go.uber.org/atomic/float64.go | 2 +- vendor/go.uber.org/atomic/int32.go | 2 +- vendor/go.uber.org/atomic/int64.go | 2 +- vendor/go.uber.org/atomic/pointer_go118.go | 41 +- .../atomic/pointer_go118_pre119.go | 60 + vendor/go.uber.org/atomic/string.go | 23 +- vendor/go.uber.org/atomic/string_ext.go | 15 +- vendor/go.uber.org/atomic/time.go | 2 +- vendor/go.uber.org/atomic/uint32.go | 2 +- vendor/go.uber.org/atomic/uint64.go | 2 +- vendor/go.uber.org/atomic/uintptr.go | 2 +- vendor/go.uber.org/goleak/CHANGELOG.md | 10 +- vendor/go.uber.org/goleak/Makefile | 10 +- vendor/go.uber.org/goleak/README.md | 5 +- .../go.uber.org/goleak/internal/stack/doc.go | 22 + vendor/go.uber.org/multierr/.travis.yml | 23 - vendor/go.uber.org/multierr/CHANGELOG.md | 35 + vendor/go.uber.org/multierr/LICENSE.txt | 2 +- vendor/go.uber.org/multierr/Makefile | 6 +- vendor/go.uber.org/multierr/README.md | 30 +- vendor/go.uber.org/multierr/error.go | 415 +- .../go.uber.org/multierr/error_post_go120.go | 48 + .../multierr/{go113.go => error_pre_go120.go} | 31 +- vendor/go.uber.org/multierr/glide.yaml | 8 - vendor/golang.org/x/exp/slices/slices.go | 55 +- vendor/golang.org/x/exp/slices/sort.go | 59 +- .../x/mod/internal/lazyregexp/lazyre.go | 2 +- vendor/golang.org/x/mod/module/module.go | 30 +- vendor/golang.org/x/mod/module/pseudo.go | 2 +- vendor/golang.org/x/mod/semver/semver.go | 6 +- .../golang.org/x/net/http/httpproxy/proxy.go | 370 + .../x/oauth2/google/appengine_gen1.go | 1 - .../x/oauth2/google/appengine_gen2_flex.go | 1 - .../x/oauth2/internal/client_appengine.go | 1 - .../x/tools/internal/event/tag/tag.go | 59 + .../x/tools/internal/fastwalk/fastwalk.go | 16 +- .../x/tools/internal/gocommand/invoke.go | 146 +- .../x/tools/internal/gocommand/version.go | 18 +- .../x/tools/internal/imports/fix.go | 40 +- .../x/tools/internal/imports/imports.go | 9 +- .../x/tools/internal/imports/mod.go | 12 +- .../x/tools/internal/typeparams/common.go | 21 +- .../google.golang.org/api/internal/version.go | 2 +- vendor/modules.txt | 111 +- 339 files changed, 28625 insertions(+), 4769 deletions(-) create mode 100644 vendor/github.com/aws/aws-sdk-go/aws/auth/bearer/token.go create mode 100644 vendor/github.com/aws/aws-sdk-go/aws/credentials/ssocreds/sso_cached_token.go create mode 100644 vendor/github.com/aws/aws-sdk-go/aws/credentials/ssocreds/token_provider.go create mode 100644 vendor/github.com/aws/aws-sdk-go/service/ssooidc/api.go create mode 100644 vendor/github.com/aws/aws-sdk-go/service/ssooidc/doc.go create mode 100644 vendor/github.com/aws/aws-sdk-go/service/ssooidc/errors.go create mode 100644 vendor/github.com/aws/aws-sdk-go/service/ssooidc/service.go create mode 100644 vendor/github.com/efficientgo/e2e/env_kind.go create mode 100644 vendor/github.com/efficientgo/e2e/host/host.go delete mode 100644 vendor/github.com/go-openapi/jsonpointer/.travis.yml delete mode 100644 vendor/github.com/go-openapi/jsonreference/.travis.yml create mode 100644 vendor/github.com/klauspost/cpuid/v2/.gitignore create mode 100644 vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml create mode 100644 vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt create mode 100644 vendor/github.com/klauspost/cpuid/v2/LICENSE create mode 100644 vendor/github.com/klauspost/cpuid/v2/README.md create mode 100644 vendor/github.com/klauspost/cpuid/v2/cpuid.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/cpuid_386.s create mode 100644 vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s create mode 100644 vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s create mode 100644 vendor/github.com/klauspost/cpuid/v2/detect_arm64.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/detect_ref.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/detect_x86.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/featureid_string.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/test-architectures.sh create mode 100644 vendor/github.com/minio/sha256-simd/.gitignore create mode 100644 vendor/github.com/minio/sha256-simd/LICENSE create mode 100644 vendor/github.com/minio/sha256-simd/README.md create mode 100644 vendor/github.com/minio/sha256-simd/cpuid_other.go create mode 100644 vendor/github.com/minio/sha256-simd/sha256.go create mode 100644 vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.asm create mode 100644 vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.go create mode 100644 vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.s create mode 100644 vendor/github.com/minio/sha256-simd/sha256block_amd64.go create mode 100644 vendor/github.com/minio/sha256-simd/sha256block_amd64.s create mode 100644 vendor/github.com/minio/sha256-simd/sha256block_arm64.go create mode 100644 vendor/github.com/minio/sha256-simd/sha256block_arm64.s create mode 100644 vendor/github.com/minio/sha256-simd/sha256block_other.go create mode 100644 vendor/github.com/minio/sha256-simd/test-architectures.sh create mode 100644 vendor/github.com/prometheus/client_golang/prometheus/vnext.go create mode 100644 vendor/github.com/prometheus/procfs/cpuinfo_loong64.go create mode 100644 vendor/github.com/prometheus/procfs/fs_statfs_notype.go create mode 100644 vendor/github.com/prometheus/procfs/fs_statfs_type.go create mode 100644 vendor/github.com/prometheus/procfs/net_route.go create mode 100644 vendor/github.com/prometheus/procfs/net_wireless.go create mode 100644 vendor/github.com/prometheus/procfs/proc_interrupts.go create mode 100644 vendor/github.com/prometheus/procfs/thread.go create mode 100644 vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/doc.go create mode 100644 vendor/go.opentelemetry.io/otel/.codespellignore create mode 100644 vendor/go.opentelemetry.io/otel/.codespellrc create mode 100644 vendor/go.opentelemetry.io/otel/internal/global/handler.go create mode 100644 vendor/go.opentelemetry.io/otel/internal/global/instruments.go create mode 100644 vendor/go.opentelemetry.io/otel/internal/global/meter.go create mode 100644 vendor/go.opentelemetry.io/otel/metric.go create mode 100644 vendor/go.opentelemetry.io/otel/metric/LICENSE create mode 100644 vendor/go.opentelemetry.io/otel/metric/asyncfloat64.go create mode 100644 vendor/go.opentelemetry.io/otel/metric/asyncint64.go create mode 100644 vendor/go.opentelemetry.io/otel/metric/config.go create mode 100644 vendor/go.opentelemetry.io/otel/metric/doc.go create mode 100644 vendor/go.opentelemetry.io/otel/metric/embedded/embedded.go create mode 100644 vendor/go.opentelemetry.io/otel/metric/instrument.go create mode 100644 vendor/go.opentelemetry.io/otel/metric/meter.go create mode 100644 vendor/go.opentelemetry.io/otel/metric/syncfloat64.go create mode 100644 vendor/go.opentelemetry.io/otel/metric/syncint64.go create mode 100644 vendor/go.opentelemetry.io/otel/requirements.txt create mode 100644 vendor/go.uber.org/atomic/pointer_go118_pre119.go create mode 100644 vendor/go.uber.org/goleak/internal/stack/doc.go delete mode 100644 vendor/go.uber.org/multierr/.travis.yml create mode 100644 vendor/go.uber.org/multierr/error_post_go120.go rename vendor/go.uber.org/multierr/{go113.go => error_pre_go120.go} (66%) delete mode 100644 vendor/go.uber.org/multierr/glide.yaml create mode 100644 vendor/golang.org/x/net/http/httpproxy/proxy.go create mode 100644 vendor/golang.org/x/tools/internal/event/tag/tag.go diff --git a/go.mod b/go.mod index b41694e933..bfd8c859a2 100644 --- a/go.mod +++ b/go.mod @@ -5,9 +5,9 @@ go 1.20 require ( cloud.google.com/go/compute/metadata v0.2.3 cloud.google.com/go/monitoring v1.16.1 - github.com/efficientgo/e2e v0.14.0 + github.com/efficientgo/e2e v0.14.1-0.20230710114240-c316eb95ae5b github.com/go-kit/log v0.2.1 - github.com/go-logr/logr v1.2.3 + github.com/go-logr/logr v1.2.4 github.com/gogo/protobuf v1.3.2 github.com/golang/protobuf v1.5.3 github.com/google/go-cmp v0.5.9 @@ -16,18 +16,18 @@ require ( github.com/grpc-ecosystem/go-grpc-prometheus v1.2.0 github.com/oklog/run v1.1.0 github.com/oklog/ulid v1.3.1 - github.com/prometheus/client_golang v1.14.0 - github.com/prometheus/client_model v0.3.0 - github.com/prometheus/common v0.41.0 + github.com/prometheus/client_golang v1.16.0 + github.com/prometheus/client_model v0.4.0 + github.com/prometheus/common v0.44.0 github.com/prometheus/common/assets v0.2.0 github.com/prometheus/prometheus v1.8.2-0.20211119115433-692a54649ed7 - github.com/thanos-io/thanos v0.25.2 + github.com/thanos-io/thanos v0.32.5 go.uber.org/zap v1.24.0 - golang.org/x/oauth2 v0.10.0 + golang.org/x/oauth2 v0.11.0 golang.org/x/time v0.3.0 - google.golang.org/api v0.128.0 - google.golang.org/genproto v0.0.0-20230711160842-782d3b101e98 - google.golang.org/genproto/googleapis/api v0.0.0-20230711160842-782d3b101e98 + google.golang.org/api v0.132.0 + google.golang.org/genproto v0.0.0-20230717213848-3f92550aa753 + google.golang.org/genproto/googleapis/api v0.0.0-20230717213848-3f92550aa753 google.golang.org/grpc v1.58.3 google.golang.org/protobuf v1.31.0 gopkg.in/alecthomas/kingpin.v2 v2.2.6 @@ -42,48 +42,50 @@ require ( ) require ( - cloud.google.com/go/compute v1.21.0 // indirect + cloud.google.com/go/compute v1.22.0 // indirect github.com/alecthomas/template v0.0.0-20190718012654-fb15b899a751 // indirect github.com/alecthomas/units v0.0.0-20211218093645-b94a6e3cc137 // indirect - github.com/asaskevich/govalidator v0.0.0-20210307081110-f21760c49a8d // indirect - github.com/aws/aws-sdk-go v1.44.159 // indirect + github.com/asaskevich/govalidator v0.0.0-20230301143203-a9d515a09cc2 // indirect + github.com/aws/aws-sdk-go v1.44.327 // indirect github.com/beorn7/perks v1.0.1 // indirect github.com/cespare/xxhash/v2 v2.2.0 // indirect - github.com/davecgh/go-spew v1.1.1 // indirect + github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc // indirect github.com/dennwc/varint v1.0.0 // indirect github.com/edsrzf/mmap-go v1.1.0 // indirect - github.com/efficientgo/core v1.0.0-rc.0 // indirect + github.com/efficientgo/core v1.0.0-rc.2 // indirect github.com/emicklei/go-restful/v3 v3.9.0 // indirect github.com/evanphx/json-patch v4.12.0+incompatible // indirect github.com/evanphx/json-patch/v5 v5.6.0 // indirect github.com/fsnotify/fsnotify v1.6.0 // indirect - github.com/go-logfmt/logfmt v0.5.1 // indirect + github.com/go-logfmt/logfmt v0.6.0 // indirect github.com/go-logr/stdr v1.2.2 // indirect github.com/go-logr/zapr v1.2.3 // indirect github.com/go-openapi/analysis v0.21.4 // indirect - github.com/go-openapi/errors v0.20.3 // indirect - github.com/go-openapi/jsonpointer v0.19.5 // indirect - github.com/go-openapi/jsonreference v0.20.0 // indirect + github.com/go-openapi/errors v0.20.4 // indirect + github.com/go-openapi/jsonpointer v0.20.0 // indirect + github.com/go-openapi/jsonreference v0.20.2 // indirect github.com/go-openapi/loads v0.21.2 // indirect - github.com/go-openapi/spec v0.20.7 // indirect - github.com/go-openapi/strfmt v0.21.3 // indirect - github.com/go-openapi/swag v0.22.3 // indirect - github.com/go-openapi/validate v0.22.0 // indirect + github.com/go-openapi/spec v0.20.9 // indirect + github.com/go-openapi/strfmt v0.21.7 // indirect + github.com/go-openapi/swag v0.22.4 // indirect + github.com/go-openapi/validate v0.22.1 // indirect github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da // indirect github.com/golang/snappy v0.0.4 // indirect github.com/google/gnostic v0.5.7-v3refs // indirect github.com/google/gofuzz v1.2.0 // indirect github.com/google/s2a-go v0.1.4 // indirect github.com/google/uuid v1.3.0 // indirect - github.com/googleapis/enterprise-certificate-proxy v0.2.4 // indirect + github.com/googleapis/enterprise-certificate-proxy v0.2.5 // indirect github.com/grafana/regexp v0.0.0-20221122212121-6b5c0a4cb7fd // indirect github.com/imdario/mergo v0.3.12 // indirect github.com/jmespath/go-jmespath v0.4.0 // indirect github.com/josharian/intern v1.0.0 // indirect github.com/jpillora/backoff v1.0.0 // indirect github.com/json-iterator/go v1.1.12 // indirect + github.com/klauspost/cpuid/v2 v2.2.5 // indirect github.com/mailru/easyjson v0.7.7 // indirect github.com/matttproud/golang_protobuf_extensions v1.0.4 // indirect + github.com/minio/sha256-simd v1.0.1 // indirect github.com/mitchellh/mapstructure v1.5.0 // indirect github.com/moby/spdystream v0.2.0 // indirect github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect @@ -91,31 +93,32 @@ require ( github.com/munnerz/goautoneg v0.0.0-20191010083416-a7dc8b61c822 // indirect github.com/mwitkow/go-conntrack v0.0.0-20190716064945-2f068394615f // indirect github.com/pkg/errors v0.9.1 // indirect - github.com/pmezard/go-difflib v1.0.0 // indirect + github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 // indirect github.com/prometheus/alertmanager v0.25.1 // indirect github.com/prometheus/common/sigv4 v0.1.0 // indirect - github.com/prometheus/procfs v0.8.0 // indirect + github.com/prometheus/procfs v0.11.1 // indirect github.com/spf13/pflag v1.0.5 // indirect - github.com/stretchr/testify v1.8.1 // indirect - go.mongodb.org/mongo-driver v1.11.0 // indirect + github.com/stretchr/testify v1.8.4 // indirect + go.mongodb.org/mongo-driver v1.12.0 // indirect go.opencensus.io v0.24.0 // indirect - go.opentelemetry.io/otel v1.11.2 // indirect - go.opentelemetry.io/otel/trace v1.11.2 // indirect - go.uber.org/atomic v1.10.0 // indirect - go.uber.org/goleak v1.2.0 // indirect - go.uber.org/multierr v1.6.0 // indirect + go.opentelemetry.io/otel v1.16.0 // indirect + go.opentelemetry.io/otel/metric v1.16.0 // indirect + go.opentelemetry.io/otel/trace v1.16.0 // indirect + go.uber.org/atomic v1.11.0 // indirect + go.uber.org/goleak v1.2.1 // indirect + go.uber.org/multierr v1.11.0 // indirect golang.org/x/crypto v0.14.0 // indirect - golang.org/x/exp v0.0.0-20221212164502-fae10dda9338 // indirect - golang.org/x/mod v0.9.0 // indirect + golang.org/x/exp v0.0.0-20230713183714-613f0c0eb8a1 // indirect + golang.org/x/mod v0.12.0 // indirect golang.org/x/net v0.17.0 // indirect golang.org/x/sync v0.3.0 // indirect golang.org/x/sys v0.13.0 // indirect golang.org/x/term v0.13.0 // indirect golang.org/x/text v0.13.0 // indirect - golang.org/x/tools v0.6.0 // indirect + golang.org/x/tools v0.11.0 // indirect gomodules.xyz/jsonpatch/v2 v2.2.0 // indirect google.golang.org/appengine v1.6.7 // indirect - google.golang.org/genproto/googleapis/rpc v0.0.0-20230711160842-782d3b101e98 // indirect + google.golang.org/genproto/googleapis/rpc v0.0.0-20230717213848-3f92550aa753 // indirect gopkg.in/inf.v0 v0.9.1 // indirect k8s.io/apiextensions-apiserver v0.26.1 // indirect k8s.io/component-base v0.26.1 // indirect diff --git a/go.sum b/go.sum index 0bbdbc95a2..3c8808f553 100644 --- a/go.sum +++ b/go.sum @@ -19,8 +19,8 @@ cloud.google.com/go/bigquery v1.4.0/go.mod h1:S8dzgnTigyfTmLBfrtrhyYhwRxG72rYxvf cloud.google.com/go/bigquery v1.5.0/go.mod h1:snEHRnqQbz117VIFhE8bmtwIDY80NLUZUMb4Nv6dBIg= cloud.google.com/go/bigquery v1.7.0/go.mod h1://okPTzCYNXSlb24MZs83e2Do+h+VXtc4gLoIoXIAPc= cloud.google.com/go/bigquery v1.8.0/go.mod h1:J5hqkt3O0uAFnINi6JXValWIb1v0goeZM77hZzJN/fQ= -cloud.google.com/go/compute v1.21.0 h1:JNBsyXVoOoNJtTQcnEY5uYpZIbeCTYIeDe0Xh1bySMk= -cloud.google.com/go/compute v1.21.0/go.mod h1:4tCnrn48xsqlwSAiLf1HXMQk8CONslYbdiEZc9FEIbM= +cloud.google.com/go/compute v1.22.0 h1:cB8R6FtUtT1TYGl5R3xuxnW6OUIc/DrT2aiR16TTG7Y= +cloud.google.com/go/compute v1.22.0/go.mod h1:4tCnrn48xsqlwSAiLf1HXMQk8CONslYbdiEZc9FEIbM= cloud.google.com/go/compute/metadata v0.2.3 h1:mg4jlk7mCAj6xXp9UJ4fjI9VUI5rubuGBW5aJ7UnBMY= cloud.google.com/go/compute/metadata v0.2.3/go.mod h1:VAV5nSsACxMJvgaAuX6Pk2AawlZn8kiOGuCv6gTkwuA= cloud.google.com/go/datastore v1.0.0/go.mod h1:LXYbyblFSglQ5pkeyhO+Qmw7ukd3C+pD7TKLgZqpHYE= @@ -63,11 +63,11 @@ github.com/antihax/optional v1.0.0/go.mod h1:uupD/76wgC+ih3iEmQUL+0Ugr19nfwCT1kd github.com/armon/go-metrics v0.3.10 h1:FR+drcQStOe+32sYyJYyZ7FIdgoGGBnwLl+flodp8Uo= github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5 h1:0CwZNZbxp69SHPdPJAN/hZIm0C4OItdklCFmMRWYpio= github.com/asaskevich/govalidator v0.0.0-20200907205600-7a23bdc65eef/go.mod h1:WaHUgvxTVq04UNunO+XhnAqY/wQc+bxr74GqbsZ/Jqw= -github.com/asaskevich/govalidator v0.0.0-20210307081110-f21760c49a8d h1:Byv0BzEl3/e6D5CLfI0j/7hiIEtvGVFPCZ7Ei2oq8iQ= -github.com/asaskevich/govalidator v0.0.0-20210307081110-f21760c49a8d/go.mod h1:WaHUgvxTVq04UNunO+XhnAqY/wQc+bxr74GqbsZ/Jqw= +github.com/asaskevich/govalidator v0.0.0-20230301143203-a9d515a09cc2 h1:DklsrG3dyBCFEj5IhUbnKptjxatkF07cF2ak3yi77so= +github.com/asaskevich/govalidator v0.0.0-20230301143203-a9d515a09cc2/go.mod h1:WaHUgvxTVq04UNunO+XhnAqY/wQc+bxr74GqbsZ/Jqw= github.com/aws/aws-sdk-go v1.38.35/go.mod h1:hcU610XS61/+aQV88ixoOzUoG7v3b31pl2zKMmprdro= -github.com/aws/aws-sdk-go v1.44.159 h1:9odtuHAYQE9tQKyuX6ny1U1MHeH5/yzeCJi96g9H4DU= -github.com/aws/aws-sdk-go v1.44.159/go.mod h1:aVsgQcEevwlmQ7qHE9I3h+dtQgpqhFB+i8Phjh7fkwI= +github.com/aws/aws-sdk-go v1.44.327 h1:ZS8oO4+7MOBLhkdwIhgtVeDzCeWOlTfKJS7EgggbIEY= +github.com/aws/aws-sdk-go v1.44.327/go.mod h1:aVsgQcEevwlmQ7qHE9I3h+dtQgpqhFB+i8Phjh7fkwI= github.com/benbjohnson/clock v1.1.0/go.mod h1:J11/hYXuz8f4ySSvYwY0FKfm+ezbsZBKZxNJlLklBHA= github.com/benbjohnson/clock v1.3.0 h1:ip6w0uFQkncKQ979AypyG0ER7mqUSBdKLOgAle/AT8A= github.com/beorn7/perks v0.0.0-20180321164747-3a771d992973/go.mod h1:Dwedo/Wpr24TaqPxmxbtue+5NUziq4I4S80YR8gNf3Q= @@ -91,8 +91,9 @@ github.com/cncf/xds/go v0.0.0-20211011173535-cb28da3451f1/go.mod h1:eXthEFrGJvWH github.com/cncf/xds/go v0.0.0-20230607035331-e9ce68804cb4 h1:/inchEIKaYC1Akx+H+gqO04wryn5h75LSazbRlnya1k= github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= -github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= +github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc h1:U9qPSI2PIWSS1VwoXQT9A3Wy9MM3WgvqSxFWenqJduM= +github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/dennwc/varint v1.0.0 h1:kGNFFSSw8ToIy3obO/kKr8U9GZYUAxQEVuix4zfDWzE= github.com/dennwc/varint v1.0.0/go.mod h1:hnItb35rvZvJrbTALZtY/iQfDs48JKRG1RPpgziApxA= github.com/digitalocean/godo v1.91.1 h1:1o30VOCu1aC6488qBd0SkQiBeAZ35RSTvLwCA1pQMhc= @@ -103,10 +104,10 @@ github.com/docker/go-units v0.5.0 h1:69rxXcBk27SvSaaxTtLh/8llcHD8vYHT7WSdRZ/jvr4 github.com/docopt/docopt-go v0.0.0-20180111231733-ee0de3bc6815/go.mod h1:WwZ+bS3ebgob9U8Nd0kOddGdZWjyMGR8Wziv+TBNwSE= github.com/edsrzf/mmap-go v1.1.0 h1:6EUwBLQ/Mcr1EYLE4Tn1VdW1A4ckqCQWZBw8Hr0kjpQ= github.com/edsrzf/mmap-go v1.1.0/go.mod h1:19H/e8pUPLicwkyNgOykDXkJ9F0MHE+Z52B8EIth78Q= -github.com/efficientgo/core v1.0.0-rc.0 h1:jJoA0N+C4/knWYVZ6GrdHOtDyrg8Y/TR4vFpTaqTsqs= -github.com/efficientgo/core v1.0.0-rc.0/go.mod h1:kQa0V74HNYMfuJH6jiPiwNdpWXl4xd/K4tzlrcvYDQI= -github.com/efficientgo/e2e v0.14.0 h1:Jxgeus4nq4COPhACC7nYRTKX1BTzSS86Z/Z2sW9W+kE= -github.com/efficientgo/e2e v0.14.0/go.mod h1:Hi+sz0REtlhVZ8zcdeTC3j6LUEEpJpPtNjOaOKuNcgI= +github.com/efficientgo/core v1.0.0-rc.2 h1:7j62qHLnrZqO3V3UA0AqOGd5d5aXV3AX6m/NZBHp78I= +github.com/efficientgo/core v1.0.0-rc.2/go.mod h1:FfGdkzWarkuzOlY04VY+bGfb1lWrjaL6x/GLcQ4vJps= +github.com/efficientgo/e2e v0.14.1-0.20230710114240-c316eb95ae5b h1:8VX23BNufsa4KCqnnEonvI3yrou2Pjp8JLcbdVn0Fs8= +github.com/efficientgo/e2e v0.14.1-0.20230710114240-c316eb95ae5b/go.mod h1:plsKU0YHE9uX+7utvr7SiDtVBSHJyEfHRO4UnUgDmts= github.com/elazarl/goproxy v0.0.0-20180725130230-947c36da3153 h1:yUdfgN0XgIJw7foRItutHYUIhlcKzcSf5vDpdhQAKTc= github.com/emicklei/go-restful/v3 v3.9.0 h1:XwGDlfxEnQZzuopoqxwSEllNcCOM9DhhFyhFIIGKwxE= github.com/emicklei/go-restful/v3 v3.9.0/go.mod h1:6n3XBCmQQb25CM2LCACGz8ukIrRry+4bhvbpWn3mrbc= @@ -138,13 +139,13 @@ github.com/go-kit/log v0.2.1/go.mod h1:NwTd00d/i8cPZ3xOwwiv2PO5MOcx78fFErGNcVmBj github.com/go-logfmt/logfmt v0.3.0/go.mod h1:Qt1PoO58o5twSAckw1HlFXLmHsOX5/0LbT9GBnD5lWE= github.com/go-logfmt/logfmt v0.4.0/go.mod h1:3RMwSq7FuexP4Kalkev3ejPJsZTpXXBr9+V4qmtdjCk= github.com/go-logfmt/logfmt v0.5.0/go.mod h1:wCYkCAKZfumFQihp8CzCvQ3paCTfi41vtzG1KdI/P7A= -github.com/go-logfmt/logfmt v0.5.1 h1:otpy5pqBCBZ1ng9RQ0dPu4PN7ba75Y/aA+UpowDyNVA= -github.com/go-logfmt/logfmt v0.5.1/go.mod h1:WYhtIu8zTZfxdn5+rREduYbwxfcBr/Vr6KEVveWlfTs= +github.com/go-logfmt/logfmt v0.6.0 h1:wGYYu3uicYdqXVgoYbvnkrPVXkuLM1p1ifugDMEdRi4= +github.com/go-logfmt/logfmt v0.6.0/go.mod h1:WYhtIu8zTZfxdn5+rREduYbwxfcBr/Vr6KEVveWlfTs= github.com/go-logr/logr v0.2.0/go.mod h1:z6/tIYblkpsD+a4lm/fGIIU9mZ+XfAiaFtq7xTgseGU= github.com/go-logr/logr v1.2.0/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbVz/1A= github.com/go-logr/logr v1.2.2/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbVz/1A= -github.com/go-logr/logr v1.2.3 h1:2DntVwHkVopvECVRSlL5PSo9eG+cAkDCuckLubN+rq0= -github.com/go-logr/logr v1.2.3/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbVz/1A= +github.com/go-logr/logr v1.2.4 h1:g01GSCwiDw2xSZfjJ2/T9M+S6pFdcNtFYsp+Y43HYDQ= +github.com/go-logr/logr v1.2.4/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbVz/1A= github.com/go-logr/stdr v1.2.2 h1:hSWxHoqTgW2S2qGc0LTAI563KZ5YKYRhT3MFKZMbjag= github.com/go-logr/stdr v1.2.2/go.mod h1:mMo/vtBO5dYbehREoey6XUKy/eSumjCCveDpRre4VKE= github.com/go-logr/zapr v1.2.3 h1:a9vnzlIBPQBBkeaR9IuMUfmVOrQlkoC4YfPoFkX3T7A= @@ -155,32 +156,37 @@ github.com/go-openapi/analysis v0.21.4/go.mod h1:4zQ35W4neeZTqh3ol0rv/O8JBbka9Qy github.com/go-openapi/errors v0.19.8/go.mod h1:cM//ZKUKyO06HSwqAelJ5NsEMMcpa6VpXe8DOa1Mi1M= github.com/go-openapi/errors v0.19.9/go.mod h1:cM//ZKUKyO06HSwqAelJ5NsEMMcpa6VpXe8DOa1Mi1M= github.com/go-openapi/errors v0.20.2/go.mod h1:cM//ZKUKyO06HSwqAelJ5NsEMMcpa6VpXe8DOa1Mi1M= -github.com/go-openapi/errors v0.20.3 h1:rz6kiC84sqNQoqrtulzaL/VERgkoCyB6WdEkc2ujzUc= -github.com/go-openapi/errors v0.20.3/go.mod h1:Z3FlZ4I8jEGxjUK+bugx3on2mIAk4txuAOhlsB1FSgk= +github.com/go-openapi/errors v0.20.4 h1:unTcVm6PispJsMECE3zWgvG4xTiKda1LIR5rCRWLG6M= +github.com/go-openapi/errors v0.20.4/go.mod h1:Z3FlZ4I8jEGxjUK+bugx3on2mIAk4txuAOhlsB1FSgk= github.com/go-openapi/jsonpointer v0.19.3/go.mod h1:Pl9vOtqEWErmShwVjC8pYs9cog34VGT37dQOVbmoatg= -github.com/go-openapi/jsonpointer v0.19.5 h1:gZr+CIYByUqjcgeLXnQu2gHYQC9o73G2XUeOFYEICuY= github.com/go-openapi/jsonpointer v0.19.5/go.mod h1:Pl9vOtqEWErmShwVjC8pYs9cog34VGT37dQOVbmoatg= +github.com/go-openapi/jsonpointer v0.19.6/go.mod h1:osyAmYz/mB/C3I+WsTTSgw1ONzaLJoLCyoi6/zppojs= +github.com/go-openapi/jsonpointer v0.20.0 h1:ESKJdU9ASRfaPNOPRx12IUyA1vn3R9GiE3KYD14BXdQ= +github.com/go-openapi/jsonpointer v0.20.0/go.mod h1:6PGzBjjIIumbLYysB73Klnms1mwnU4G3YHOECG3CedA= github.com/go-openapi/jsonreference v0.19.6/go.mod h1:diGHMEHg2IqXZGKxqyvWdfWU/aim5Dprw5bqpKkTvns= -github.com/go-openapi/jsonreference v0.20.0 h1:MYlu0sBgChmCfJxxUKZ8g1cPWFOB37YSZqewK7OKeyA= github.com/go-openapi/jsonreference v0.20.0/go.mod h1:Ag74Ico3lPc+zR+qjn4XBUmXymS4zJbYVCZmcgkasdo= +github.com/go-openapi/jsonreference v0.20.2 h1:3sVjiK66+uXK/6oQ8xgcRKcFgQ5KXa2KvnJRumpMGbE= +github.com/go-openapi/jsonreference v0.20.2/go.mod h1:Bl1zwGIM8/wsvqjsOQLJ/SH+En5Ap4rVB5KVcIDZG2k= github.com/go-openapi/loads v0.21.1/go.mod h1:/DtAMXXneXFjbQMGEtbamCZb+4x7eGwkvZCvBmwUG+g= github.com/go-openapi/loads v0.21.2 h1:r2a/xFIYeZ4Qd2TnGpWDIQNcP80dIaZgf704za8enro= github.com/go-openapi/loads v0.21.2/go.mod h1:Jq58Os6SSGz0rzh62ptiu8Z31I+OTHqmULx5e/gJbNw= github.com/go-openapi/spec v0.20.4/go.mod h1:faYFR1CvsJZ0mNsmsphTMSoRrNV3TEDoAM7FOEWeq8I= github.com/go-openapi/spec v0.20.6/go.mod h1:2OpW+JddWPrpXSCIX8eOx7lZ5iyuWj3RYR6VaaBKcWA= -github.com/go-openapi/spec v0.20.7 h1:1Rlu/ZrOCCob0n+JKKJAWhNWMPW8bOZRg8FJaY+0SKI= -github.com/go-openapi/spec v0.20.7/go.mod h1:2OpW+JddWPrpXSCIX8eOx7lZ5iyuWj3RYR6VaaBKcWA= +github.com/go-openapi/spec v0.20.9 h1:xnlYNQAwKd2VQRRfwTEI0DcK+2cbuvI/0c7jx3gA8/8= +github.com/go-openapi/spec v0.20.9/go.mod h1:2OpW+JddWPrpXSCIX8eOx7lZ5iyuWj3RYR6VaaBKcWA= github.com/go-openapi/strfmt v0.21.0/go.mod h1:ZRQ409bWMj+SOgXofQAGTIo2Ebu72Gs+WaRADcS5iNg= github.com/go-openapi/strfmt v0.21.1/go.mod h1:I/XVKeLc5+MM5oPNN7P6urMOpuLXEcNrCX/rPGuWb0k= -github.com/go-openapi/strfmt v0.21.3 h1:xwhj5X6CjXEZZHMWy1zKJxvW9AfHC9pkyUjLvHtKG7o= github.com/go-openapi/strfmt v0.21.3/go.mod h1:k+RzNO0Da+k3FrrynSNN8F7n/peCmQQqbbXjtDfvmGg= +github.com/go-openapi/strfmt v0.21.7 h1:rspiXgNWgeUzhjo1YU01do6qsahtJNByjLVbPLNHb8k= +github.com/go-openapi/strfmt v0.21.7/go.mod h1:adeGTkxE44sPyLk0JV235VQAO/ZXUr8KAzYjclFs3ew= github.com/go-openapi/swag v0.19.5/go.mod h1:POnQmlKehdgb5mhVOsnJFsivZCEZ/vjK9gh66Z9tfKk= github.com/go-openapi/swag v0.19.15/go.mod h1:QYRuS/SOXUCsnplDa677K7+DxSOj6IPNl/eQntq43wQ= github.com/go-openapi/swag v0.21.1/go.mod h1:QYRuS/SOXUCsnplDa677K7+DxSOj6IPNl/eQntq43wQ= -github.com/go-openapi/swag v0.22.3 h1:yMBqmnQ0gyZvEb/+KzuWZOXgllrXT4SADYbvDaXHv/g= github.com/go-openapi/swag v0.22.3/go.mod h1:UzaqsxGiab7freDnrUUra0MwWfN/q7tE4j+VcZ0yl14= -github.com/go-openapi/validate v0.22.0 h1:b0QecH6VslW/TxtpKgzpO1SNG7GU2FsaqKdP1E2T50Y= -github.com/go-openapi/validate v0.22.0/go.mod h1:rjnrwK57VJ7A8xqfpAOEKRH8yQSGUriMu5/zuPSQ1hg= +github.com/go-openapi/swag v0.22.4 h1:QLMzNJnMGPRNDCbySlcj1x01tzU8/9LTTL9hZZZogBU= +github.com/go-openapi/swag v0.22.4/go.mod h1:UzaqsxGiab7freDnrUUra0MwWfN/q7tE4j+VcZ0yl14= +github.com/go-openapi/validate v0.22.1 h1:G+c2ub6q47kfX1sOBLwIQwzBVt8qmOAARyo/9Fqs9NU= +github.com/go-openapi/validate v0.22.1/go.mod h1:rjnrwK57VJ7A8xqfpAOEKRH8yQSGUriMu5/zuPSQ1hg= github.com/go-resty/resty/v2 v2.1.1-0.20191201195748-d7b97669fe48 h1:JVrqSeQfdhYRFk24TvhTZWU0q8lfCojxZQFi3Ou7+uY= github.com/go-stack/stack v1.8.0/go.mod h1:v0f6uXyyMGvRgIKkXu+yp6POWl0qKG85gN/melR3HDY= github.com/go-zookeeper/zk v1.0.3 h1:7M2kwOsc//9VeeFiPtf+uSJlVpU66x9Ba5+8XK7/TDg= @@ -286,8 +292,8 @@ github.com/google/uuid v1.1.1/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+ github.com/google/uuid v1.1.2/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/google/uuid v1.3.0 h1:t6JiXgmwXMjEs8VusXIJk2BXHsn+wx8BZdTaoZ5fu7I= github.com/google/uuid v1.3.0/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= -github.com/googleapis/enterprise-certificate-proxy v0.2.4 h1:uGy6JWR/uMIILU8wbf+OkstIrNiMjGpEIyhx8f6W7s4= -github.com/googleapis/enterprise-certificate-proxy v0.2.4/go.mod h1:AwSRAtLfXpU5Nm3pW+v7rGDHp09LsPtGY9MduiEsR9k= +github.com/googleapis/enterprise-certificate-proxy v0.2.5 h1:UR4rDjcgpgEnqpIEvkiqTYKBCKLNmlge2eVjoZfySzM= +github.com/googleapis/enterprise-certificate-proxy v0.2.5/go.mod h1:RxW0N9901Cko1VOCW3SXCpWP+mlIEkk2tP7jnHy9a3w= github.com/googleapis/gax-go/v2 v2.0.4/go.mod h1:0Wqv26UfaUD9n4G6kQubkQ+KchISgw+vpHVxEJEs9eg= github.com/googleapis/gax-go/v2 v2.0.5/go.mod h1:DWXyrwAJ9X0FpwwEdw+IPEYBICEFu5mhpdKc/us6bOk= github.com/googleapis/gax-go/v2 v2.12.0 h1:A+gCJKdRfqXkr+BIRGtZLibNXf0m1f9E4HG56etFpas= @@ -342,6 +348,8 @@ github.com/karrick/godirwalk v1.10.3/go.mod h1:RoGL9dQei4vP9ilrpETWE8CLOZ1kiN0Lh github.com/kisielk/errcheck v1.5.0/go.mod h1:pFxgyoBC7bSaBwPgfKdkLd5X25qrDl4LWUI2bnpBCr8= github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck= github.com/klauspost/compress v1.13.6/go.mod h1:/3/Vjq9QcHkK5uEr5lBEmyoZ1iFhe47etQ6QUkpK6sk= +github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg= +github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= github.com/kolo/xmlrpc v0.0.0-20220921171641-a4b6fa1dd06b h1:udzkj9S/zlT5X367kqJis0QP7YMxobob6zhzq6Yre00= github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= github.com/konsorten/go-windows-terminal-sequences v1.0.2/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= @@ -349,7 +357,8 @@ github.com/konsorten/go-windows-terminal-sequences v1.0.3/go.mod h1:T0+1ngSBFLxv github.com/kr/logfmt v0.0.0-20140226030751-b84e30acd515/go.mod h1:+0opPa2QZZtGFBFZlji/RkVcI2GknAs/DXo4wKdlNEc= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= github.com/kr/pretty v0.2.0/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI= -github.com/kr/pretty v0.2.1 h1:Fmg33tUaq4/8ym9TJN1x7sLJnHVwhP33CNkpYV/7rwI= +github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI= +github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE= github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ= github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI= github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY= @@ -367,7 +376,9 @@ github.com/mattn/go-isatty v0.0.14 h1:yVuAays6BHfxijgZPzw+3Zlu5yQgKGP2/hcQbHb7S9 github.com/matttproud/golang_protobuf_extensions v1.0.1/go.mod h1:D8He9yQNgCq6Z5Ld7szi9bcBfOoFv/3dc6xSMkL2PC0= github.com/matttproud/golang_protobuf_extensions v1.0.4 h1:mmDVorXM7PCGKw94cs5zkfA9PSy5pEvNWRP0ET0TIVo= github.com/matttproud/golang_protobuf_extensions v1.0.4/go.mod h1:BSXmuO+STAnVfrANrmjBb36TMTDstsz7MSK+HVaYKv4= -github.com/miekg/dns v1.1.50 h1:DQUfb9uc6smULcREF09Uc+/Gd46YWqJd5DbpPE9xkcA= +github.com/miekg/dns v1.1.55 h1:GoQ4hpsj0nFLYe+bWiCToyrBEJXkQfOOIvFGFy0lEgo= +github.com/minio/sha256-simd v1.0.1 h1:6kaan5IFmwTNynnKKpDHe6FWHohJOHhCPchzK49dzMM= +github.com/minio/sha256-simd v1.0.1/go.mod h1:Pz6AKMiUdngCLpeTL/RJY1M9rUuPMYujV5xJjtbRSN8= github.com/mitchellh/go-homedir v1.1.0 h1:lukF9ziXFxDFPkA1vsr5zpc1XuPDn/wFntq5mG+4E0Y= github.com/mitchellh/mapstructure v1.3.3/go.mod h1:bFUtVrKA4DC2yAKiSyO/QUcy7e+RRV2QTWOzhPopBRo= github.com/mitchellh/mapstructure v1.4.1/go.mod h1:bFUtVrKA4DC2yAKiSyO/QUcy7e+RRV2QTWOzhPopBRo= @@ -393,8 +404,9 @@ github.com/oklog/run v1.1.0 h1:GEenZ1cK0+q0+wsJew9qUg/DyD8k3JzYsZAi5gYi2mA= github.com/oklog/run v1.1.0/go.mod h1:sVPdnTZT1zYwAJeCMu2Th4T21pA3FPOQRfWjQlk7DVU= github.com/oklog/ulid v1.3.1 h1:EGfNDEx6MqHz8B3uNV6QAib1UR2Lm97sHi3ocA6ESJ4= github.com/oklog/ulid v1.3.1/go.mod h1:CirwcVhetQ6Lv90oh/F+FBtV6XMibvdAFo93nm5qn4U= +github.com/onsi/ginkgo v1.16.5 h1:8xi0RTUf59SOSfEtZMvwTvXYMzG4gV23XVHOZiXNtnE= github.com/onsi/ginkgo/v2 v2.6.0 h1:9t9b9vRUbFq3C4qKFCGkVuq/fIHji802N1nrtkh1mNc= -github.com/onsi/gomega v1.24.1 h1:KORJXNNTzJXzu4ScJWssJfJMnJ+2QJqhoQSRwNlze9E= +github.com/onsi/gomega v1.27.10 h1:naR28SdDFlqrG6kScpT8VWpu1xWY5nJRCF3XaYyBjhI= github.com/opencontainers/go-digest v1.0.0 h1:apOUWs51W5PlhuyGyz9FCeeBIOUDA/6nW8Oi/yOhh5U= github.com/opencontainers/image-spec v1.0.2 h1:9yCKha/T5XdGtO0q9Q9a6T5NUCsTn/DrBg0D7ufOcFM= github.com/ovh/go-ovh v1.3.0 h1:mvZaddk4E4kLcXhzb+cxBsMPYp2pHqiQpWYkInsuZPQ= @@ -403,28 +415,29 @@ github.com/pkg/errors v0.8.0/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINE github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= -github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= +github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 h1:Jamvg5psRIccs7FGNTlIRMkT8wgtp5eCXdBlqhYGL6U= +github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/prometheus/alertmanager v0.25.1 h1:LGBNMspOfv8h7brb+LWj2wnwBCg2ZuuKWTh6CAVw2/Y= github.com/prometheus/alertmanager v0.25.1/go.mod h1:MEZ3rFVHqKZsw7IcNS/m4AWZeXThmJhumpiWR4eHU/w= github.com/prometheus/client_golang v0.9.1/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXPKyh/dDVn+NZz0KFw= github.com/prometheus/client_golang v1.0.0/go.mod h1:db9x61etRT2tGnBNRi70OPL5FsnadC4Ky3P0J6CfImo= github.com/prometheus/client_golang v1.7.1/go.mod h1:PY5Wy2awLA44sXw4AOSfFBetzPP4j5+D6mVACh+pe2M= github.com/prometheus/client_golang v1.11.0/go.mod h1:Z6t4BnS23TR94PD6BsDNk8yVqroYurpAkEiz0P2BEV0= -github.com/prometheus/client_golang v1.14.0 h1:nJdhIvne2eSX/XRAFV9PcvFFRbrjbcTUj0VP62TMhnw= -github.com/prometheus/client_golang v1.14.0/go.mod h1:8vpkKitgIVNcqrRBWh1C4TIUQgYNtG/XQE4E/Zae36Y= +github.com/prometheus/client_golang v1.16.0 h1:yk/hx9hDbrGHovbci4BY+pRMfSuuat626eFsHb7tmT8= +github.com/prometheus/client_golang v1.16.0/go.mod h1:Zsulrv/L9oM40tJ7T815tM89lFEugiJ9HzIqaAx4LKc= github.com/prometheus/client_model v0.0.0-20180712105110-5c3871d89910/go.mod h1:MbSGuTsp3dbXC40dX6PRTWyKYBIrTGTE9sqQNg2J8bo= github.com/prometheus/client_model v0.0.0-20190129233127-fd36f4220a90/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA= github.com/prometheus/client_model v0.0.0-20190812154241-14fe0d1b01d4/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA= github.com/prometheus/client_model v0.2.0/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA= -github.com/prometheus/client_model v0.3.0 h1:UBgGFHqYdG/TPFD1B1ogZywDqEkwp3fBMvqdiQ7Xew4= -github.com/prometheus/client_model v0.3.0/go.mod h1:LDGWKZIo7rky3hgvBe+caln+Dr3dPggB5dvjtD7w9+w= +github.com/prometheus/client_model v0.4.0 h1:5lQXD3cAg1OXBf4Wq03gTrXHeaV0TQvGfUooCfx1yqY= +github.com/prometheus/client_model v0.4.0/go.mod h1:oMQmHW1/JoDwqLtg57MGgP/Fb1CJEYF2imWWhWtMkYU= github.com/prometheus/common v0.4.1/go.mod h1:TNfzLD0ON7rHzMJeJkieUDPYmFC7Snx/y86RQel1bk4= github.com/prometheus/common v0.10.0/go.mod h1:Tlit/dnDKsSWFlCLTWaA1cyBgKHSMdTB80sz/V91rCo= github.com/prometheus/common v0.26.0/go.mod h1:M7rCNAaPfAosfx8veZJCuw84e35h3Cfd9VFqTh1DIvc= github.com/prometheus/common v0.29.0/go.mod h1:vu+V0TpY+O6vW9J44gczi3Ap/oXXR10b+M/gUGO4Hls= -github.com/prometheus/common v0.41.0 h1:npo01n6vUlRViIj5fgwiK8vlNIh8bnoxqh3gypKsyAw= -github.com/prometheus/common v0.41.0/go.mod h1:xBwqVerjNdUDjgODMpudtOMwlOwf2SaTr1yjz4b7Zbc= +github.com/prometheus/common v0.44.0 h1:+5BrQJwiBB9xsMygAB3TNvpQKOwlkc25LbISbrdOOfY= +github.com/prometheus/common v0.44.0/go.mod h1:ofAIvZbQ1e/nugmZGz4/qCb9Ap1VoSTIO7x0VV9VvuY= github.com/prometheus/common/assets v0.2.0 h1:0P5OrzoHrYBOSM1OigWL3mY8ZvV2N4zIE/5AahrSrfM= github.com/prometheus/common/assets v0.2.0/go.mod h1:D17UVUE12bHbim7HzwUvtqm6gwBEaDQ0F+hIGbFbccI= github.com/prometheus/common/sigv4 v0.1.0 h1:qoVebwtwwEhS85Czm2dSROY5fTo2PAPEVdDeppTwGX4= @@ -433,21 +446,22 @@ github.com/prometheus/procfs v0.0.0-20181005140218-185b4288413d/go.mod h1:c3At6R github.com/prometheus/procfs v0.0.2/go.mod h1:TjEm7ze935MbeOT/UhFTIMYKhuLP4wbCsTZCD3I8kEA= github.com/prometheus/procfs v0.1.3/go.mod h1:lV6e/gmhEcM9IjHGsFOCxxuZ+z1YqCvr4OA4YeYWdaU= github.com/prometheus/procfs v0.6.0/go.mod h1:cz+aTbrPOrUb4q7XlbU9ygM+/jj0fzG6c1xBZuNvfVA= -github.com/prometheus/procfs v0.8.0 h1:ODq8ZFEaYeCaZOJlZZdJA2AbQR98dSHSM1KW/You5mo= -github.com/prometheus/procfs v0.8.0/go.mod h1:z7EfXMXOkbkqb9IINtpCn86r/to3BnA0uaxHdg830/4= +github.com/prometheus/procfs v0.11.1 h1:xRC8Iq1yyca5ypa9n1EZnWZkt7dwcoRPQwX/5gwaUuI= +github.com/prometheus/procfs v0.11.1/go.mod h1:eesXgaPo1q7lBpVMoMy0ZOFTth9hBn4W/y0/p/ScXhY= github.com/prometheus/prometheus v0.41.0 h1:+QR4QpzwE54zsKk2K7EUkof3tHxa3b/fyw7xJ4jR1Ns= github.com/prometheus/prometheus v0.41.0/go.mod h1:Uu5817xm7ibU/VaDZ9pu1ssGzcpO9Bd+LyoZ76RpHyo= github.com/rogpeppe/fastuuid v1.2.0/go.mod h1:jVj6XXZzXRy/MSR5jhDC/2q6DgLz+nrA6LYCDYWNEvQ= github.com/rogpeppe/go-internal v1.1.0/go.mod h1:M8bDsm7K2OlrFYOpmOWEs/qY81heoFRclV5y23lUDJ4= github.com/rogpeppe/go-internal v1.2.2/go.mod h1:M8bDsm7K2OlrFYOpmOWEs/qY81heoFRclV5y23lUDJ4= github.com/rogpeppe/go-internal v1.3.0/go.mod h1:M8bDsm7K2OlrFYOpmOWEs/qY81heoFRclV5y23lUDJ4= +github.com/rogpeppe/go-internal v1.10.0 h1:TMyTOH3F/DB16zRVcYyreMH6GnZZrwQVAoYjRBZyWFQ= github.com/scaleway/scaleway-sdk-go v1.0.0-beta.10 h1:wsfMs0iv+MJiViM37qh5VEKISi3/ZUq2nNKNdqmumAs= github.com/sirupsen/logrus v1.2.0/go.mod h1:LxeOpSwHxABJmUn/MG1IvRgCAasNZTLOkJPxbbu5VWo= github.com/sirupsen/logrus v1.4.0/go.mod h1:LxeOpSwHxABJmUn/MG1IvRgCAasNZTLOkJPxbbu5VWo= github.com/sirupsen/logrus v1.4.1/go.mod h1:ni0Sbl8bgC9z8RoU9G6nDWqqs/fq4eDPysMBDgk/93Q= github.com/sirupsen/logrus v1.4.2/go.mod h1:tLMulIdttU9McNUspp0xgXVQah82FyeX6MwdIuYE2rE= github.com/sirupsen/logrus v1.6.0/go.mod h1:7uNnSEd1DgxDLC74fIahvMZmmYsHGZGEOFrfsX/uA88= -github.com/sirupsen/logrus v1.8.1 h1:dJKuHgqk1NNQlqoA6BTlM1Wf9DOH3NBjQyu0h9+AZZE= +github.com/sirupsen/logrus v1.9.3 h1:dueUQJ1C2q9oE3F7wvmSGAaVtTmUizReu6fjN8uqzbQ= github.com/spf13/cobra v0.0.3/go.mod h1:1l0Ry5zgKvJasoi3XT1TypsSe7PqH0Sj9dhYf7v3XqQ= github.com/spf13/pflag v1.0.3/go.mod h1:DYY7MBk1bdzusC3SYhjObp+wFpr4gzcvqqNjLnInEg4= github.com/spf13/pflag v1.0.5 h1:iy+VFUOCP1a+8yFto/drg2CJ5u0yRoB7fZw3DKv/JXA= @@ -465,18 +479,20 @@ github.com/stretchr/testify v1.6.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/ github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= github.com/stretchr/testify v1.7.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= github.com/stretchr/testify v1.8.0/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU= -github.com/stretchr/testify v1.8.1 h1:w7B6lhMri9wdJUVmEZPGGhZzrYTPvgJArz7wNPgYKsk= github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= -github.com/thanos-io/thanos v0.25.2 h1:vzqeD5mWgpEUAgOsco7H+8L+Hfs5aZPCnb7jjeJ/kcY= -github.com/thanos-io/thanos v0.25.2/go.mod h1:7i7BAtkc5n9gADy6Fez3PCiVb9Wzc7DldhZ+JJJC0Eg= -github.com/tidwall/pretty v1.0.0 h1:HsD+QiTn7sK6flMKIvNmpqz1qrpP3Ps6jOKIKMooyg4= +github.com/stretchr/testify v1.8.4 h1:CcVxjf3Q8PM0mHUKJCdn+eZZtm5yQwehR5yeSVQQcUk= +github.com/stretchr/testify v1.8.4/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo= +github.com/thanos-io/thanos v0.32.5 h1:khHvuEAbUKox9DQI9cSmLes4F9G3MqWPxcdrf2tYY0w= +github.com/thanos-io/thanos v0.32.5/go.mod h1:POOrd2N/0wRQKkg1MJTvU29X+IVs7iMjSoN08q8V1Mo= github.com/tidwall/pretty v1.0.0/go.mod h1:XNkn88O1ChpSDQmQeStsy+sBenx6DDtFZJxhVysOjyk= github.com/vultr/govultr/v2 v2.17.2 h1:gej/rwr91Puc/tgh+j33p/BLR16UrIPnSr+AIwYWZQs= github.com/xdg-go/pbkdf2 v1.0.0/go.mod h1:jrpuAogTd400dnrH08LKmI/xc1MbPOebTwRqcT5RDeI= github.com/xdg-go/scram v1.0.2/go.mod h1:1WAq6h33pAW+iRreB34OORO2Nf7qel3VV3fjBj+hCSs= github.com/xdg-go/scram v1.1.1/go.mod h1:RaEWvsqvNKKvBPvcKeFjrG2cJqOkHTiyTpzz23ni57g= +github.com/xdg-go/scram v1.1.2/go.mod h1:RT/sEzTbU5y00aCK8UOx6R7YryM0iF1N2MOmC3kKLN4= github.com/xdg-go/stringprep v1.0.2/go.mod h1:8F9zXuvzgwmyT5DUm4GUfZGDdT3W+LCvS6+da4O5kxM= github.com/xdg-go/stringprep v1.0.3/go.mod h1:W3f5j4i+9rC0kuIEJL0ky1VpHXQU3ocBgklLGvcBnW8= +github.com/xdg-go/stringprep v1.0.4/go.mod h1:mPGuuIYwz7CmR2bT9j4GbQqutWS1zV24gijq1dTyGkM= github.com/youmark/pkcs8 v0.0.0-20181117223130-1be2e3e5546d/go.mod h1:rHwXgn7JulP+udvsHwJoVG1YGAP6VLg4y9I5dyZdqmA= github.com/yuin/goldmark v1.1.25/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74= github.com/yuin/goldmark v1.1.27/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74= @@ -486,8 +502,8 @@ github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5t go.mongodb.org/mongo-driver v1.7.3/go.mod h1:NqaYOwnXWr5Pm7AOpO5QFxKJ503nbMse/R79oO62zWg= go.mongodb.org/mongo-driver v1.7.5/go.mod h1:VXEWRZ6URJIkUq2SCAyapmhH0ZLRBP+FT4xhp5Zvxng= go.mongodb.org/mongo-driver v1.10.0/go.mod h1:wsihk0Kdgv8Kqu1Anit4sfK+22vSFbUrAVEYRhCXrA8= -go.mongodb.org/mongo-driver v1.11.0 h1:FZKhBSTydeuffHj9CBjXlR8vQLee1cQyTWYPA6/tqiE= -go.mongodb.org/mongo-driver v1.11.0/go.mod h1:s7p5vEtfbeR1gYi6pnj3c3/urpbLv2T5Sfd6Rp2HBB8= +go.mongodb.org/mongo-driver v1.12.0 h1:aPx33jmn/rQuJXPQLZQ8NtfPQG8CaqgLThFtqRb0PiE= +go.mongodb.org/mongo-driver v1.12.0/go.mod h1:AZkxhPnFJUoH7kZlFkVKucV20K387miPfm7oimrSmK0= go.opencensus.io v0.21.0/go.mod h1:mSImk1erAIZhrmZN+AvHh14ztQfjbGwt4TtuofqLduU= go.opencensus.io v0.22.0/go.mod h1:+kGneAE2xo2IficOXnaByMWTGM9T73dGwxeWcUqIpI8= go.opencensus.io v0.22.2/go.mod h1:yxeiOL68Rb0Xd1ddK5vPZ/oVn4vY4Ynel7k9FzqtOIw= @@ -495,19 +511,22 @@ go.opencensus.io v0.22.3/go.mod h1:yxeiOL68Rb0Xd1ddK5vPZ/oVn4vY4Ynel7k9FzqtOIw= go.opencensus.io v0.22.4/go.mod h1:yxeiOL68Rb0Xd1ddK5vPZ/oVn4vY4Ynel7k9FzqtOIw= go.opencensus.io v0.24.0 h1:y73uSU6J157QMP2kn2r30vwW1A2W2WFwSCGnAVxeaD0= go.opencensus.io v0.24.0/go.mod h1:vNK8G9p7aAivkbmorf4v+7Hgx+Zs0yY+0fOtgBfjQKo= -go.opentelemetry.io/otel v1.11.2 h1:YBZcQlsVekzFsFbjygXMOXSs6pialIZxcjfO/mBDmR0= -go.opentelemetry.io/otel v1.11.2/go.mod h1:7p4EUV+AqgdlNV9gL97IgUZiVR3yrFXYo53f9BM3tRI= -go.opentelemetry.io/otel/trace v1.11.2 h1:Xf7hWSF2Glv0DE3MH7fBHvtpSBsjcBUe5MYAmZM/+y0= -go.opentelemetry.io/otel/trace v1.11.2/go.mod h1:4N+yC7QEz7TTsG9BSRLNAa63eg5E06ObSbKPmxQ/pKA= +go.opentelemetry.io/otel v1.16.0 h1:Z7GVAX/UkAXPKsy94IU+i6thsQS4nb7LviLpnaNeW8s= +go.opentelemetry.io/otel v1.16.0/go.mod h1:vl0h9NUa1D5s1nv3A5vZOYWn8av4K8Ml6JDeHrT/bx4= +go.opentelemetry.io/otel/metric v1.16.0 h1:RbrpwVG1Hfv85LgnZ7+txXioPDoh6EdbZHo26Q3hqOo= +go.opentelemetry.io/otel/metric v1.16.0/go.mod h1:QE47cpOmkwipPiefDwo2wDzwJrlfxxNYodqc4xnGCo4= +go.opentelemetry.io/otel/trace v1.16.0 h1:8JRpaObFoW0pxuVPapkgH8UhHQj+bJW8jJsCZEu5MQs= +go.opentelemetry.io/otel/trace v1.16.0/go.mod h1:Yt9vYq1SdNz3xdjZZK7wcXv1qv2pwLkqr2QVwea0ef0= go.opentelemetry.io/proto/otlp v0.7.0/go.mod h1:PqfVotwruBrMGOCsRd/89rSnXhoiJIqeYNgFYFoEGnI= go.uber.org/atomic v1.7.0/go.mod h1:fEN4uk6kAWBTFdckzkM89CLk9XfWZrxpCo0nPH17wJc= -go.uber.org/atomic v1.10.0 h1:9qC72Qh0+3MqyJbAn8YU5xVq1frD8bn3JtD2oXtafVQ= -go.uber.org/atomic v1.10.0/go.mod h1:LUxbIzbOniOlMKjJjyPfpl4v+PKK2cNJn91OQbhoJI0= +go.uber.org/atomic v1.11.0 h1:ZvwS0R+56ePWxUNi+Atn9dWONBPp/AUETXlHW0DxSjE= +go.uber.org/atomic v1.11.0/go.mod h1:LUxbIzbOniOlMKjJjyPfpl4v+PKK2cNJn91OQbhoJI0= go.uber.org/goleak v1.1.10/go.mod h1:8a7PlsEVH3e/a/GLqe5IIrQx6GzcnRmZEufDUTk4A7A= -go.uber.org/goleak v1.2.0 h1:xqgm/S+aQvhWFTtR0XK3Jvg7z8kGV8P4X14IzwN3Eqk= -go.uber.org/goleak v1.2.0/go.mod h1:XJYK+MuIchqpmGmUSAzotztawfKvYLUIgg7guXrwVUo= -go.uber.org/multierr v1.6.0 h1:y6IPFStTAIT5Ytl7/XYmHvzXQ7S3g/IeZW9hyZ5thw4= +go.uber.org/goleak v1.2.1 h1:NBol2c7O1ZokfZ0LEU9K6Whx/KnwvepVetCUhtKja4A= +go.uber.org/goleak v1.2.1/go.mod h1:qlT2yGI9QafXHhZZLxlSuNsMw3FFLxBr+tBRlmO1xH4= go.uber.org/multierr v1.6.0/go.mod h1:cdWPpRnG4AhwMwsgIHip0KRBQjJy5kYEpYjJxpXp9iU= +go.uber.org/multierr v1.11.0 h1:blXXJkSxSSfBVBlC76pxqeO+LN3aDfLQo+309xJstO0= +go.uber.org/multierr v1.11.0/go.mod h1:20+QtiLqy0Nd6FdQB9TLXag12DsQkrbs3htMFfDN80Y= go.uber.org/zap v1.19.0/go.mod h1:xg/QME4nWcxGxrpdeYfq7UvYrLh66cuVKdrbD1XF/NI= go.uber.org/zap v1.24.0 h1:FiJd5l1UOLj0wCgbSE0rwwXHzEdAZS6hiiSnxJN/D60= go.uber.org/zap v1.24.0/go.mod h1:2kMP+WWQ8aoFoedH3T2sq6iJ2yDWpHbP0f6MQbS9Gkg= @@ -534,8 +553,8 @@ golang.org/x/exp v0.0.0-20191227195350-da58074b4299/go.mod h1:2RIsYlXP63K8oxa1u0 golang.org/x/exp v0.0.0-20200119233911-0405dc783f0a/go.mod h1:2RIsYlXP63K8oxa1u096TMicItID8zy7Y6sNkU49FU4= golang.org/x/exp v0.0.0-20200207192155-f17229e696bd/go.mod h1:J/WKrq2StrnmMY6+EHIKF9dgMWnmCNThgcyBT1FY9mM= golang.org/x/exp v0.0.0-20200224162631-6cc2880d07d6/go.mod h1:3jZMyOhIsHpP37uCMkUooju7aAi5cS1Q23tOzKc+0MU= -golang.org/x/exp v0.0.0-20221212164502-fae10dda9338 h1:OvjRkcNHnf6/W5FZXSxODbxwD+X7fspczG7Jn/xQVD4= -golang.org/x/exp v0.0.0-20221212164502-fae10dda9338/go.mod h1:CxIveKay+FTh1D0yPZemJVgC/95VzuuOLq5Qi4xnoYc= +golang.org/x/exp v0.0.0-20230713183714-613f0c0eb8a1 h1:MGwJjxBy0HJshjDNfLsYO8xppfqWlA5ZT9OhtUUhTNw= +golang.org/x/exp v0.0.0-20230713183714-613f0c0eb8a1/go.mod h1:FXUEEKJgO7OQYeo8N01OfiKP8RXMtf6e8aTskBGqWdc= golang.org/x/image v0.0.0-20190227222117-0694c2d4d067/go.mod h1:kZ7UVZpmo3dzQBMxlp+ypCbDeSB+sBbTgSJuh5dn5js= golang.org/x/image v0.0.0-20190802002840-cff245a6509b/go.mod h1:FeLwcggjj3mMvU+oOTbSwawSJRM1uh48EjtB4UJZlP0= golang.org/x/lint v0.0.0-20181026193005-c67002cb31c3/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE= @@ -547,7 +566,6 @@ golang.org/x/lint v0.0.0-20190909230951-414d861bb4ac/go.mod h1:6SW0HCj/g11FgYtHl golang.org/x/lint v0.0.0-20190930215403-16217165b5de/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc= golang.org/x/lint v0.0.0-20191125180803-fdd1cda4f05f/go.mod h1:5qLYkcX4OjUUV8bRuDixDT3tpyyb+LUpUlRWLxfhWrs= golang.org/x/lint v0.0.0-20200130185559-910be7a94367/go.mod h1:3xt1FjdF8hUf6vQPIChWIBhFzV8gjjsPE/fR3IyQdNY= -golang.org/x/lint v0.0.0-20200302205851-738671d3881b h1:Wh+f8QHJXR411sJR8/vRBTZ7YapZaRvUcLFFJhusH0k= golang.org/x/lint v0.0.0-20200302205851-738671d3881b/go.mod h1:3xt1FjdF8hUf6vQPIChWIBhFzV8gjjsPE/fR3IyQdNY= golang.org/x/mobile v0.0.0-20190312151609-d3739f865fa6/go.mod h1:z+o9i4GpDbdi3rU15maQ/Ox0txvL9dWGYEHz965HBQE= golang.org/x/mobile v0.0.0-20190719004257-d2bd2a29d028/go.mod h1:E/iHnbuqvinMTCcRqshq8CkpyQDoeVncDDYHnLhea+o= @@ -558,8 +576,8 @@ golang.org/x/mod v0.1.1-0.20191107180719-034126e5016b/go.mod h1:QqPTAvyqsEbceGzB golang.org/x/mod v0.2.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4= -golang.org/x/mod v0.9.0 h1:KENHtAZL2y3NLMYZeHY9DW8HW8V+kQyJsY/V9JlKvCs= -golang.org/x/mod v0.9.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= +golang.org/x/mod v0.12.0 h1:rmsUpXtvNzj340zd98LZ4KntptpfRHwpFOHG188oHXc= +golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20180826012351-8a410e7b638d/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20181114220301-adae6a3d119a/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= @@ -604,8 +622,8 @@ golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4Iltr golang.org/x/oauth2 v0.0.0-20191202225959-858c2ad4c8b6/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/oauth2 v0.0.0-20200107190931-bf48bf16ab8d/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/oauth2 v0.0.0-20210514164344-f6687ab2804c/go.mod h1:KelEdhl1UZF7XfJ4dDtk6s++YSgaE7mD/BuKKDLBl4A= -golang.org/x/oauth2 v0.10.0 h1:zHCpF2Khkwy4mMB4bv0U37YtJdTGW8jI0glAApi0Kh8= -golang.org/x/oauth2 v0.10.0/go.mod h1:kTpgurOux7LqtuxjuyZa4Gj2gdezIt/jQtGnNFfypQI= +golang.org/x/oauth2 v0.11.0 h1:vPL4xzxBM4niKCW6g9whtaWVXTJf1U5e4aZxxFx/gbU= +golang.org/x/oauth2 v0.11.0/go.mod h1:LdF7O/8bLR/qWK9DrpXmbHLTouvRHK0SgJl0GmDBchk= golang.org/x/sync v0.0.0-20180314180146-1d60e4601c6f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20181221193216-37e7f081c4d4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= @@ -666,6 +684,7 @@ golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220908164124-27713097b956/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.1.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.13.0 h1:Af8nKPmuFypiUBjVoU9V20FiaFXOcuZI21p0ycVYYGE= golang.org/x/sys v0.13.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= @@ -683,6 +702,7 @@ golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= golang.org/x/text v0.3.8/go.mod h1:E6s5w1FMmriuDzIBO73fBruAKo1PCIq6d2Q6DHfQ8WQ= golang.org/x/text v0.4.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= +golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= golang.org/x/text v0.13.0 h1:ablQoSUd0tRdKxZewP80B+BaqeKJuVhuRxj/dkrun3k= golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= @@ -739,8 +759,8 @@ golang.org/x/tools v0.0.0-20200804011535-6c149bb5ef0d/go.mod h1:njjCfa9FT2d7l9Bc golang.org/x/tools v0.0.0-20200825202427-b303f430e36d/go.mod h1:njjCfa9FT2d7l9Bc6FUM5FLjQPp3cFF28FI3qnDFljA= golang.org/x/tools v0.0.0-20210106214847-113979e3529a/go.mod h1:emZCQorbCU4vsT4fOWvOPXz4eW1wZW4PmDk9uLelYpA= golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc= -golang.org/x/tools v0.6.0 h1:BOw41kyTf3PuCW1pVQf8+Cyg8pMlkYB1oo9iJ6D/lKM= -golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU= +golang.org/x/tools v0.11.0 h1:EMCa6U9S2LtZXLAMoWiR/R8dAQFRqbAitmbJ2UKhoi8= +golang.org/x/tools v0.11.0/go.mod h1:anzJrxPjNtfgiYQYirP2CPGzGLxrH2u2QBhn6Bf3qY8= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= @@ -763,8 +783,8 @@ google.golang.org/api v0.24.0/go.mod h1:lIXQywCXRcnZPGlsd8NbLnOjtAoL6em04bJ9+z0M google.golang.org/api v0.28.0/go.mod h1:lIXQywCXRcnZPGlsd8NbLnOjtAoL6em04bJ9+z0MncE= google.golang.org/api v0.29.0/go.mod h1:Lcubydp8VUV7KeIHD9z2Bys/sm/vGKnG1UHuDBSrHWM= google.golang.org/api v0.30.0/go.mod h1:QGmEvQ87FHZNiUVJkT14jQNYJ4ZJjdRF23ZXz5138Fc= -google.golang.org/api v0.128.0 h1:RjPESny5CnQRn9V6siglged+DZCgfu9l6mO9dkX9VOg= -google.golang.org/api v0.128.0/go.mod h1:Y611qgqaE92On/7g65MQgxYul3c0rEB894kniWLY750= +google.golang.org/api v0.132.0 h1:8t2/+qZ26kAOGSmOiHwVycqVaDg7q3JDILrNi/Z6rvc= +google.golang.org/api v0.132.0/go.mod h1:AeTBC6GpJnJSRJjktDcPX0QwtS8pGYZOV6MSuSCusw0= google.golang.org/appengine v1.1.0/go.mod h1:EbEs0AVv82hx2wNQdGPgUI5lhzA/G0D9YwlJXL52JkM= google.golang.org/appengine v1.4.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4= google.golang.org/appengine v1.5.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4= @@ -804,12 +824,12 @@ google.golang.org/genproto v0.0.0-20200729003335-053ba62fc06f/go.mod h1:FWY/as6D google.golang.org/genproto v0.0.0-20200804131852-c06518451d9c/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no= google.golang.org/genproto v0.0.0-20200825200019-8632dd797987/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no= google.golang.org/genproto v0.0.0-20201019141844-1ed22bb0c154/go.mod h1:FWY/as6DDZQgahTzZj3fqbO1CbirC29ZNUFHwi0/+no= -google.golang.org/genproto v0.0.0-20230711160842-782d3b101e98 h1:Z0hjGZePRE0ZBWotvtrwxFNrNE9CUAGtplaDK5NNI/g= -google.golang.org/genproto v0.0.0-20230711160842-782d3b101e98/go.mod h1:S7mY02OqCJTD0E1OiQy1F72PWFB4bZJ87cAtLPYgDR0= -google.golang.org/genproto/googleapis/api v0.0.0-20230711160842-782d3b101e98 h1:FmF5cCW94Ij59cfpoLiwTgodWmm60eEV0CjlsVg2fuw= -google.golang.org/genproto/googleapis/api v0.0.0-20230711160842-782d3b101e98/go.mod h1:rsr7RhLuwsDKL7RmgDDCUc6yaGr1iqceVb5Wv6f6YvQ= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230711160842-782d3b101e98 h1:bVf09lpb+OJbByTj913DRJioFFAjf/ZGxEz7MajTp2U= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230711160842-782d3b101e98/go.mod h1:TUfxEVdsvPg18p6AslUXFoLdpED4oBnGwyqk3dV1XzM= +google.golang.org/genproto v0.0.0-20230717213848-3f92550aa753 h1:+VoAg+OKmWaommL56xmZSE2sUK8A7m6SUO7X89F2tbw= +google.golang.org/genproto v0.0.0-20230717213848-3f92550aa753/go.mod h1:iqkVr8IRpZ53gx1dEnWlCUIEwDWqWARWrbzpasaTNYM= +google.golang.org/genproto/googleapis/api v0.0.0-20230717213848-3f92550aa753 h1:lCbbUxUDD+DiXx9Q6F/ttL0aAu7N2pz8XnmMm8ZW4NE= +google.golang.org/genproto/googleapis/api v0.0.0-20230717213848-3f92550aa753/go.mod h1:rsr7RhLuwsDKL7RmgDDCUc6yaGr1iqceVb5Wv6f6YvQ= +google.golang.org/genproto/googleapis/rpc v0.0.0-20230717213848-3f92550aa753 h1:XUODHrpzJEUeWmVo/jfNTLj0YyVveOo28oE6vkFbkO4= +google.golang.org/genproto/googleapis/rpc v0.0.0-20230717213848-3f92550aa753/go.mod h1:TUfxEVdsvPg18p6AslUXFoLdpED4oBnGwyqk3dV1XzM= google.golang.org/grpc v1.19.0/go.mod h1:mqu4LbDTu4XGKhr4mRzUsmM4RtVoemTSY81AxZiDr8c= google.golang.org/grpc v1.20.1/go.mod h1:10oTOabMzJvdu6/UiuZezV6QK5dSlG84ov/aaiqXj38= google.golang.org/grpc v1.21.1/go.mod h1:oYelfM1adQP15Ek0mdvEgi9Df8B9CZIaU1084ijfRaM= @@ -849,10 +869,11 @@ gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127/go.mod h1:Co6ibVJAznAaIkqp8 gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20200227125254-8fa46927fb4f/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk= +gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q= gopkg.in/errgo.v2 v2.1.0/go.mod h1:hNsd1EY+bozCKY1Ytp96fpM3vjJbqLJn88ws8XvfDNI= gopkg.in/inf.v0 v0.9.1 h1:73M5CoZyi3ZLMOyDlQh031Cx6N9NDJ2Vvfl76EDAgDc= gopkg.in/inf.v0 v0.9.1/go.mod h1:cWUDdTG/fYaXco+Dcufb5Vnc6Gp2YChqWtbxRZE0mXw= -gopkg.in/ini.v1 v1.66.6 h1:LATuAqN/shcYAOkv3wl2L4rkaKqkcgTBQjOyYDvcPKI= +gopkg.in/ini.v1 v1.67.0 h1:Dgnx+6+nfE+IfzjUEISNeydPJh9AXNNsWbGP9KzCsOA= gopkg.in/yaml.v2 v2.2.1/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.3/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= diff --git a/vendor/cloud.google.com/go/compute/internal/version.go b/vendor/cloud.google.com/go/compute/internal/version.go index b1672963f6..eddfee04b0 100644 --- a/vendor/cloud.google.com/go/compute/internal/version.go +++ b/vendor/cloud.google.com/go/compute/internal/version.go @@ -15,4 +15,4 @@ package internal // Version is the current tagged release of the library. -const Version = "1.21.0" +const Version = "1.22.0" diff --git a/vendor/github.com/asaskevich/govalidator/validator.go b/vendor/github.com/asaskevich/govalidator/validator.go index 46ecfc84a4..c9c4fac065 100644 --- a/vendor/github.com/asaskevich/govalidator/validator.go +++ b/vendor/github.com/asaskevich/govalidator/validator.go @@ -454,27 +454,26 @@ func IsCreditCard(str string) bool { if !rxCreditCard.MatchString(sanitized) { return false } + + number, _ := ToInt(sanitized) + number, lastDigit := number / 10, number % 10 + var sum int64 - var digit string - var tmpNum int64 - var shouldDouble bool - for i := len(sanitized) - 1; i >= 0; i-- { - digit = sanitized[i:(i + 1)] - tmpNum, _ = ToInt(digit) - if shouldDouble { - tmpNum *= 2 - if tmpNum >= 10 { - sum += (tmpNum % 10) + 1 - } else { - sum += tmpNum + for i:=0; number > 0; i++ { + digit := number % 10 + + if i % 2 == 0 { + digit *= 2 + if digit > 9 { + digit -= 9 } - } else { - sum += tmpNum } - shouldDouble = !shouldDouble + + sum += digit + number = number / 10 } - - return sum%10 == 0 + + return (sum + lastDigit) % 10 == 0 } // IsISBN10 checks if the string is an ISBN version 10. diff --git a/vendor/github.com/aws/aws-sdk-go/aws/auth/bearer/token.go b/vendor/github.com/aws/aws-sdk-go/aws/auth/bearer/token.go new file mode 100644 index 0000000000..dd950a286f --- /dev/null +++ b/vendor/github.com/aws/aws-sdk-go/aws/auth/bearer/token.go @@ -0,0 +1,50 @@ +package bearer + +import ( + "github.com/aws/aws-sdk-go/aws" + "time" +) + +// Token provides a type wrapping a bearer token and expiration metadata. +type Token struct { + Value string + + CanExpire bool + Expires time.Time +} + +// Expired returns if the token's Expires time is before or equal to the time +// provided. If CanExpire is false, Expired will always return false. +func (t Token) Expired(now time.Time) bool { + if !t.CanExpire { + return false + } + now = now.Round(0) + return now.Equal(t.Expires) || now.After(t.Expires) +} + +// TokenProvider provides interface for retrieving bearer tokens. +type TokenProvider interface { + RetrieveBearerToken(aws.Context) (Token, error) +} + +// TokenProviderFunc provides a helper utility to wrap a function as a type +// that implements the TokenProvider interface. +type TokenProviderFunc func(aws.Context) (Token, error) + +// RetrieveBearerToken calls the wrapped function, returning the Token or +// error. +func (fn TokenProviderFunc) RetrieveBearerToken(ctx aws.Context) (Token, error) { + return fn(ctx) +} + +// StaticTokenProvider provides a utility for wrapping a static bearer token +// value within an implementation of a token provider. +type StaticTokenProvider struct { + Token Token +} + +// RetrieveBearerToken returns the static token specified. +func (s StaticTokenProvider) RetrieveBearerToken(aws.Context) (Token, error) { + return s.Token, nil +} diff --git a/vendor/github.com/aws/aws-sdk-go/aws/config.go b/vendor/github.com/aws/aws-sdk-go/aws/config.go index 4818ea427e..776e31b21d 100644 --- a/vendor/github.com/aws/aws-sdk-go/aws/config.go +++ b/vendor/github.com/aws/aws-sdk-go/aws/config.go @@ -20,16 +20,16 @@ type RequestRetryer interface{} // A Config provides service configuration for service clients. By default, // all clients will use the defaults.DefaultConfig structure. // -// // Create Session with MaxRetries configuration to be shared by multiple -// // service clients. -// sess := session.Must(session.NewSession(&aws.Config{ -// MaxRetries: aws.Int(3), -// })) +// // Create Session with MaxRetries configuration to be shared by multiple +// // service clients. +// sess := session.Must(session.NewSession(&aws.Config{ +// MaxRetries: aws.Int(3), +// })) // -// // Create S3 service client with a specific Region. -// svc := s3.New(sess, &aws.Config{ -// Region: aws.String("us-west-2"), -// }) +// // Create S3 service client with a specific Region. +// svc := s3.New(sess, &aws.Config{ +// Region: aws.String("us-west-2"), +// }) type Config struct { // Enables verbose error printing of all credential chain errors. // Should be used when wanting to see all errors while attempting to @@ -192,6 +192,23 @@ type Config struct { // EC2MetadataDisableTimeoutOverride *bool + // Set this to `false` to disable EC2Metadata client from falling back to IMDSv1. + // By default, EC2 role credentials will fall back to IMDSv1 as needed for backwards compatibility. + // You can disable this behavior by explicitly setting this flag to `false`. When false, the EC2Metadata + // client will return any errors encountered from attempting to fetch a token instead of silently + // using the insecure data flow of IMDSv1. + // + // Example: + // sess := session.Must(session.NewSession(aws.NewConfig() + // .WithEC2MetadataEnableFallback(false))) + // + // svc := s3.New(sess) + // + // See [configuring IMDS] for more information. + // + // [configuring IMDS]: https://docs.aws.amazon.com/AWSEC2/latest/UserGuide/configuring-instance-metadata-service.html + EC2MetadataEnableFallback *bool + // Instructs the endpoint to be generated for a service client to // be the dual stack endpoint. The dual stack endpoint will support // both IPv4 and IPv6 addressing. @@ -283,16 +300,16 @@ type Config struct { // NewConfig returns a new Config pointer that can be chained with builder // methods to set multiple configuration values inline without using pointers. // -// // Create Session with MaxRetries configuration to be shared by multiple -// // service clients. -// sess := session.Must(session.NewSession(aws.NewConfig(). -// WithMaxRetries(3), -// )) +// // Create Session with MaxRetries configuration to be shared by multiple +// // service clients. +// sess := session.Must(session.NewSession(aws.NewConfig(). +// WithMaxRetries(3), +// )) // -// // Create S3 service client with a specific Region. -// svc := s3.New(sess, aws.NewConfig(). -// WithRegion("us-west-2"), -// ) +// // Create S3 service client with a specific Region. +// svc := s3.New(sess, aws.NewConfig(). +// WithRegion("us-west-2"), +// ) func NewConfig() *Config { return &Config{} } @@ -432,6 +449,13 @@ func (c *Config) WithEC2MetadataDisableTimeoutOverride(enable bool) *Config { return c } +// WithEC2MetadataEnableFallback sets a config EC2MetadataEnableFallback value +// returning a Config pointer for chaining. +func (c *Config) WithEC2MetadataEnableFallback(v bool) *Config { + c.EC2MetadataEnableFallback = &v + return c +} + // WithSleepDelay overrides the function used to sleep while waiting for the // next retry. Defaults to time.Sleep. func (c *Config) WithSleepDelay(fn func(time.Duration)) *Config { @@ -576,6 +600,10 @@ func mergeInConfig(dst *Config, other *Config) { dst.EC2MetadataDisableTimeoutOverride = other.EC2MetadataDisableTimeoutOverride } + if other.EC2MetadataEnableFallback != nil { + dst.EC2MetadataEnableFallback = other.EC2MetadataEnableFallback + } + if other.SleepDelay != nil { dst.SleepDelay = other.SleepDelay } diff --git a/vendor/github.com/aws/aws-sdk-go/aws/credentials/processcreds/provider.go b/vendor/github.com/aws/aws-sdk-go/aws/credentials/processcreds/provider.go index e624836002..18694f07f7 100644 --- a/vendor/github.com/aws/aws-sdk-go/aws/credentials/processcreds/provider.go +++ b/vendor/github.com/aws/aws-sdk-go/aws/credentials/processcreds/provider.go @@ -226,12 +226,24 @@ func NewCredentialsCommand(command *exec.Cmd, options ...func(*ProcessProvider)) return credentials.NewCredentials(p) } -type credentialProcessResponse struct { - Version int - AccessKeyID string `json:"AccessKeyId"` +// A CredentialProcessResponse is the AWS credentials format that must be +// returned when executing an external credential_process. +type CredentialProcessResponse struct { + // As of this writing, the Version key must be set to 1. This might + // increment over time as the structure evolves. + Version int + + // The access key ID that identifies the temporary security credentials. + AccessKeyID string `json:"AccessKeyId"` + + // The secret access key that can be used to sign requests. SecretAccessKey string - SessionToken string - Expiration *time.Time + + // The token that users must pass to the service API to use the temporary credentials. + SessionToken string + + // The date on which the current credentials expire. + Expiration *time.Time } // Retrieve executes the 'credential_process' and returns the credentials. @@ -242,7 +254,7 @@ func (p *ProcessProvider) Retrieve() (credentials.Value, error) { } // Serialize and validate response - resp := &credentialProcessResponse{} + resp := &CredentialProcessResponse{} if err = json.Unmarshal(out, resp); err != nil { return credentials.Value{ProviderName: ProviderName}, awserr.New( ErrCodeProcessProviderParse, diff --git a/vendor/github.com/aws/aws-sdk-go/aws/credentials/ssocreds/provider.go b/vendor/github.com/aws/aws-sdk-go/aws/credentials/ssocreds/provider.go index 6eda2a5557..4138e725dd 100644 --- a/vendor/github.com/aws/aws-sdk-go/aws/credentials/ssocreds/provider.go +++ b/vendor/github.com/aws/aws-sdk-go/aws/credentials/ssocreds/provider.go @@ -4,13 +4,13 @@ import ( "crypto/sha1" "encoding/hex" "encoding/json" - "fmt" "io/ioutil" "path/filepath" "strings" "time" "github.com/aws/aws-sdk-go/aws" + "github.com/aws/aws-sdk-go/aws/auth/bearer" "github.com/aws/aws-sdk-go/aws/awserr" "github.com/aws/aws-sdk-go/aws/client" "github.com/aws/aws-sdk-go/aws/credentials" @@ -55,6 +55,19 @@ type Provider struct { // The URL that points to the organization's AWS Single Sign-On (AWS SSO) user portal. StartURL string + + // The filepath the cached token will be retrieved from. If unset Provider will + // use the startURL to determine the filepath at. + // + // ~/.aws/sso/cache/<sha1-hex-encoded-startURL>.json + // + // If custom cached token filepath is used, the Provider's startUrl + // parameter will be ignored. + CachedTokenFilepath string + + // Used by the SSOCredentialProvider if a token configuration + // profile is used in the shared config + TokenProvider bearer.TokenProvider } // NewCredentials returns a new AWS Single Sign-On (AWS SSO) credential provider. The ConfigProvider is expected to be configured @@ -89,13 +102,31 @@ func (p *Provider) Retrieve() (credentials.Value, error) { // RetrieveWithContext retrieves temporary AWS credentials from the configured Amazon Single Sign-On (AWS SSO) user portal // by exchanging the accessToken present in ~/.aws/sso/cache. func (p *Provider) RetrieveWithContext(ctx credentials.Context) (credentials.Value, error) { - tokenFile, err := loadTokenFile(p.StartURL) - if err != nil { - return credentials.Value{}, err + var accessToken *string + if p.TokenProvider != nil { + token, err := p.TokenProvider.RetrieveBearerToken(ctx) + if err != nil { + return credentials.Value{}, err + } + accessToken = &token.Value + } else { + if p.CachedTokenFilepath == "" { + cachedTokenFilePath, err := getCachedFilePath(p.StartURL) + if err != nil { + return credentials.Value{}, err + } + p.CachedTokenFilepath = cachedTokenFilePath + } + + tokenFile, err := loadTokenFile(p.CachedTokenFilepath) + if err != nil { + return credentials.Value{}, err + } + accessToken = &tokenFile.AccessToken } output, err := p.Client.GetRoleCredentialsWithContext(ctx, &sso.GetRoleCredentialsInput{ - AccessToken: &tokenFile.AccessToken, + AccessToken: accessToken, AccountId: &p.AccountID, RoleName: &p.RoleName, }) @@ -114,32 +145,13 @@ func (p *Provider) RetrieveWithContext(ctx credentials.Context) (credentials.Val }, nil } -func getCacheFileName(url string) (string, error) { +func getCachedFilePath(startUrl string) (string, error) { hash := sha1.New() - _, err := hash.Write([]byte(url)) + _, err := hash.Write([]byte(startUrl)) if err != nil { return "", err } - return strings.ToLower(hex.EncodeToString(hash.Sum(nil))) + ".json", nil -} - -type rfc3339 time.Time - -func (r *rfc3339) UnmarshalJSON(bytes []byte) error { - var value string - - if err := json.Unmarshal(bytes, &value); err != nil { - return err - } - - parse, err := time.Parse(time.RFC3339, value) - if err != nil { - return fmt.Errorf("expected RFC3339 timestamp: %v", err) - } - - *r = rfc3339(parse) - - return nil + return filepath.Join(defaultCacheLocation(), strings.ToLower(hex.EncodeToString(hash.Sum(nil)))+".json"), nil } type token struct { @@ -153,13 +165,8 @@ func (t token) Expired() bool { return nowTime().Round(0).After(time.Time(t.ExpiresAt)) } -func loadTokenFile(startURL string) (t token, err error) { - key, err := getCacheFileName(startURL) - if err != nil { - return token{}, awserr.New(ErrCodeSSOProviderInvalidToken, invalidTokenMessage, err) - } - - fileBytes, err := ioutil.ReadFile(filepath.Join(defaultCacheLocation(), key)) +func loadTokenFile(cachedTokenPath string) (t token, err error) { + fileBytes, err := ioutil.ReadFile(cachedTokenPath) if err != nil { return token{}, awserr.New(ErrCodeSSOProviderInvalidToken, invalidTokenMessage, err) } diff --git a/vendor/github.com/aws/aws-sdk-go/aws/credentials/ssocreds/sso_cached_token.go b/vendor/github.com/aws/aws-sdk-go/aws/credentials/ssocreds/sso_cached_token.go new file mode 100644 index 0000000000..f6fa88451a --- /dev/null +++ b/vendor/github.com/aws/aws-sdk-go/aws/credentials/ssocreds/sso_cached_token.go @@ -0,0 +1,237 @@ +package ssocreds + +import ( + "crypto/sha1" + "encoding/hex" + "encoding/json" + "fmt" + "github.com/aws/aws-sdk-go/internal/shareddefaults" + "io/ioutil" + "os" + "path/filepath" + "strconv" + "strings" + "time" +) + +var resolvedOsUserHomeDir = shareddefaults.UserHomeDir + +// StandardCachedTokenFilepath returns the filepath for the cached SSO token file, or +// error if unable get derive the path. Key that will be used to compute a SHA1 +// value that is hex encoded. +// +// Derives the filepath using the Key as: +// +// ~/.aws/sso/cache/<sha1-hex-encoded-key>.json +func StandardCachedTokenFilepath(key string) (string, error) { + homeDir := resolvedOsUserHomeDir() + if len(homeDir) == 0 { + return "", fmt.Errorf("unable to get USER's home directory for cached token") + } + hash := sha1.New() + if _, err := hash.Write([]byte(key)); err != nil { + return "", fmt.Errorf("unable to compute cached token filepath key SHA1 hash, %v", err) + } + + cacheFilename := strings.ToLower(hex.EncodeToString(hash.Sum(nil))) + ".json" + + return filepath.Join(homeDir, ".aws", "sso", "cache", cacheFilename), nil +} + +type tokenKnownFields struct { + AccessToken string `json:"accessToken,omitempty"` + ExpiresAt *rfc3339 `json:"expiresAt,omitempty"` + + RefreshToken string `json:"refreshToken,omitempty"` + ClientID string `json:"clientId,omitempty"` + ClientSecret string `json:"clientSecret,omitempty"` +} + +type cachedToken struct { + tokenKnownFields + UnknownFields map[string]interface{} `json:"-"` +} + +// MarshalJSON provides custom marshalling because the standard library Go marshaller ignores unknown/unspecified fields +// when marshalling from a struct: https://pkg.go.dev/encoding/json#Marshal +// This function adds some extra validation to the known fields and captures unknown fields. +func (t cachedToken) MarshalJSON() ([]byte, error) { + fields := map[string]interface{}{} + + setTokenFieldString(fields, "accessToken", t.AccessToken) + setTokenFieldRFC3339(fields, "expiresAt", t.ExpiresAt) + + setTokenFieldString(fields, "refreshToken", t.RefreshToken) + setTokenFieldString(fields, "clientId", t.ClientID) + setTokenFieldString(fields, "clientSecret", t.ClientSecret) + + for k, v := range t.UnknownFields { + if _, ok := fields[k]; ok { + return nil, fmt.Errorf("unknown token field %v, duplicates known field", k) + } + fields[k] = v + } + + return json.Marshal(fields) +} + +func setTokenFieldString(fields map[string]interface{}, key, value string) { + if value == "" { + return + } + fields[key] = value +} +func setTokenFieldRFC3339(fields map[string]interface{}, key string, value *rfc3339) { + if value == nil { + return + } + fields[key] = value +} + +// UnmarshalJSON provides custom unmarshalling because the standard library Go unmarshaller ignores unknown/unspecified +// fields when unmarshalling from a struct: https://pkg.go.dev/encoding/json#Unmarshal +// This function adds some extra validation to the known fields and captures unknown fields. +func (t *cachedToken) UnmarshalJSON(b []byte) error { + var fields map[string]interface{} + if err := json.Unmarshal(b, &fields); err != nil { + return nil + } + + t.UnknownFields = map[string]interface{}{} + + for k, v := range fields { + var err error + switch k { + case "accessToken": + err = getTokenFieldString(v, &t.AccessToken) + case "expiresAt": + err = getTokenFieldRFC3339(v, &t.ExpiresAt) + case "refreshToken": + err = getTokenFieldString(v, &t.RefreshToken) + case "clientId": + err = getTokenFieldString(v, &t.ClientID) + case "clientSecret": + err = getTokenFieldString(v, &t.ClientSecret) + default: + t.UnknownFields[k] = v + } + + if err != nil { + return fmt.Errorf("field %q, %v", k, err) + } + } + + return nil +} + +func getTokenFieldString(v interface{}, value *string) error { + var ok bool + *value, ok = v.(string) + if !ok { + return fmt.Errorf("expect value to be string, got %T", v) + } + return nil +} + +func getTokenFieldRFC3339(v interface{}, value **rfc3339) error { + var stringValue string + if err := getTokenFieldString(v, &stringValue); err != nil { + return err + } + + timeValue, err := parseRFC3339(stringValue) + if err != nil { + return err + } + + *value = &timeValue + return nil +} + +func loadCachedToken(filename string) (cachedToken, error) { + fileBytes, err := ioutil.ReadFile(filename) + if err != nil { + return cachedToken{}, fmt.Errorf("failed to read cached SSO token file, %v", err) + } + + var t cachedToken + if err := json.Unmarshal(fileBytes, &t); err != nil { + return cachedToken{}, fmt.Errorf("failed to parse cached SSO token file, %v", err) + } + + if len(t.AccessToken) == 0 || t.ExpiresAt == nil || time.Time(*t.ExpiresAt).IsZero() { + return cachedToken{}, fmt.Errorf( + "cached SSO token must contain accessToken and expiresAt fields") + } + + return t, nil +} + +func storeCachedToken(filename string, t cachedToken, fileMode os.FileMode) (err error) { + tmpFilename := filename + ".tmp-" + strconv.FormatInt(nowTime().UnixNano(), 10) + if err := writeCacheFile(tmpFilename, fileMode, t); err != nil { + return err + } + + if err := os.Rename(tmpFilename, filename); err != nil { + return fmt.Errorf("failed to replace old cached SSO token file, %v", err) + } + + return nil +} + +func writeCacheFile(filename string, fileMode os.FileMode, t cachedToken) (err error) { + var f *os.File + f, err = os.OpenFile(filename, os.O_CREATE|os.O_TRUNC|os.O_RDWR, fileMode) + if err != nil { + return fmt.Errorf("failed to create cached SSO token file %v", err) + } + + defer func() { + closeErr := f.Close() + if err == nil && closeErr != nil { + err = fmt.Errorf("failed to close cached SSO token file, %v", closeErr) + } + }() + + encoder := json.NewEncoder(f) + + if err = encoder.Encode(t); err != nil { + return fmt.Errorf("failed to serialize cached SSO token, %v", err) + } + + return nil +} + +type rfc3339 time.Time + +// UnmarshalJSON decode rfc3339 from JSON format +func (r *rfc3339) UnmarshalJSON(bytes []byte) error { + var value string + var err error + + if err = json.Unmarshal(bytes, &value); err != nil { + return err + } + + *r, err = parseRFC3339(value) + return err +} + +func parseRFC3339(v string) (rfc3339, error) { + parsed, err := time.Parse(time.RFC3339, v) + if err != nil { + return rfc3339{}, fmt.Errorf("expected RFC3339 timestamp: %v", err) + } + + return rfc3339(parsed), nil +} + +// MarshalJSON encode rfc3339 to JSON format time +func (r *rfc3339) MarshalJSON() ([]byte, error) { + value := time.Time(*r).Format(time.RFC3339) + + // Use JSON unmarshal to unescape the quoted value making use of JSON's + // quoting rules. + return json.Marshal(value) +} diff --git a/vendor/github.com/aws/aws-sdk-go/aws/credentials/ssocreds/token_provider.go b/vendor/github.com/aws/aws-sdk-go/aws/credentials/ssocreds/token_provider.go new file mode 100644 index 0000000000..3388b78b4f --- /dev/null +++ b/vendor/github.com/aws/aws-sdk-go/aws/credentials/ssocreds/token_provider.go @@ -0,0 +1,148 @@ +package ssocreds + +import ( + "fmt" + "os" + "time" + + "github.com/aws/aws-sdk-go/aws" + "github.com/aws/aws-sdk-go/aws/auth/bearer" + "github.com/aws/aws-sdk-go/service/ssooidc" +) + +// CreateTokenAPIClient provides the interface for the SSOTokenProvider's API +// client for calling CreateToken operation to refresh the SSO token. +type CreateTokenAPIClient interface { + CreateToken(input *ssooidc.CreateTokenInput) (*ssooidc.CreateTokenOutput, error) +} + +// SSOTokenProviderOptions provides the options for configuring the +// SSOTokenProvider. +type SSOTokenProviderOptions struct { + // Client that can be overridden + Client CreateTokenAPIClient + + // The path the file containing the cached SSO token will be read from. + // Initialized the NewSSOTokenProvider's cachedTokenFilepath parameter. + CachedTokenFilepath string +} + +// SSOTokenProvider provides a utility for refreshing SSO AccessTokens for +// Bearer Authentication. The SSOTokenProvider can only be used to refresh +// already cached SSO Tokens. This utility cannot perform the initial SSO +// create token. +// +// The initial SSO create token should be preformed with the AWS CLI before the +// Go application using the SSOTokenProvider will need to retrieve the SSO +// token. If the AWS CLI has not created the token cache file, this provider +// will return an error when attempting to retrieve the cached token. +// +// This provider will attempt to refresh the cached SSO token periodically if +// needed when RetrieveBearerToken is called. +// +// A utility such as the AWS CLI must be used to initially create the SSO +// session and cached token file. +// https://docs.aws.amazon.com/cli/latest/userguide/cli-configure-sso.html +type SSOTokenProvider struct { + options SSOTokenProviderOptions +} + +// NewSSOTokenProvider returns an initialized SSOTokenProvider that will +// periodically refresh the SSO token cached stored in the cachedTokenFilepath. +// The cachedTokenFilepath file's content will be rewritten by the token +// provider when the token is refreshed. +// +// The client must be configured for the AWS region the SSO token was created for. +func NewSSOTokenProvider(client CreateTokenAPIClient, cachedTokenFilepath string, optFns ...func(o *SSOTokenProviderOptions)) *SSOTokenProvider { + options := SSOTokenProviderOptions{ + Client: client, + CachedTokenFilepath: cachedTokenFilepath, + } + for _, fn := range optFns { + fn(&options) + } + + provider := &SSOTokenProvider{ + options: options, + } + + return provider +} + +// RetrieveBearerToken returns the SSO token stored in the cachedTokenFilepath +// the SSOTokenProvider was created with. If the token has expired +// RetrieveBearerToken will attempt to refresh it. If the token cannot be +// refreshed or is not present an error will be returned. +// +// A utility such as the AWS CLI must be used to initially create the SSO +// session and cached token file. https://docs.aws.amazon.com/cli/latest/userguide/cli-configure-sso.html +func (p *SSOTokenProvider) RetrieveBearerToken(ctx aws.Context) (bearer.Token, error) { + cachedToken, err := loadCachedToken(p.options.CachedTokenFilepath) + if err != nil { + return bearer.Token{}, err + } + + if cachedToken.ExpiresAt != nil && nowTime().After(time.Time(*cachedToken.ExpiresAt)) { + cachedToken, err = p.refreshToken(cachedToken) + if err != nil { + return bearer.Token{}, fmt.Errorf("refresh cached SSO token failed, %v", err) + } + } + + expiresAt := toTime((*time.Time)(cachedToken.ExpiresAt)) + return bearer.Token{ + Value: cachedToken.AccessToken, + CanExpire: !expiresAt.IsZero(), + Expires: expiresAt, + }, nil +} + +func (p *SSOTokenProvider) refreshToken(token cachedToken) (cachedToken, error) { + if token.ClientSecret == "" || token.ClientID == "" || token.RefreshToken == "" { + return cachedToken{}, fmt.Errorf("cached SSO token is expired, or not present, and cannot be refreshed") + } + + createResult, err := p.options.Client.CreateToken(&ssooidc.CreateTokenInput{ + ClientId: &token.ClientID, + ClientSecret: &token.ClientSecret, + RefreshToken: &token.RefreshToken, + GrantType: aws.String("refresh_token"), + }) + if err != nil { + return cachedToken{}, fmt.Errorf("unable to refresh SSO token, %v", err) + } + if createResult.ExpiresIn == nil { + return cachedToken{}, fmt.Errorf("missing required field ExpiresIn") + } + if createResult.AccessToken == nil { + return cachedToken{}, fmt.Errorf("missing required field AccessToken") + } + if createResult.RefreshToken == nil { + return cachedToken{}, fmt.Errorf("missing required field RefreshToken") + } + + expiresAt := nowTime().Add(time.Duration(*createResult.ExpiresIn) * time.Second) + + token.AccessToken = *createResult.AccessToken + token.ExpiresAt = (*rfc3339)(&expiresAt) + token.RefreshToken = *createResult.RefreshToken + + fileInfo, err := os.Stat(p.options.CachedTokenFilepath) + if err != nil { + return cachedToken{}, fmt.Errorf("failed to stat cached SSO token file %v", err) + } + + if err = storeCachedToken(p.options.CachedTokenFilepath, token, fileInfo.Mode()); err != nil { + return cachedToken{}, fmt.Errorf("unable to cache refreshed SSO token, %v", err) + } + + return token, nil +} + +func toTime(p *time.Time) (v time.Time) { + if p == nil { + return v + } + + return *p +} diff --git a/vendor/github.com/aws/aws-sdk-go/aws/credentials/stscreds/assume_role_provider.go b/vendor/github.com/aws/aws-sdk-go/aws/credentials/stscreds/assume_role_provider.go index 260a37cbba..86db488def 100644 --- a/vendor/github.com/aws/aws-sdk-go/aws/credentials/stscreds/assume_role_provider.go +++ b/vendor/github.com/aws/aws-sdk-go/aws/credentials/stscreds/assume_role_provider.go @@ -9,7 +9,7 @@ to refresh the credentials will be synchronized. But, the SDK is unable to ensure synchronous usage of the AssumeRoleProvider if the value is shared between multiple Credentials, Sessions or service clients. -Assume Role +# Assume Role To assume an IAM role using STS with the SDK you can create a new Credentials with the SDKs's stscreds package. @@ -27,7 +27,7 @@ with the SDKs's stscreds package. // from assumed role. svc := s3.New(sess, &aws.Config{Credentials: creds}) -Assume Role with static MFA Token +# Assume Role with static MFA Token To assume an IAM role with a MFA token you can either specify a MFA token code directly or provide a function to prompt the user each time the credentials @@ -49,7 +49,7 @@ credentials. // from assumed role. svc := s3.New(sess, &aws.Config{Credentials: creds}) -Assume Role with MFA Token Provider +# Assume Role with MFA Token Provider To assume an IAM role with MFA for longer running tasks where the credentials may need to be refreshed setting the TokenProvider field of AssumeRoleProvider @@ -74,7 +74,6 @@ single Credentials with an AssumeRoleProvider can be shared safely. // Create service client value configured for credentials // from assumed role. svc := s3.New(sess, &aws.Config{Credentials: creds}) - */ package stscreds @@ -199,6 +198,10 @@ type AssumeRoleProvider struct { // or an Amazon Resource Name (ARN) for a virtual device (such as arn:aws:iam::123456789012:mfa/user). SerialNumber *string + // The SourceIdentity which is used to identity a persistent identity through the whole session. + // For more details see https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp_control-access_monitor.html + SourceIdentity *string + // The value provided by the MFA device, if the trust policy of the role being // assumed requires MFA (that is, if the policy includes a condition that tests // for MFA). If the role being assumed requires MFA and if the TokenCode value @@ -320,6 +323,7 @@ func (p *AssumeRoleProvider) RetrieveWithContext(ctx credentials.Context) (crede Tags: p.Tags, PolicyArns: p.PolicyArns, TransitiveTagKeys: p.TransitiveTagKeys, + SourceIdentity: p.SourceIdentity, } if p.Policy != nil { input.Policy = p.Policy diff --git a/vendor/github.com/aws/aws-sdk-go/aws/ec2metadata/service.go b/vendor/github.com/aws/aws-sdk-go/aws/ec2metadata/service.go index df63bade10..f4cc8751d0 100644 --- a/vendor/github.com/aws/aws-sdk-go/aws/ec2metadata/service.go +++ b/vendor/github.com/aws/aws-sdk-go/aws/ec2metadata/service.go @@ -57,13 +57,13 @@ type EC2Metadata struct { // New creates a new instance of the EC2Metadata client with a session. // This client is safe to use across multiple goroutines. // -// // Example: -// // Create a EC2Metadata client from just a session. -// svc := ec2metadata.New(mySession) // -// // Create a EC2Metadata client with additional configuration -// svc := ec2metadata.New(mySession, aws.NewConfig().WithLogLevel(aws.LogDebugHTTPBody)) +// // Create a EC2Metadata client from just a session. +// svc := ec2metadata.New(mySession) +// +// // Create a EC2Metadata client with additional configuration +// svc := ec2metadata.New(mySession, aws.NewConfig().WithLogLevel(aws.LogDebugHTTPBody)) func New(p client.ConfigProvider, cfgs ...*aws.Config) *EC2Metadata { c := p.ClientConfig(ServiceName, cfgs...) return NewClient(*c.Config, c.Handlers, c.Endpoint, c.SigningRegion) diff --git a/vendor/github.com/aws/aws-sdk-go/aws/ec2metadata/token_provider.go b/vendor/github.com/aws/aws-sdk-go/aws/ec2metadata/token_provider.go index 4b29f190bf..604aeffdeb 100644 --- a/vendor/github.com/aws/aws-sdk-go/aws/ec2metadata/token_provider.go +++ b/vendor/github.com/aws/aws-sdk-go/aws/ec2metadata/token_provider.go @@ -1,6 +1,7 @@ package ec2metadata import ( + "fmt" "net/http" "sync/atomic" "time" @@ -33,11 +34,15 @@ func newTokenProvider(c *EC2Metadata, duration time.Duration) *tokenProvider { return &tokenProvider{client: c, configuredTTL: duration} } +// check if fallback is enabled +func (t *tokenProvider) fallbackEnabled() bool { + return t.client.Config.EC2MetadataEnableFallback == nil || *t.client.Config.EC2MetadataEnableFallback +} + // fetchTokenHandler fetches token for EC2Metadata service client by default. func (t *tokenProvider) fetchTokenHandler(r *request.Request) { - // short-circuits to insecure data flow if tokenProvider is disabled. - if v := atomic.LoadUint32(&t.disabled); v == 1 { + if v := atomic.LoadUint32(&t.disabled); v == 1 && t.fallbackEnabled() { return } @@ -49,23 +54,21 @@ func (t *tokenProvider) fetchTokenHandler(r *request.Request) { output, err := t.client.getToken(r.Context(), t.configuredTTL) if err != nil { + // only attempt fallback to insecure data flow if IMDSv1 is enabled + if !t.fallbackEnabled() { + r.Error = awserr.New("EC2MetadataError", "failed to get IMDSv2 token and fallback to IMDSv1 is disabled", err) + return + } - // change the disabled flag on token provider to true, - // when error is request timeout error. + // change the disabled flag on token provider to true and fallback if requestFailureError, ok := err.(awserr.RequestFailure); ok { switch requestFailureError.StatusCode() { case http.StatusForbidden, http.StatusNotFound, http.StatusMethodNotAllowed: atomic.StoreUint32(&t.disabled, 1) + t.client.Config.Logger.Log(fmt.Sprintf("WARN: failed to get session token, falling back to IMDSv1: %v", requestFailureError)) case http.StatusBadRequest: r.Error = requestFailureError } - - // Check if request timed out while waiting for response - if e, ok := requestFailureError.OrigErr().(awserr.Error); ok { - if e.Code() == request.ErrCodeRequestError { - atomic.StoreUint32(&t.disabled, 1) - } - } } return } diff --git a/vendor/github.com/aws/aws-sdk-go/aws/endpoints/defaults.go b/vendor/github.com/aws/aws-sdk-go/aws/endpoints/defaults.go index da37660070..a515362a1a 100644 --- a/vendor/github.com/aws/aws-sdk-go/aws/endpoints/defaults.go +++ b/vendor/github.com/aws/aws-sdk-go/aws/endpoints/defaults.go @@ -13,6 +13,8 @@ const ( AwsUsGovPartitionID = "aws-us-gov" // AWS GovCloud (US) partition. AwsIsoPartitionID = "aws-iso" // AWS ISO (US) partition. AwsIsoBPartitionID = "aws-iso-b" // AWS ISOB (US) partition. + AwsIsoEPartitionID = "aws-iso-e" // AWS ISOE (Europe) partition. + AwsIsoFPartitionID = "aws-iso-f" // AWS ISOF partition. ) // AWS Standard partition's regions. @@ -27,6 +29,7 @@ const ( ApSoutheast1RegionID = "ap-southeast-1" // Asia Pacific (Singapore). ApSoutheast2RegionID = "ap-southeast-2" // Asia Pacific (Sydney). ApSoutheast3RegionID = "ap-southeast-3" // Asia Pacific (Jakarta). + ApSoutheast4RegionID = "ap-southeast-4" // Asia Pacific (Melbourne). CaCentral1RegionID = "ca-central-1" // Canada (Central). EuCentral1RegionID = "eu-central-1" // Europe (Frankfurt). EuCentral2RegionID = "eu-central-2" // Europe (Zurich). @@ -36,6 +39,7 @@ const ( EuWest1RegionID = "eu-west-1" // Europe (Ireland). EuWest2RegionID = "eu-west-2" // Europe (London). EuWest3RegionID = "eu-west-3" // Europe (Paris). + IlCentral1RegionID = "il-central-1" // Israel (Tel Aviv). MeCentral1RegionID = "me-central-1" // Middle East (UAE). MeSouth1RegionID = "me-south-1" // Middle East (Bahrain). SaEast1RegionID = "sa-east-1" // South America (Sao Paulo). @@ -68,8 +72,14 @@ const ( UsIsobEast1RegionID = "us-isob-east-1" // US ISOB East (Ohio). ) +// AWS ISOE (Europe) partition's regions. +const () + +// AWS ISOF partition's regions. +const () + // DefaultResolver returns an Endpoint resolver that will be able -// to resolve endpoints for: AWS Standard, AWS China, AWS GovCloud (US), AWS ISO (US), and AWS ISOB (US). +// to resolve endpoints for: AWS Standard, AWS China, AWS GovCloud (US), AWS ISO (US), AWS ISOB (US), AWS ISOE (Europe), and AWS ISOF. // // Use DefaultPartitions() to get the list of the default partitions. func DefaultResolver() Resolver { @@ -77,7 +87,7 @@ func DefaultResolver() Resolver { } // DefaultPartitions returns a list of the partitions the SDK is bundled -// with. The available partitions are: AWS Standard, AWS China, AWS GovCloud (US), AWS ISO (US), and AWS ISOB (US). +// with. The available partitions are: AWS Standard, AWS China, AWS GovCloud (US), AWS ISO (US), AWS ISOB (US), AWS ISOE (Europe), and AWS ISOF. // // partitions := endpoints.DefaultPartitions // for _, p := range partitions { @@ -93,6 +103,8 @@ var defaultPartitions = partitions{ awsusgovPartition, awsisoPartition, awsisobPartition, + awsisoePartition, + awsisofPartition, } // AwsPartition returns the Resolver for AWS Standard. @@ -106,7 +118,7 @@ var awsPartition = partition{ DNSSuffix: "amazonaws.com", RegionRegex: regionRegex{ Regexp: func() *regexp.Regexp { - reg, _ := regexp.Compile("^(us|eu|ap|sa|ca|me|af)\\-\\w+\\-\\d+$") + reg, _ := regexp.Compile("^(us|eu|ap|sa|ca|me|af|il)\\-\\w+\\-\\d+$") return reg }(), }, @@ -172,6 +184,9 @@ var awsPartition = partition{ "ap-southeast-3": region{ Description: "Asia Pacific (Jakarta)", }, + "ap-southeast-4": region{ + Description: "Asia Pacific (Melbourne)", + }, "ca-central-1": region{ Description: "Canada (Central)", }, @@ -199,6 +214,9 @@ var awsPartition = partition{ "eu-west-3": region{ Description: "Europe (Paris)", }, + "il-central-1": region{ + Description: "Israel (Tel Aviv)", + }, "me-central-1": region{ Description: "Middle East (UAE)", }, @@ -261,6 +279,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -339,6 +360,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -432,6 +456,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -474,6 +501,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -582,6 +612,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -591,6 +624,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -603,12 +639,18 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -663,6 +705,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -846,6 +891,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-north-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -901,6 +949,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-north-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -935,6 +986,15 @@ var awsPartition = partition{ endpointKey{ Region: "ap-northeast-1", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -1168,6 +1228,14 @@ var awsPartition = partition{ Region: "ap-southeast-3", }, }, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{ + Hostname: "api.ecr.ap-southeast-4.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-4", + }, + }, endpointKey{ Region: "ca-central-1", }: endpoint{ @@ -1384,6 +1452,14 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{ + Hostname: "api.ecr.il-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "il-central-1", + }, + }, endpointKey{ Region: "me-central-1", }: endpoint{ @@ -1733,9 +1809,15 @@ var awsPartition = partition{ }, "api.mediatailor": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -1751,6 +1833,9 @@ var awsPartition = partition{ endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -1768,6 +1853,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, endpointKey{ Region: "us-east-1", }: endpoint{}, @@ -1801,6 +1889,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -1810,18 +1901,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -1831,6 +1931,12 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -2008,6 +2114,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -2084,6 +2193,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -2162,6 +2274,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -2275,6 +2390,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -2302,6 +2420,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -2345,24 +2466,39 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -2372,6 +2508,12 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -2481,6 +2623,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -2508,6 +2653,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -2551,24 +2699,36 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -2578,6 +2738,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -2910,6 +3073,15 @@ var awsPartition = partition{ endpointKey{ Region: "ap-northeast-1", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -3079,6 +3251,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -3094,12 +3269,18 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -3109,6 +3290,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -3139,6 +3323,12 @@ var awsPartition = partition{ endpointKey{ Region: "ap-northeast-1", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -3157,6 +3347,12 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-2", }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, endpointKey{ Region: "us-east-1", }: endpoint{}, @@ -3170,30 +3366,87 @@ var awsPartition = partition{ }, "arc-zonal-shift": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, endpointKey{ Region: "us-east-1", }: endpoint{}, endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -3255,6 +3508,15 @@ var awsPartition = partition{ }: endpoint{ Hostname: "athena.ap-south-1.api.aws", }, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "athena.ap-south-2.api.aws", + }, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -3282,6 +3544,15 @@ var awsPartition = partition{ }: endpoint{ Hostname: "athena.ap-southeast-3.api.aws", }, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "athena.ap-southeast-4.api.aws", + }, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -3300,6 +3571,15 @@ var awsPartition = partition{ }: endpoint{ Hostname: "athena.eu-central-1.api.aws", }, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "athena.eu-central-2.api.aws", + }, endpointKey{ Region: "eu-north-1", }: endpoint{}, @@ -3318,6 +3598,15 @@ var awsPartition = partition{ }: endpoint{ Hostname: "athena.eu-south-1.api.aws", }, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "athena.eu-south-2.api.aws", + }, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -3381,6 +3670,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "athena.me-central-1.api.aws", + }, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -3414,6 +3712,12 @@ var awsPartition = partition{ }: endpoint{ Hostname: "athena-fips.us-east-1.amazonaws.com", }, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "athena-fips.us-east-1.api.aws", + }, endpointKey{ Region: "us-east-2", }: endpoint{}, @@ -3429,6 +3733,12 @@ var awsPartition = partition{ }: endpoint{ Hostname: "athena-fips.us-east-2.amazonaws.com", }, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "athena-fips.us-east-2.api.aws", + }, endpointKey{ Region: "us-west-1", }: endpoint{}, @@ -3444,6 +3754,12 @@ var awsPartition = partition{ }: endpoint{ Hostname: "athena-fips.us-west-1.amazonaws.com", }, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "athena-fips.us-west-1.api.aws", + }, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -3459,6 +3775,12 @@ var awsPartition = partition{ }: endpoint{ Hostname: "athena-fips.us-west-2.amazonaws.com", }, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "athena-fips.us-west-2.api.aws", + }, }, }, "auditmanager": service{ @@ -3538,6 +3860,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -3565,6 +3890,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -3683,6 +4011,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -3692,18 +4023,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -3713,6 +4053,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -3802,15 +4145,84 @@ var awsPartition = partition{ }, "backupstorage": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, endpointKey{ Region: "us-east-1", }: endpoint{}, endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -3844,6 +4256,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -3853,18 +4268,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -3910,6 +4334,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -4000,12 +4427,47 @@ var awsPartition = partition{ }, "cases": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{}, endpointKey{ Region: "us-west-2", }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{}, }, }, "cassandra": service{ @@ -4137,6 +4599,43 @@ var awsPartition = partition{ }, }, }, + "cleanrooms": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + }, + }, "cloud9": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -4236,6 +4735,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -4314,6 +4816,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -4424,6 +4929,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -4451,6 +4959,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -4598,6 +5109,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, @@ -4613,6 +5127,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -4702,6 +5219,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -4765,6 +5285,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -4812,6 +5335,76 @@ var awsPartition = partition{ }, }, }, + "cloudtrail-data": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + }, + }, "codeartifact": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -4875,6 +5468,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -4884,18 +5480,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -4905,6 +5510,12 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -5016,12 +5627,18 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -5067,6 +5684,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -5179,6 +5799,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -5206,6 +5829,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -5325,6 +5951,9 @@ var awsPartition = partition{ }, "codepipeline": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, endpointKey{ Region: "ap-east-1", }: endpoint{}, @@ -5355,6 +5984,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, @@ -5415,6 +6047,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, endpointKey{ Region: "sa-east-1", }: endpoint{}, @@ -5525,6 +6160,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-north-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -5665,6 +6303,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-us-west-1", + }: endpoint{ + Hostname: "cognito-identity-fips.us-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-us-west-2", }: endpoint{ @@ -5701,6 +6348,12 @@ var awsPartition = partition{ endpointKey{ Region: "us-west-1", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "cognito-identity-fips.us-west-1.amazonaws.com", + }, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -6231,6 +6884,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -6294,6 +6950,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -6367,12 +7026,42 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-2", }: endpoint{}, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "connect-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "connect-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "connect-fips.us-east-1.amazonaws.com", + }, endpointKey{ Region: "us-west-2", }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "connect-fips.us-west-2.amazonaws.com", + }, }, }, "connect-campaigns": service{ @@ -6380,6 +7069,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, endpointKey{ Region: "eu-west-2", }: endpoint{}, @@ -6429,6 +7121,12 @@ var awsPartition = partition{ endpointKey{ Region: "ap-northeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, @@ -6451,12 +7149,21 @@ var awsPartition = partition{ }, "controltower": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, endpointKey{ Region: "ap-northeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, endpointKey{ Region: "ap-south-1", }: endpoint{}, @@ -6466,6 +7173,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -6490,6 +7200,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-north-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -6499,6 +7212,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, endpointKey{ Region: "sa-east-1", }: endpoint{}, @@ -6538,6 +7254,24 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "controltower-fips.us-west-1.amazonaws.com", + }, + endpointKey{ + Region: "us-west-1-fips", + }: endpoint{ + Hostname: "controltower-fips.us-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -7070,6 +7804,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -7079,6 +7816,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -7091,12 +7831,18 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -7273,6 +8019,12 @@ var awsPartition = partition{ endpointKey{ Region: "ca-central-1", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "devops-guru-fips.ca-central-1.amazonaws.com", + }, endpointKey{ Region: "eu-central-1", }: endpoint{}, @@ -7288,6 +8040,15 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "fips-ca-central-1", + }: endpoint{ + Hostname: "devops-guru-fips.ca-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ca-central-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-us-east-1", }: endpoint{ @@ -7306,6 +8067,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-us-west-1", + }: endpoint{ + Hostname: "devops-guru-fips.us-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-us-west-2", }: endpoint{ @@ -7339,6 +8109,12 @@ var awsPartition = partition{ endpointKey{ Region: "us-west-1", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "devops-guru-fips.us-west-1.amazonaws.com", + }, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -7382,6 +8158,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -7445,6 +8224,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -7537,6 +8319,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -7546,18 +8331,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -7622,6 +8416,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -7676,6 +8473,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -7895,6 +8695,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -7904,18 +8707,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -7925,6 +8737,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -7965,6 +8780,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -7974,6 +8792,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -7986,12 +8807,18 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -8046,6 +8873,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -8130,6 +8960,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -8172,6 +9005,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "local", }: endpoint{ @@ -8284,6 +9120,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -8293,6 +9132,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -8305,12 +9147,18 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -8365,6 +9213,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -8455,6 +9306,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -8539,6 +9393,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -8642,6 +9499,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -8705,6 +9565,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -8805,6 +9668,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -8814,18 +9680,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -8871,6 +9746,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -8950,6 +9828,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -8986,6 +9867,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -9155,6 +10039,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -9255,6 +10142,15 @@ var awsPartition = partition{ }: endpoint{ Hostname: "elasticfilesystem-fips.ap-south-1.amazonaws.com", }, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "elasticfilesystem-fips.ap-south-2.amazonaws.com", + }, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -9282,6 +10178,15 @@ var awsPartition = partition{ }: endpoint{ Hostname: "elasticfilesystem-fips.ap-southeast-3.amazonaws.com", }, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + Variant: fipsVariant, + }: endpoint{ + Hostname: "elasticfilesystem-fips.ap-southeast-4.amazonaws.com", + }, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -9300,6 +10205,15 @@ var awsPartition = partition{ }: endpoint{ Hostname: "elasticfilesystem-fips.eu-central-1.amazonaws.com", }, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "elasticfilesystem-fips.eu-central-2.amazonaws.com", + }, endpointKey{ Region: "eu-north-1", }: endpoint{}, @@ -9318,6 +10232,15 @@ var awsPartition = partition{ }: endpoint{ Hostname: "elasticfilesystem-fips.eu-south-1.amazonaws.com", }, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "elasticfilesystem-fips.eu-south-2.amazonaws.com", + }, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -9399,6 +10322,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-ap-south-2", + }: endpoint{ + Hostname: "elasticfilesystem-fips.ap-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-south-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-ap-southeast-1", }: endpoint{ @@ -9426,6 +10358,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-ap-southeast-4", + }: endpoint{ + Hostname: "elasticfilesystem-fips.ap-southeast-4.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-4", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-ca-central-1", }: endpoint{ @@ -9444,6 +10385,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-eu-central-2", + }: endpoint{ + Hostname: "elasticfilesystem-fips.eu-central-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-central-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-eu-north-1", }: endpoint{ @@ -9462,6 +10412,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-eu-south-2", + }: endpoint{ + Hostname: "elasticfilesystem-fips.eu-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-south-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-eu-west-1", }: endpoint{ @@ -9489,6 +10448,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-il-central-1", + }: endpoint{ + Hostname: "elasticfilesystem-fips.il-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "il-central-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-me-central-1", }: endpoint{ @@ -9552,6 +10520,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "il-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "elasticfilesystem-fips.il-central-1.amazonaws.com", + }, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -9654,6 +10631,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -9717,6 +10697,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -9802,6 +10785,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -9882,6 +10868,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -10059,6 +11048,12 @@ var awsPartition = partition{ }, "emr-containers": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, @@ -10089,6 +11084,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-north-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -10143,6 +11141,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, endpointKey{ Region: "sa-east-1", }: endpoint{}, @@ -10186,6 +11187,9 @@ var awsPartition = partition{ }, "emr-serverless": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, @@ -10270,6 +11274,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, endpointKey{ Region: "sa-east-1", }: endpoint{}, @@ -10357,6 +11364,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -10393,6 +11403,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -10508,6 +11521,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -10571,6 +11587,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -10725,6 +11744,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -10734,18 +11756,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -10791,6 +11822,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -10893,6 +11927,9 @@ var awsPartition = partition{ }: endpoint{ Hostname: "fms-fips.ap-south-1.amazonaws.com", }, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -10911,6 +11948,12 @@ var awsPartition = partition{ }: endpoint{ Hostname: "fms-fips.ap-southeast-2.amazonaws.com", }, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -10929,6 +11972,9 @@ var awsPartition = partition{ }: endpoint{ Hostname: "fms-fips.eu-central-1.amazonaws.com", }, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, @@ -10941,6 +11987,9 @@ var awsPartition = partition{ }: endpoint{ Hostname: "fms-fips.eu-south-1.amazonaws.com", }, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -11139,6 +12188,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -11395,6 +12447,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -11404,6 +12459,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -11416,12 +12474,18 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -11521,6 +12585,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -11737,12 +12804,18 @@ var awsPartition = partition{ endpointKey{ Region: "ap-northeast-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, @@ -11752,6 +12825,12 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-1", }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, endpointKey{ Region: "us-east-1", }: endpoint{}, @@ -11933,6 +13012,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -11942,18 +13024,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -11999,6 +13090,12 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -12153,6 +13250,12 @@ var awsPartition = partition{ endpointKey{ Region: "ca-central-1", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "greengrass-fips.ca-central-1.amazonaws.com", + }, endpointKey{ Region: "eu-central-1", }: endpoint{}, @@ -12162,15 +13265,69 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-2", }: endpoint{}, + endpointKey{ + Region: "fips-ca-central-1", + }: endpoint{ + Hostname: "greengrass-fips.ca-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ca-central-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "greengrass-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-2", + }: endpoint{ + Hostname: "greengrass-fips.us-east-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "greengrass-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "greengrass-fips.us-east-1.amazonaws.com", + }, endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "greengrass-fips.us-east-2.amazonaws.com", + }, endpointKey{ Region: "us-west-2", }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "greengrass-fips.us-west-2.amazonaws.com", + }, }, }, "groundstation": service{ @@ -12284,6 +13441,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -12293,6 +13453,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -12308,6 +13471,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -12454,6 +13620,9 @@ var awsPartition = partition{ }, }, Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, endpointKey{ Region: "us-east-1", }: endpoint{}, @@ -12558,12 +13727,21 @@ var awsPartition = partition{ }, "identitystore": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, endpointKey{ Region: "ap-northeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, endpointKey{ Region: "ap-south-1", }: endpoint{}, @@ -12573,6 +13751,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -12582,18 +13763,33 @@ var awsPartition = partition{ endpointKey{ Region: "eu-north-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, endpointKey{ Region: "eu-west-2", }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, endpointKey{ Region: "us-east-1", }: endpoint{}, endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -12862,6 +14058,42 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "inspector2-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-2", + }: endpoint{ + Hostname: "inspector2-fips.us-east-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-1", + }: endpoint{ + Hostname: "inspector2-fips.us-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "inspector2-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -12871,25 +14103,227 @@ var awsPartition = partition{ endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "inspector2-fips.us-east-1.amazonaws.com", + }, endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "inspector2-fips.us-east-2.amazonaws.com", + }, endpointKey{ Region: "us-west-1", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "inspector2-fips.us-west-1.amazonaws.com", + }, endpointKey{ Region: "us-west-2", }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "inspector2-fips.us-west-2.amazonaws.com", + }, }, }, - "iot": service{ + "internetmonitor": service{ Defaults: endpointDefaults{ defaultKey{}: endpoint{ - CredentialScope: credentialScope{ - Service: "execute-api", - }, + DNSSuffix: "api.aws", + }, + defaultKey{ + Variant: fipsVariant, + }: endpoint{ + Hostname: "{service}-fips.{region}.{dnsSuffix}", + DNSSuffix: "api.aws", + }, + }, + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{ + Hostname: "internetmonitor.af-south-1.api.aws", + }, + endpointKey{ + Region: "ap-east-1", + }: endpoint{ + Hostname: "internetmonitor.ap-east-1.api.aws", + }, + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{ + Hostname: "internetmonitor.ap-northeast-1.api.aws", + }, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{ + Hostname: "internetmonitor.ap-northeast-2.api.aws", + }, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{ + Hostname: "internetmonitor.ap-northeast-3.api.aws", + }, + endpointKey{ + Region: "ap-south-1", + }: endpoint{ + Hostname: "internetmonitor.ap-south-1.api.aws", + }, + endpointKey{ + Region: "ap-south-2", + }: endpoint{ + Hostname: "internetmonitor.ap-south-2.api.aws", + }, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{ + Hostname: "internetmonitor.ap-southeast-1.api.aws", + }, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{ + Hostname: "internetmonitor.ap-southeast-2.api.aws", + }, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{ + Hostname: "internetmonitor.ap-southeast-3.api.aws", + }, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{ + Hostname: "internetmonitor.ap-southeast-4.api.aws", + }, + endpointKey{ + Region: "ca-central-1", + }: endpoint{ + Hostname: "internetmonitor.ca-central-1.api.aws", + }, + endpointKey{ + Region: "ca-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "internetmonitor-fips.ca-central-1.api.aws", + }, + endpointKey{ + Region: "eu-central-1", + }: endpoint{ + Hostname: "internetmonitor.eu-central-1.api.aws", + }, + endpointKey{ + Region: "eu-central-2", + }: endpoint{ + Hostname: "internetmonitor.eu-central-2.api.aws", + }, + endpointKey{ + Region: "eu-north-1", + }: endpoint{ + Hostname: "internetmonitor.eu-north-1.api.aws", + }, + endpointKey{ + Region: "eu-south-1", + }: endpoint{ + Hostname: "internetmonitor.eu-south-1.api.aws", + }, + endpointKey{ + Region: "eu-south-2", + }: endpoint{ + Hostname: "internetmonitor.eu-south-2.api.aws", + }, + endpointKey{ + Region: "eu-west-1", + }: endpoint{ + Hostname: "internetmonitor.eu-west-1.api.aws", + }, + endpointKey{ + Region: "eu-west-2", + }: endpoint{ + Hostname: "internetmonitor.eu-west-2.api.aws", + }, + endpointKey{ + Region: "eu-west-3", + }: endpoint{ + Hostname: "internetmonitor.eu-west-3.api.aws", + }, + endpointKey{ + Region: "il-central-1", + }: endpoint{ + Hostname: "internetmonitor.il-central-1.api.aws", + }, + endpointKey{ + Region: "me-central-1", + }: endpoint{ + Hostname: "internetmonitor.me-central-1.api.aws", + }, + endpointKey{ + Region: "me-south-1", + }: endpoint{ + Hostname: "internetmonitor.me-south-1.api.aws", + }, + endpointKey{ + Region: "sa-east-1", + }: endpoint{ + Hostname: "internetmonitor.sa-east-1.api.aws", + }, + endpointKey{ + Region: "us-east-1", + }: endpoint{ + Hostname: "internetmonitor.us-east-1.api.aws", + }, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "internetmonitor-fips.us-east-1.api.aws", + }, + endpointKey{ + Region: "us-east-2", + }: endpoint{ + Hostname: "internetmonitor.us-east-2.api.aws", + }, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "internetmonitor-fips.us-east-2.api.aws", + }, + endpointKey{ + Region: "us-west-1", + }: endpoint{ + Hostname: "internetmonitor.us-west-1.api.aws", + }, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "internetmonitor-fips.us-west-1.api.aws", + }, + endpointKey{ + Region: "us-west-2", + }: endpoint{ + Hostname: "internetmonitor.us-west-2.api.aws", + }, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "internetmonitor-fips.us-west-2.api.aws", }, }, + }, + "iot": service{ Endpoints: serviceEndpoints{ endpointKey{ Region: "ap-east-1", @@ -12937,45 +14371,35 @@ var awsPartition = partition{ Region: "fips-ca-central-1", }: endpoint{ Hostname: "iot-fips.ca-central-1.amazonaws.com", - CredentialScope: credentialScope{ - Service: "execute-api", - }, + Deprecated: boxedTrue, }, endpointKey{ Region: "fips-us-east-1", }: endpoint{ Hostname: "iot-fips.us-east-1.amazonaws.com", - CredentialScope: credentialScope{ - Service: "execute-api", - }, + Deprecated: boxedTrue, }, endpointKey{ Region: "fips-us-east-2", }: endpoint{ Hostname: "iot-fips.us-east-2.amazonaws.com", - CredentialScope: credentialScope{ - Service: "execute-api", - }, + Deprecated: boxedTrue, }, endpointKey{ Region: "fips-us-west-1", }: endpoint{ Hostname: "iot-fips.us-west-1.amazonaws.com", - CredentialScope: credentialScope{ - Service: "execute-api", - }, + Deprecated: boxedTrue, }, endpointKey{ Region: "fips-us-west-2", }: endpoint{ Hostname: "iot-fips.us-west-2.amazonaws.com", - CredentialScope: credentialScope{ - Service: "execute-api", - }, + Deprecated: boxedTrue, }, endpointKey{ @@ -13620,18 +15044,176 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "api-ap-southeast-1", + }: endpoint{ + Hostname: "api.iottwinmaker.ap-southeast-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-1", + }, + }, + endpointKey{ + Region: "api-ap-southeast-2", + }: endpoint{ + Hostname: "api.iottwinmaker.ap-southeast-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-2", + }, + }, + endpointKey{ + Region: "api-eu-central-1", + }: endpoint{ + Hostname: "api.iottwinmaker.eu-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-central-1", + }, + }, + endpointKey{ + Region: "api-eu-west-1", + }: endpoint{ + Hostname: "api.iottwinmaker.eu-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-west-1", + }, + }, + endpointKey{ + Region: "api-us-east-1", + }: endpoint{ + Hostname: "api.iottwinmaker.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + }, + endpointKey{ + Region: "api-us-west-2", + }: endpoint{ + Hostname: "api.iottwinmaker.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + }, + endpointKey{ + Region: "data-ap-southeast-1", + }: endpoint{ + Hostname: "data.iottwinmaker.ap-southeast-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-1", + }, + }, + endpointKey{ + Region: "data-ap-southeast-2", + }: endpoint{ + Hostname: "data.iottwinmaker.ap-southeast-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-2", + }, + }, + endpointKey{ + Region: "data-eu-central-1", + }: endpoint{ + Hostname: "data.iottwinmaker.eu-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-central-1", + }, + }, + endpointKey{ + Region: "data-eu-west-1", + }: endpoint{ + Hostname: "data.iottwinmaker.eu-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-west-1", + }, + }, + endpointKey{ + Region: "data-us-east-1", + }: endpoint{ + Hostname: "data.iottwinmaker.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + }, + endpointKey{ + Region: "data-us-west-2", + }: endpoint{ + Hostname: "data.iottwinmaker.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + }, endpointKey{ Region: "eu-central-1", }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, + endpointKey{ + Region: "fips-api-us-east-1", + }: endpoint{ + Hostname: "api.iottwinmaker-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + }, + endpointKey{ + Region: "fips-api-us-west-2", + }: endpoint{ + Hostname: "api.iottwinmaker-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + }, + endpointKey{ + Region: "fips-data-us-east-1", + }: endpoint{ + Hostname: "data.iottwinmaker-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + }, + endpointKey{ + Region: "fips-data-us-west-2", + }: endpoint{ + Hostname: "data.iottwinmaker-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + }, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "iottwinmaker-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "iottwinmaker-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "iottwinmaker-fips.us-east-1.amazonaws.com", + }, endpointKey{ Region: "us-west-2", }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "iottwinmaker-fips.us-west-2.amazonaws.com", + }, }, }, "iotwireless": service{ @@ -13728,6 +15310,31 @@ var awsPartition = partition{ }: endpoint{}, }, }, + "ivsrealtime": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + }, + }, "kafka": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -13748,6 +15355,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -13757,18 +15367,33 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kafka-fips.ca-central-1.amazonaws.com", + }, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -13778,6 +15403,54 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "fips-ca-central-1", + }: endpoint{ + Hostname: "kafka-fips.ca-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ca-central-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "kafka-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-2", + }: endpoint{ + Hostname: "kafka-fips.us-east-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-1", + }: endpoint{ + Hostname: "kafka-fips.us-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "kafka-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -13787,15 +15460,39 @@ var awsPartition = partition{ endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kafka-fips.us-east-1.amazonaws.com", + }, endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kafka-fips.us-east-2.amazonaws.com", + }, endpointKey{ Region: "us-west-1", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kafka-fips.us-west-1.amazonaws.com", + }, endpointKey{ Region: "us-west-2", }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kafka-fips.us-west-2.amazonaws.com", + }, }, }, "kafkaconnect": service{ @@ -13852,6 +15549,12 @@ var awsPartition = partition{ }, "kendra": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -13864,6 +15567,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-1", }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, endpointKey{ Region: "fips-us-east-1", }: endpoint{ @@ -13920,6 +15626,175 @@ var awsPartition = partition{ }, }, }, + "kendra-ranking": service{ + Defaults: endpointDefaults{ + defaultKey{}: endpoint{ + DNSSuffix: "api.aws", + }, + defaultKey{ + Variant: fipsVariant, + }: endpoint{ + Hostname: "{service}-fips.{region}.{dnsSuffix}", + DNSSuffix: "api.aws", + }, + }, + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{ + Hostname: "kendra-ranking.af-south-1.api.aws", + }, + endpointKey{ + Region: "ap-east-1", + }: endpoint{ + Hostname: "kendra-ranking.ap-east-1.api.aws", + }, + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{ + Hostname: "kendra-ranking.ap-northeast-1.api.aws", + }, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{ + Hostname: "kendra-ranking.ap-northeast-2.api.aws", + }, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{ + Hostname: "kendra-ranking.ap-northeast-3.api.aws", + }, + endpointKey{ + Region: "ap-south-1", + }: endpoint{ + Hostname: "kendra-ranking.ap-south-1.api.aws", + }, + endpointKey{ + Region: "ap-south-2", + }: endpoint{ + Hostname: "kendra-ranking.ap-south-2.api.aws", + }, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{ + Hostname: "kendra-ranking.ap-southeast-1.api.aws", + }, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{ + Hostname: "kendra-ranking.ap-southeast-2.api.aws", + }, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{ + Hostname: "kendra-ranking.ap-southeast-3.api.aws", + }, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{ + Hostname: "kendra-ranking.ap-southeast-4.api.aws", + }, + endpointKey{ + Region: "ca-central-1", + }: endpoint{ + Hostname: "kendra-ranking.ca-central-1.api.aws", + }, + endpointKey{ + Region: "ca-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kendra-ranking-fips.ca-central-1.api.aws", + }, + endpointKey{ + Region: "eu-central-2", + }: endpoint{ + Hostname: "kendra-ranking.eu-central-2.api.aws", + }, + endpointKey{ + Region: "eu-north-1", + }: endpoint{ + Hostname: "kendra-ranking.eu-north-1.api.aws", + }, + endpointKey{ + Region: "eu-south-1", + }: endpoint{ + Hostname: "kendra-ranking.eu-south-1.api.aws", + }, + endpointKey{ + Region: "eu-south-2", + }: endpoint{ + Hostname: "kendra-ranking.eu-south-2.api.aws", + }, + endpointKey{ + Region: "eu-west-1", + }: endpoint{ + Hostname: "kendra-ranking.eu-west-1.api.aws", + }, + endpointKey{ + Region: "eu-west-3", + }: endpoint{ + Hostname: "kendra-ranking.eu-west-3.api.aws", + }, + endpointKey{ + Region: "il-central-1", + }: endpoint{ + Hostname: "kendra-ranking.il-central-1.api.aws", + }, + endpointKey{ + Region: "me-central-1", + }: endpoint{ + Hostname: "kendra-ranking.me-central-1.api.aws", + }, + endpointKey{ + Region: "me-south-1", + }: endpoint{ + Hostname: "kendra-ranking.me-south-1.api.aws", + }, + endpointKey{ + Region: "sa-east-1", + }: endpoint{ + Hostname: "kendra-ranking.sa-east-1.api.aws", + }, + endpointKey{ + Region: "us-east-1", + }: endpoint{ + Hostname: "kendra-ranking.us-east-1.api.aws", + }, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kendra-ranking-fips.us-east-1.api.aws", + }, + endpointKey{ + Region: "us-east-2", + }: endpoint{ + Hostname: "kendra-ranking.us-east-2.api.aws", + }, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kendra-ranking-fips.us-east-2.api.aws", + }, + endpointKey{ + Region: "us-west-1", + }: endpoint{ + Hostname: "kendra-ranking.us-west-1.api.aws", + }, + endpointKey{ + Region: "us-west-2", + }: endpoint{ + Hostname: "kendra-ranking.us-west-2.api.aws", + }, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kendra-ranking-fips.us-west-2.api.aws", + }, + }, + }, "kinesis": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -13952,6 +15827,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -14015,6 +15893,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -14082,6 +15963,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -14091,18 +15975,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -14112,6 +16005,12 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -14375,6 +16274,24 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kms-fips.ap-southeast-4.amazonaws.com", + }, + endpointKey{ + Region: "ap-southeast-4-fips", + }: endpoint{ + Hostname: "kms-fips.ap-southeast-4.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-4", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -14537,6 +16454,24 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "il-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kms-fips.il-central-1.amazonaws.com", + }, + endpointKey{ + Region: "il-central-1-fips", + }: endpoint{ + Hostname: "kms-fips.il-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "il-central-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -14685,24 +16620,39 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -14748,6 +16698,12 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -14884,6 +16840,15 @@ var awsPartition = partition{ }: endpoint{ Hostname: "lambda.ap-southeast-3.api.aws", }, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "lambda.ap-southeast-4.api.aws", + }, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -15001,6 +16966,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "il-central-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "lambda.il-central-1.api.aws", + }, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -15220,6 +17194,154 @@ var awsPartition = partition{ }, }, }, + "license-manager-linux-subscriptions": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "license-manager-linux-subscriptions-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-2", + }: endpoint{ + Hostname: "license-manager-linux-subscriptions-fips.us-east-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-1", + }: endpoint{ + Hostname: "license-manager-linux-subscriptions-fips.us-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "license-manager-linux-subscriptions-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "license-manager-linux-subscriptions-fips.us-east-1.amazonaws.com", + }, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "license-manager-linux-subscriptions-fips.us-east-2.amazonaws.com", + }, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "license-manager-linux-subscriptions-fips.us-west-1.amazonaws.com", + }, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "license-manager-linux-subscriptions-fips.us-west-2.amazonaws.com", + }, + }, + }, "license-manager-user-subscriptions": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -15425,6 +17547,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -15488,6 +17613,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -15609,6 +17737,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-northeast-1", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, endpointKey{ Region: "ap-south-1", }: endpoint{}, @@ -15649,6 +17780,18 @@ var awsPartition = partition{ Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-us-east-2", + }: endpoint{ + + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-1", + }: endpoint{ + + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-us-west-2", }: endpoint{ @@ -15665,6 +17808,20 @@ var awsPartition = partition{ Region: "us-east-1", Variant: fipsVariant, }: endpoint{}, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant, + }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant, + }: endpoint{}, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -15928,6 +18085,9 @@ var awsPartition = partition{ }, "mediaconnect": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, endpointKey{ Region: "ap-east-1", }: endpoint{}, @@ -15937,6 +18097,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-northeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, endpointKey{ Region: "ap-south-1", }: endpoint{}, @@ -15946,6 +18109,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, @@ -15980,6 +18146,9 @@ var awsPartition = partition{ }, "mediaconvert": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, @@ -16214,53 +18383,111 @@ var awsPartition = partition{ Region: "ap-southeast-2", }: endpoint{}, endpointKey{ - Region: "eu-central-1", - }: endpoint{}, - endpointKey{ - Region: "eu-north-1", - }: endpoint{}, - endpointKey{ - Region: "eu-west-1", - }: endpoint{}, - endpointKey{ - Region: "eu-west-2", - }: endpoint{}, - endpointKey{ - Region: "eu-west-3", - }: endpoint{}, - endpointKey{ - Region: "sa-east-1", - }: endpoint{}, - endpointKey{ - Region: "us-east-1", - }: endpoint{}, - endpointKey{ - Region: "us-east-2", - }: endpoint{}, - endpointKey{ - Region: "us-west-1", - }: endpoint{}, - endpointKey{ - Region: "us-west-2", - }: endpoint{}, - }, - }, - "mediapackage-vod": service{ - Endpoints: serviceEndpoints{ - endpointKey{ - Region: "ap-northeast-1", - }: endpoint{}, - endpointKey{ - Region: "ap-northeast-2", - }: endpoint{}, - endpointKey{ - Region: "ap-south-1", - }: endpoint{}, - endpointKey{ - Region: "ap-southeast-1", - }: endpoint{}, - endpointKey{ - Region: "ap-southeast-2", + Region: "ca-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + }, + }, + "mediapackage-vod": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + }, + }, + "mediapackagev2": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", @@ -16501,6 +18728,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -16528,6 +18758,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -16571,6 +18804,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -16580,24 +18816,39 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, endpointKey{ Region: "eu-west-2", }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -16666,6 +18917,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -16675,18 +18929,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -16696,6 +18959,45 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "mgn-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-2", + }: endpoint{ + Hostname: "mgn-fips.us-east-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-1", + }: endpoint{ + Hostname: "mgn-fips.us-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "mgn-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -16705,15 +19007,39 @@ var awsPartition = partition{ endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "mgn-fips.us-east-1.amazonaws.com", + }, endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "mgn-fips.us-east-2.amazonaws.com", + }, endpointKey{ Region: "us-west-1", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "mgn-fips.us-west-1.amazonaws.com", + }, endpointKey{ Region: "us-west-2", }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "mgn-fips.us-west-2.amazonaws.com", + }, }, }, "migrationhub-orchestrator": service{ @@ -16920,6 +19246,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -16983,6 +19312,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -17050,6 +19382,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -17059,18 +19394,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -17344,12 +19688,21 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -17362,12 +19715,18 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -17422,6 +19781,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -17478,6 +19840,24 @@ var awsPartition = partition{ Region: "us-west-2", }, }, + endpointKey{ + Region: "aws-global", + Variant: fipsVariant, + }: endpoint{ + Hostname: "networkmanager-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + }, + endpointKey{ + Region: "fips-aws-global", + }: endpoint{ + Hostname: "networkmanager-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, }, }, "nimble": service{ @@ -17485,18 +19865,33 @@ var awsPartition = partition{ endpointKey{ Region: "ap-northeast-1", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, endpointKey{ Region: "eu-west-2", }: endpoint{}, endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -17534,6 +19929,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -17561,6 +19959,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -17586,6 +19987,14 @@ var awsPartition = partition{ }, "oidc": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{ + Hostname: "oidc.af-south-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "af-south-1", + }, + }, endpointKey{ Region: "ap-east-1", }: endpoint{ @@ -17642,6 +20051,14 @@ var awsPartition = partition{ Region: "ap-southeast-2", }, }, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{ + Hostname: "oidc.ap-southeast-3.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-3", + }, + }, endpointKey{ Region: "ca-central-1", }: endpoint{ @@ -17730,6 +20147,14 @@ var awsPartition = partition{ Region: "us-east-2", }, }, + endpointKey{ + Region: "us-west-1", + }: endpoint{ + Hostname: "oidc.us-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-1", + }, + }, endpointKey{ Region: "us-west-2", }: endpoint{ @@ -17740,6 +20165,94 @@ var awsPartition = partition{ }, }, }, + "omics": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{ + Hostname: "omics.ap-southeast-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-1", + }, + }, + endpointKey{ + Region: "eu-central-1", + }: endpoint{ + Hostname: "omics.eu-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-central-1", + }, + }, + endpointKey{ + Region: "eu-west-1", + }: endpoint{ + Hostname: "omics.eu-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-west-1", + }, + }, + endpointKey{ + Region: "eu-west-2", + }: endpoint{ + Hostname: "omics.eu-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-west-2", + }, + }, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "omics-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "omics-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "us-east-1", + }: endpoint{ + Hostname: "omics.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + }, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "omics-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + }, + endpointKey{ + Region: "us-west-2", + }: endpoint{ + Hostname: "omics.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + }, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "omics-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + }, + }, + }, "opsworks": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -17852,6 +20365,40 @@ var awsPartition = partition{ }, }, }, + "osis": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + }, + }, "outposts": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -18130,6 +20677,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -18157,6 +20707,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -18406,6 +20959,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-northeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, endpointKey{ Region: "ap-south-1", }: endpoint{}, @@ -18515,6 +21071,14 @@ var awsPartition = partition{ }, "portal.sso": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{ + Hostname: "portal.sso.af-south-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "af-south-1", + }, + }, endpointKey{ Region: "ap-east-1", }: endpoint{ @@ -18571,6 +21135,14 @@ var awsPartition = partition{ Region: "ap-southeast-2", }, }, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{ + Hostname: "portal.sso.ap-southeast-3.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-3", + }, + }, endpointKey{ Region: "ca-central-1", }: endpoint{ @@ -18659,6 +21231,14 @@ var awsPartition = partition{ Region: "us-east-2", }, }, + endpointKey{ + Region: "us-west-1", + }: endpoint{ + Hostname: "portal.sso.us-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-1", + }, + }, endpointKey{ Region: "us-west-2", }: endpoint{ @@ -18689,18 +21269,63 @@ var awsPartition = partition{ endpointKey{ Region: "ca-central-1", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "profile-fips.ca-central-1.amazonaws.com", + }, endpointKey{ Region: "eu-central-1", }: endpoint{}, endpointKey{ Region: "eu-west-2", }: endpoint{}, + endpointKey{ + Region: "fips-ca-central-1", + }: endpoint{ + Hostname: "profile-fips.ca-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ca-central-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "profile-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "profile-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "profile-fips.us-east-1.amazonaws.com", + }, endpointKey{ Region: "us-west-2", }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "profile-fips.us-west-2.amazonaws.com", + }, }, }, "projects.iot1click": service{ @@ -18879,21 +21504,24 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-2", }: endpoint{}, - endpointKey{ - Region: "api", - }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, endpointKey{ Region: "eu-west-2", }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, endpointKey{ Region: "sa-east-1", }: endpoint{}, @@ -18928,6 +21556,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -18937,6 +21568,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -18949,12 +21583,18 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -19009,6 +21649,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -19088,6 +21731,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -19166,6 +21812,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -19245,6 +21894,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -19287,6 +21939,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -19646,6 +22301,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -19724,6 +22382,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -19779,12 +22440,18 @@ var awsPartition = partition{ endpointKey{ Region: "ap-northeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, @@ -19797,12 +22464,18 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-2", }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, endpointKey{ Region: "us-east-1", }: endpoint{}, endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -20138,16 +22811,6 @@ var awsPartition = partition{ }, }, Endpoints: serviceEndpoints{ - endpointKey{ - Region: "af-south-1", - }: endpoint{ - Hostname: "resource-explorer-2.af-south-1.api.aws", - }, - endpointKey{ - Region: "ap-east-1", - }: endpoint{ - Hostname: "resource-explorer-2.ap-east-1.api.aws", - }, endpointKey{ Region: "ap-northeast-1", }: endpoint{ @@ -20183,6 +22846,11 @@ var awsPartition = partition{ }: endpoint{ Hostname: "resource-explorer-2.ap-southeast-2.api.aws", }, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{ + Hostname: "resource-explorer-2.ap-southeast-4.api.aws", + }, endpointKey{ Region: "ca-central-1", }: endpoint{ @@ -20218,6 +22886,11 @@ var awsPartition = partition{ }: endpoint{ Hostname: "resource-explorer-2.eu-west-3.api.aws", }, + endpointKey{ + Region: "il-central-1", + }: endpoint{ + Hostname: "resource-explorer-2.il-central-1.api.aws", + }, endpointKey{ Region: "sa-east-1", }: endpoint{ @@ -20265,6 +22938,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -20274,18 +22950,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -20331,6 +23016,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -20549,6 +23237,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -20558,18 +23249,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -20579,6 +23279,12 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -20771,6 +23477,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -20780,18 +23489,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -20801,6 +23519,12 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -21009,6 +23733,15 @@ var awsPartition = partition{ }: endpoint{ Hostname: "s3.dualstack.ap-southeast-3.amazonaws.com", }, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "s3.dualstack.ap-southeast-4.amazonaws.com", + }, endpointKey{ Region: "aws-global", }: endpoint{ @@ -21160,6 +23893,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "il-central-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "s3.dualstack.il-central-1.amazonaws.com", + }, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -21946,30 +24688,84 @@ var awsPartition = partition{ }, "scheduler": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, endpointKey{ Region: "us-east-1", }: endpoint{}, endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -21977,6 +24773,9 @@ var awsPartition = partition{ }, "schemas": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, endpointKey{ Region: "ap-east-1", }: endpoint{}, @@ -21986,6 +24785,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-northeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, endpointKey{ Region: "ap-south-1", }: endpoint{}, @@ -21995,15 +24797,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -22013,6 +24827,12 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, endpointKey{ Region: "sa-east-1", }: endpoint{}, @@ -22098,6 +24918,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -22140,6 +24963,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -22243,6 +25069,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -22252,18 +25081,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -22309,6 +25147,12 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -22358,6 +25202,15 @@ var awsPartition = partition{ endpointKey{ Region: "ap-northeast-1", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, @@ -22367,12 +25220,21 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-1", }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, endpointKey{ Region: "us-east-1", }: endpoint{}, endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -22497,6 +25359,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -22506,18 +25371,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -22527,6 +25401,12 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -22627,6 +25507,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -22636,6 +25519,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -22648,12 +25534,18 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -22708,6 +25600,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -22757,39 +25652,123 @@ var awsPartition = partition{ endpointKey{ Region: "af-south-1", }: endpoint{}, + endpointKey{ + Region: "af-south-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.af-south-1.api.aws", + }, endpointKey{ Region: "ap-east-1", }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.ap-east-1.api.aws", + }, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.ap-northeast-1.api.aws", + }, endpointKey{ Region: "ap-northeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.ap-northeast-2.api.aws", + }, endpointKey{ Region: "ap-northeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.ap-northeast-3.api.aws", + }, endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.ap-south-1.api.aws", + }, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.ap-south-2.api.aws", + }, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.ap-southeast-1.api.aws", + }, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.ap-southeast-2.api.aws", + }, endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.ap-southeast-3.api.aws", + }, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.ap-southeast-4.api.aws", + }, endpointKey{ Region: "ca-central-1", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.ca-central-1.api.aws", + }, endpointKey{ Region: "ca-central-1", Variant: fipsVariant, }: endpoint{ Hostname: "servicediscovery-fips.ca-central-1.amazonaws.com", }, + endpointKey{ + Region: "ca-central-1", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery-fips.ca-central-1.api.aws", + }, endpointKey{ Region: "ca-central-1-fips", }: endpoint{ @@ -22802,66 +25781,132 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.eu-central-1.api.aws", + }, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.eu-central-2.api.aws", + }, endpointKey{ Region: "eu-north-1", }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.eu-north-1.api.aws", + }, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.eu-south-1.api.aws", + }, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.eu-south-2.api.aws", + }, endpointKey{ Region: "eu-west-1", }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.eu-west-1.api.aws", + }, endpointKey{ Region: "eu-west-2", }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.eu-west-2.api.aws", + }, endpointKey{ Region: "eu-west-3", }: endpoint{}, endpointKey{ - Region: "me-central-1", - }: endpoint{}, + Region: "eu-west-3", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.eu-west-3.api.aws", + }, endpointKey{ - Region: "me-south-1", + Region: "il-central-1", }: endpoint{}, endpointKey{ - Region: "sa-east-1", + Region: "il-central-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.il-central-1.api.aws", + }, + endpointKey{ + Region: "me-central-1", }: endpoint{}, endpointKey{ - Region: "servicediscovery", + Region: "me-central-1", + Variant: dualStackVariant, }: endpoint{ - CredentialScope: credentialScope{ - Region: "ca-central-1", - }, - Deprecated: boxedTrue, + Hostname: "servicediscovery.me-central-1.api.aws", }, endpointKey{ - Region: "servicediscovery", - Variant: fipsVariant, + Region: "me-south-1", + }: endpoint{}, + endpointKey{ + Region: "me-south-1", + Variant: dualStackVariant, }: endpoint{ - Hostname: "servicediscovery-fips.ca-central-1.amazonaws.com", - CredentialScope: credentialScope{ - Region: "ca-central-1", - }, - Deprecated: boxedTrue, + Hostname: "servicediscovery.me-south-1.api.aws", }, endpointKey{ - Region: "servicediscovery-fips", + Region: "sa-east-1", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + Variant: dualStackVariant, }: endpoint{ - Hostname: "servicediscovery-fips.ca-central-1.amazonaws.com", - CredentialScope: credentialScope{ - Region: "ca-central-1", - }, - Deprecated: boxedTrue, + Hostname: "servicediscovery.sa-east-1.api.aws", }, endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.us-east-1.api.aws", + }, endpointKey{ Region: "us-east-1", Variant: fipsVariant, }: endpoint{ Hostname: "servicediscovery-fips.us-east-1.amazonaws.com", }, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery-fips.us-east-1.api.aws", + }, endpointKey{ Region: "us-east-1-fips", }: endpoint{ @@ -22874,12 +25919,24 @@ var awsPartition = partition{ endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-east-2", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.us-east-2.api.aws", + }, endpointKey{ Region: "us-east-2", Variant: fipsVariant, }: endpoint{ Hostname: "servicediscovery-fips.us-east-2.amazonaws.com", }, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery-fips.us-east-2.api.aws", + }, endpointKey{ Region: "us-east-2-fips", }: endpoint{ @@ -22892,12 +25949,24 @@ var awsPartition = partition{ endpointKey{ Region: "us-west-1", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.us-west-1.api.aws", + }, endpointKey{ Region: "us-west-1", Variant: fipsVariant, }: endpoint{ Hostname: "servicediscovery-fips.us-west-1.amazonaws.com", }, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery-fips.us-west-1.api.aws", + }, endpointKey{ Region: "us-west-1-fips", }: endpoint{ @@ -22910,12 +25979,24 @@ var awsPartition = partition{ endpointKey{ Region: "us-west-2", }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.us-west-2.api.aws", + }, endpointKey{ Region: "us-west-2", Variant: fipsVariant, }: endpoint{ Hostname: "servicediscovery-fips.us-west-2.amazonaws.com", }, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery-fips.us-west-2.api.aws", + }, endpointKey{ Region: "us-west-2-fips", }: endpoint{ @@ -22952,6 +26033,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -22961,18 +26045,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -22982,6 +26075,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -23122,35 +26218,7 @@ var awsPartition = partition{ }, }, }, - "simspaceweaver": service{ - Endpoints: serviceEndpoints{ - endpointKey{ - Region: "ap-southeast-1", - }: endpoint{}, - endpointKey{ - Region: "ap-southeast-2", - }: endpoint{}, - endpointKey{ - Region: "eu-central-1", - }: endpoint{}, - endpointKey{ - Region: "eu-north-1", - }: endpoint{}, - endpointKey{ - Region: "eu-west-1", - }: endpoint{}, - endpointKey{ - Region: "us-east-1", - }: endpoint{}, - endpointKey{ - Region: "us-east-2", - }: endpoint{}, - endpointKey{ - Region: "us-west-2", - }: endpoint{}, - }, - }, - "sms": service{ + "signer": service{ Endpoints: serviceEndpoints{ endpointKey{ Region: "af-south-1", @@ -23197,7 +26265,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-east-1", }: endpoint{ - Hostname: "sms-fips.us-east-1.amazonaws.com", + Hostname: "signer-fips.us-east-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-east-1", }, @@ -23206,7 +26274,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-east-2", }: endpoint{ - Hostname: "sms-fips.us-east-2.amazonaws.com", + Hostname: "signer-fips.us-east-2.amazonaws.com", CredentialScope: credentialScope{ Region: "us-east-2", }, @@ -23215,7 +26283,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-west-1", }: endpoint{ - Hostname: "sms-fips.us-west-1.amazonaws.com", + Hostname: "signer-fips.us-west-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-west-1", }, @@ -23224,7 +26292,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-west-2", }: endpoint{ - Hostname: "sms-fips.us-west-2.amazonaws.com", + Hostname: "signer-fips.us-west-2.amazonaws.com", CredentialScope: credentialScope{ Region: "us-west-2", }, @@ -23243,7 +26311,7 @@ var awsPartition = partition{ Region: "us-east-1", Variant: fipsVariant, }: endpoint{ - Hostname: "sms-fips.us-east-1.amazonaws.com", + Hostname: "signer-fips.us-east-1.amazonaws.com", }, endpointKey{ Region: "us-east-2", @@ -23252,7 +26320,7 @@ var awsPartition = partition{ Region: "us-east-2", Variant: fipsVariant, }: endpoint{ - Hostname: "sms-fips.us-east-2.amazonaws.com", + Hostname: "signer-fips.us-east-2.amazonaws.com", }, endpointKey{ Region: "us-west-1", @@ -23261,7 +26329,57 @@ var awsPartition = partition{ Region: "us-west-1", Variant: fipsVariant, }: endpoint{ - Hostname: "sms-fips.us-west-1.amazonaws.com", + Hostname: "signer-fips.us-west-1.amazonaws.com", + }, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "signer-fips.us-west-2.amazonaws.com", + }, + }, + }, + "simspaceweaver": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + }, + }, + "sms": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "sms-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, }, endpointKey{ Region: "us-west-2", @@ -23291,6 +26409,12 @@ var awsPartition = partition{ endpointKey{ Region: "ca-central-1", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "sms-voice-fips.ca-central-1.amazonaws.com", + }, endpointKey{ Region: "eu-central-1", }: endpoint{}, @@ -23300,12 +26424,51 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-2", }: endpoint{}, + endpointKey{ + Region: "fips-ca-central-1", + }: endpoint{ + Hostname: "sms-voice-fips.ca-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ca-central-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "sms-voice-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "sms-voice-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "sms-voice-fips.us-east-1.amazonaws.com", + }, endpointKey{ Region: "us-west-2", }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "sms-voice-fips.us-west-2.amazonaws.com", + }, }, }, "snowball": service{ @@ -23568,6 +26731,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "sa-east-1", }: endpoint{}, @@ -23652,9 +26818,323 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "sns-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-2", + }: endpoint{ + Hostname: "sns-fips.us-east-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-1", + }: endpoint{ + Hostname: "sns-fips.us-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "sns-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "sns-fips.us-east-1.amazonaws.com", + }, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "sns-fips.us-east-2.amazonaws.com", + }, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "sns-fips.us-west-1.amazonaws.com", + }, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "sns-fips.us-west-2.amazonaws.com", + }, + }, + }, + "sqs": service{ + Defaults: endpointDefaults{ + defaultKey{}: endpoint{ + SSLCommonName: "{region}.queue.{dnsSuffix}", + Protocols: []string{"http", "https"}, + }, + }, + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "sqs-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-2", + }: endpoint{ + Hostname: "sqs-fips.us-east-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-1", + }: endpoint{ + Hostname: "sqs-fips.us-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "sqs-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{ + SSLCommonName: "queue.{dnsSuffix}", + }, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "sqs-fips.us-east-1.amazonaws.com", + SSLCommonName: "queue.{dnsSuffix}", + }, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "sqs-fips.us-east-2.amazonaws.com", + }, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "sqs-fips.us-west-1.amazonaws.com", + }, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "sqs-fips.us-west-2.amazonaws.com", + }, + }, + }, + "ssm": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "ssm-fips.ca-central-1.amazonaws.com", + }, endpointKey{ Region: "eu-central-1", }: endpoint{}, @@ -23679,10 +27159,19 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "fips-ca-central-1", + }: endpoint{ + Hostname: "ssm-fips.ca-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ca-central-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-us-east-1", }: endpoint{ - Hostname: "sns-fips.us-east-1.amazonaws.com", + Hostname: "ssm-fips.us-east-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-east-1", }, @@ -23691,7 +27180,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-east-2", }: endpoint{ - Hostname: "sns-fips.us-east-2.amazonaws.com", + Hostname: "ssm-fips.us-east-2.amazonaws.com", CredentialScope: credentialScope{ Region: "us-east-2", }, @@ -23700,7 +27189,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-west-1", }: endpoint{ - Hostname: "sns-fips.us-west-1.amazonaws.com", + Hostname: "ssm-fips.us-west-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-west-1", }, @@ -23709,12 +27198,15 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-west-2", }: endpoint{ - Hostname: "sns-fips.us-west-2.amazonaws.com", + Hostname: "ssm-fips.us-west-2.amazonaws.com", CredentialScope: credentialScope{ Region: "us-west-2", }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -23731,7 +27223,7 @@ var awsPartition = partition{ Region: "us-east-1", Variant: fipsVariant, }: endpoint{ - Hostname: "sns-fips.us-east-1.amazonaws.com", + Hostname: "ssm-fips.us-east-1.amazonaws.com", }, endpointKey{ Region: "us-east-2", @@ -23740,7 +27232,7 @@ var awsPartition = partition{ Region: "us-east-2", Variant: fipsVariant, }: endpoint{ - Hostname: "sns-fips.us-east-2.amazonaws.com", + Hostname: "ssm-fips.us-east-2.amazonaws.com", }, endpointKey{ Region: "us-west-1", @@ -23749,7 +27241,7 @@ var awsPartition = partition{ Region: "us-west-1", Variant: fipsVariant, }: endpoint{ - Hostname: "sns-fips.us-west-1.amazonaws.com", + Hostname: "ssm-fips.us-west-1.amazonaws.com", }, endpointKey{ Region: "us-west-2", @@ -23758,66 +27250,36 @@ var awsPartition = partition{ Region: "us-west-2", Variant: fipsVariant, }: endpoint{ - Hostname: "sns-fips.us-west-2.amazonaws.com", + Hostname: "ssm-fips.us-west-2.amazonaws.com", }, }, }, - "sqs": service{ - Defaults: endpointDefaults{ - defaultKey{}: endpoint{ - SSLCommonName: "{region}.queue.{dnsSuffix}", - Protocols: []string{"http", "https"}, - }, - }, + "ssm-contacts": service{ Endpoints: serviceEndpoints{ - endpointKey{ - Region: "af-south-1", - }: endpoint{}, - endpointKey{ - Region: "ap-east-1", - }: endpoint{}, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, endpointKey{ Region: "ap-northeast-2", }: endpoint{}, - endpointKey{ - Region: "ap-northeast-3", - }: endpoint{}, endpointKey{ Region: "ap-south-1", }: endpoint{}, - endpointKey{ - Region: "ap-south-2", - }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, - endpointKey{ - Region: "ap-southeast-3", - }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, endpointKey{ Region: "eu-central-1", }: endpoint{}, - endpointKey{ - Region: "eu-central-2", - }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, - endpointKey{ - Region: "eu-south-1", - }: endpoint{}, - endpointKey{ - Region: "eu-south-2", - }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -23830,7 +27292,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-east-1", }: endpoint{ - Hostname: "sqs-fips.us-east-1.amazonaws.com", + Hostname: "ssm-contacts-fips.us-east-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-east-1", }, @@ -23839,7 +27301,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-east-2", }: endpoint{ - Hostname: "sqs-fips.us-east-2.amazonaws.com", + Hostname: "ssm-contacts-fips.us-east-2.amazonaws.com", CredentialScope: credentialScope{ Region: "us-east-2", }, @@ -23848,7 +27310,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-west-1", }: endpoint{ - Hostname: "sqs-fips.us-west-1.amazonaws.com", + Hostname: "ssm-contacts-fips.us-west-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-west-1", }, @@ -23857,32 +27319,23 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-west-2", }: endpoint{ - Hostname: "sqs-fips.us-west-2.amazonaws.com", + Hostname: "ssm-contacts-fips.us-west-2.amazonaws.com", CredentialScope: credentialScope{ Region: "us-west-2", }, Deprecated: boxedTrue, }, - endpointKey{ - Region: "me-central-1", - }: endpoint{}, - endpointKey{ - Region: "me-south-1", - }: endpoint{}, endpointKey{ Region: "sa-east-1", }: endpoint{}, endpointKey{ Region: "us-east-1", - }: endpoint{ - SSLCommonName: "queue.{dnsSuffix}", - }, + }: endpoint{}, endpointKey{ Region: "us-east-1", Variant: fipsVariant, }: endpoint{ - Hostname: "sqs-fips.us-east-1.amazonaws.com", - SSLCommonName: "queue.{dnsSuffix}", + Hostname: "ssm-contacts-fips.us-east-1.amazonaws.com", }, endpointKey{ Region: "us-east-2", @@ -23891,7 +27344,7 @@ var awsPartition = partition{ Region: "us-east-2", Variant: fipsVariant, }: endpoint{ - Hostname: "sqs-fips.us-east-2.amazonaws.com", + Hostname: "ssm-contacts-fips.us-east-2.amazonaws.com", }, endpointKey{ Region: "us-west-1", @@ -23900,7 +27353,7 @@ var awsPartition = partition{ Region: "us-west-1", Variant: fipsVariant, }: endpoint{ - Hostname: "sqs-fips.us-west-1.amazonaws.com", + Hostname: "ssm-contacts-fips.us-west-1.amazonaws.com", }, endpointKey{ Region: "us-west-2", @@ -23909,42 +27362,27 @@ var awsPartition = partition{ Region: "us-west-2", Variant: fipsVariant, }: endpoint{ - Hostname: "sqs-fips.us-west-2.amazonaws.com", + Hostname: "ssm-contacts-fips.us-west-2.amazonaws.com", }, }, }, - "ssm": service{ + "ssm-incidents": service{ Endpoints: serviceEndpoints{ - endpointKey{ - Region: "af-south-1", - }: endpoint{}, - endpointKey{ - Region: "ap-east-1", - }: endpoint{}, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, endpointKey{ Region: "ap-northeast-2", }: endpoint{}, - endpointKey{ - Region: "ap-northeast-3", - }: endpoint{}, endpointKey{ Region: "ap-south-1", }: endpoint{}, - endpointKey{ - Region: "ap-south-2", - }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, - endpointKey{ - Region: "ap-southeast-3", - }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -23952,23 +27390,14 @@ var awsPartition = partition{ Region: "ca-central-1", Variant: fipsVariant, }: endpoint{ - Hostname: "ssm-fips.ca-central-1.amazonaws.com", + Hostname: "ssm-incidents-fips.ca-central-1.amazonaws.com", }, endpointKey{ Region: "eu-central-1", }: endpoint{}, - endpointKey{ - Region: "eu-central-2", - }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, - endpointKey{ - Region: "eu-south-1", - }: endpoint{}, - endpointKey{ - Region: "eu-south-2", - }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -23981,7 +27410,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-ca-central-1", }: endpoint{ - Hostname: "ssm-fips.ca-central-1.amazonaws.com", + Hostname: "ssm-incidents-fips.ca-central-1.amazonaws.com", CredentialScope: credentialScope{ Region: "ca-central-1", }, @@ -23990,7 +27419,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-east-1", }: endpoint{ - Hostname: "ssm-fips.us-east-1.amazonaws.com", + Hostname: "ssm-incidents-fips.us-east-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-east-1", }, @@ -23999,7 +27428,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-east-2", }: endpoint{ - Hostname: "ssm-fips.us-east-2.amazonaws.com", + Hostname: "ssm-incidents-fips.us-east-2.amazonaws.com", CredentialScope: credentialScope{ Region: "us-east-2", }, @@ -24008,7 +27437,7 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-west-1", }: endpoint{ - Hostname: "ssm-fips.us-west-1.amazonaws.com", + Hostname: "ssm-incidents-fips.us-west-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-west-1", }, @@ -24017,18 +27446,12 @@ var awsPartition = partition{ endpointKey{ Region: "fips-us-west-2", }: endpoint{ - Hostname: "ssm-fips.us-west-2.amazonaws.com", + Hostname: "ssm-incidents-fips.us-west-2.amazonaws.com", CredentialScope: credentialScope{ Region: "us-west-2", }, Deprecated: boxedTrue, }, - endpointKey{ - Region: "me-central-1", - }: endpoint{}, - endpointKey{ - Region: "me-south-1", - }: endpoint{}, endpointKey{ Region: "sa-east-1", }: endpoint{}, @@ -24039,7 +27462,7 @@ var awsPartition = partition{ Region: "us-east-1", Variant: fipsVariant, }: endpoint{ - Hostname: "ssm-fips.us-east-1.amazonaws.com", + Hostname: "ssm-incidents-fips.us-east-1.amazonaws.com", }, endpointKey{ Region: "us-east-2", @@ -24048,7 +27471,7 @@ var awsPartition = partition{ Region: "us-east-2", Variant: fipsVariant, }: endpoint{ - Hostname: "ssm-fips.us-east-2.amazonaws.com", + Hostname: "ssm-incidents-fips.us-east-2.amazonaws.com", }, endpointKey{ Region: "us-west-1", @@ -24057,7 +27480,7 @@ var awsPartition = partition{ Region: "us-west-1", Variant: fipsVariant, }: endpoint{ - Hostname: "ssm-fips.us-west-1.amazonaws.com", + Hostname: "ssm-incidents-fips.us-west-1.amazonaws.com", }, endpointKey{ Region: "us-west-2", @@ -24066,18 +27489,27 @@ var awsPartition = partition{ Region: "us-west-2", Variant: fipsVariant, }: endpoint{ - Hostname: "ssm-fips.us-west-2.amazonaws.com", + Hostname: "ssm-incidents-fips.us-west-2.amazonaws.com", }, }, }, - "ssm-incidents": service{ + "ssm-sap": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, endpointKey{ Region: "ap-northeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, endpointKey{ Region: "ap-south-1", }: endpoint{}, @@ -24087,15 +27519,27 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "ssm-sap-fips.ca-central-1.amazonaws.com", + }, endpointKey{ Region: "eu-central-1", }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -24105,25 +27549,100 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "fips-ca-central-1", + }: endpoint{ + Hostname: "ssm-sap-fips.ca-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ca-central-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-1", + }: endpoint{ + Hostname: "ssm-sap-fips.us-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-east-2", + }: endpoint{ + Hostname: "ssm-sap-fips.us-east-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-east-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-1", + }: endpoint{ + Hostname: "ssm-sap-fips.us-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-west-2", + }: endpoint{ + Hostname: "ssm-sap-fips.us-west-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-west-2", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, endpointKey{ Region: "sa-east-1", }: endpoint{}, endpointKey{ Region: "us-east-1", }: endpoint{}, + endpointKey{ + Region: "us-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "ssm-sap-fips.us-east-1.amazonaws.com", + }, endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-east-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "ssm-sap-fips.us-east-2.amazonaws.com", + }, endpointKey{ Region: "us-west-1", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "ssm-sap-fips.us-west-1.amazonaws.com", + }, endpointKey{ Region: "us-west-2", }: endpoint{}, + endpointKey{ + Region: "us-west-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "ssm-sap-fips.us-west-2.amazonaws.com", + }, }, }, "sso": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, endpointKey{ Region: "ap-east-1", }: endpoint{}, @@ -24145,6 +27664,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -24178,6 +27700,9 @@ var awsPartition = partition{ endpointKey{ Region: "us-east-2", }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, endpointKey{ Region: "us-west-2", }: endpoint{}, @@ -24215,6 +27740,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -24278,6 +27806,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -24345,6 +27876,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -24354,6 +27888,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -24375,12 +27912,18 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -24390,15 +27933,6 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, - endpointKey{ - Region: "fips", - }: endpoint{ - Hostname: "storagegateway-fips.ca-central-1.amazonaws.com", - CredentialScope: credentialScope{ - Region: "ca-central-1", - }, - Deprecated: boxedTrue, - }, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -24522,6 +28056,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -24549,6 +28086,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "local", }: endpoint{ @@ -24614,6 +28154,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "aws-global", }: endpoint{ @@ -24649,6 +28192,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -24790,6 +28336,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -24853,6 +28402,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -24932,6 +28484,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -24995,6 +28550,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -25074,6 +28632,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -25101,6 +28662,9 @@ var awsPartition = partition{ endpointKey{ Region: "eu-west-3", }: endpoint{}, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -25242,6 +28806,25 @@ var awsPartition = partition{ }, }, }, + "tnb": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + }, + }, "transcribe": service{ Defaults: endpointDefaults{ defaultKey{}: endpoint{ @@ -25391,12 +28974,21 @@ var awsPartition = partition{ }, "transcribestreaming": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, endpointKey{ Region: "ap-northeast-1", }: endpoint{}, endpointKey{ Region: "ap-northeast-2", }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, endpointKey{ Region: "ap-southeast-2", }: endpoint{}, @@ -25554,6 +29146,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-south-1", }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, endpointKey{ Region: "ap-southeast-1", }: endpoint{}, @@ -25563,6 +29158,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -25575,12 +29173,18 @@ var awsPartition = partition{ endpointKey{ Region: "eu-central-1", }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, endpointKey{ Region: "eu-north-1", }: endpoint{}, endpointKey{ Region: "eu-south-1", }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, endpointKey{ Region: "eu-west-1", }: endpoint{}, @@ -25635,6 +29239,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, endpointKey{ Region: "me-south-1", }: endpoint{}, @@ -25781,6 +29388,91 @@ var awsPartition = partition{ }, }, }, + "verifiedpermissions": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "af-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-east-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-northeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-south-1", + }: endpoint{}, + endpointKey{ + Region: "ap-south-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-3", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-2", + }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-1", + }: endpoint{}, + endpointKey{ + Region: "eu-south-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "eu-west-3", + }: endpoint{}, + endpointKey{ + Region: "me-central-1", + }: endpoint{}, + endpointKey{ + Region: "me-south-1", + }: endpoint{}, + endpointKey{ + Region: "sa-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, + endpointKey{ + Region: "us-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + }, + }, "voice-chime": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -25795,6 +29487,21 @@ var awsPartition = partition{ endpointKey{ Region: "ca-central-1", }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "voice-chime-fips.ca-central-1.amazonaws.com", + }, + endpointKey{ + Region: "ca-central-1-fips", + }: endpoint{ + Hostname: "voice-chime-fips.ca-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ca-central-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "eu-central-1", }: endpoint{}, @@ -25811,12 +29518,12 @@ var awsPartition = partition{ Region: "us-east-1", Variant: fipsVariant, }: endpoint{ - Hostname: "fips.voice-chime.us-east-1.amazonaws.com", + Hostname: "voice-chime-fips.us-east-1.amazonaws.com", }, endpointKey{ Region: "us-east-1-fips", }: endpoint{ - Hostname: "fips.voice-chime.us-east-1.amazonaws.com", + Hostname: "voice-chime-fips.us-east-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-east-1", }, @@ -25829,12 +29536,12 @@ var awsPartition = partition{ Region: "us-west-2", Variant: fipsVariant, }: endpoint{ - Hostname: "fips.voice-chime.us-west-2.amazonaws.com", + Hostname: "voice-chime-fips.us-west-2.amazonaws.com", }, endpointKey{ Region: "us-west-2-fips", }: endpoint{ - Hostname: "fips.voice-chime.us-west-2.amazonaws.com", + Hostname: "voice-chime-fips.us-west-2.amazonaws.com", CredentialScope: credentialScope{ Region: "us-west-2", }, @@ -25915,6 +29622,43 @@ var awsPartition = partition{ }, }, }, + "vpc-lattice": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "ap-northeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-1", + }: endpoint{}, + endpointKey{ + Region: "ap-southeast-2", + }: endpoint{}, + endpointKey{ + Region: "ca-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-central-1", + }: endpoint{}, + endpointKey{ + Region: "eu-north-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-1", + }: endpoint{}, + endpointKey{ + Region: "eu-west-2", + }: endpoint{}, + endpointKey{ + Region: "us-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-east-2", + }: endpoint{}, + endpointKey{ + Region: "us-west-2", + }: endpoint{}, + }, + }, "waf": service{ PartitionEndpoint: "aws-global", IsRegionalized: boxedFalse, @@ -26078,6 +29822,23 @@ var awsPartition = partition{ Region: "ap-south-1", }, }, + endpointKey{ + Region: "ap-south-2", + }: endpoint{ + Hostname: "waf-regional.ap-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-south-2", + }, + }, + endpointKey{ + Region: "ap-south-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "waf-regional-fips.ap-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-south-2", + }, + }, endpointKey{ Region: "ap-southeast-1", }: endpoint{ @@ -26129,6 +29890,23 @@ var awsPartition = partition{ Region: "ap-southeast-3", }, }, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{ + Hostname: "waf-regional.ap-southeast-4.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-4", + }, + }, + endpointKey{ + Region: "ap-southeast-4", + Variant: fipsVariant, + }: endpoint{ + Hostname: "waf-regional-fips.ap-southeast-4.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-4", + }, + }, endpointKey{ Region: "ca-central-1", }: endpoint{ @@ -26163,6 +29941,23 @@ var awsPartition = partition{ Region: "eu-central-1", }, }, + endpointKey{ + Region: "eu-central-2", + }: endpoint{ + Hostname: "waf-regional.eu-central-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-central-2", + }, + }, + endpointKey{ + Region: "eu-central-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "waf-regional-fips.eu-central-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-central-2", + }, + }, endpointKey{ Region: "eu-north-1", }: endpoint{ @@ -26197,6 +29992,23 @@ var awsPartition = partition{ Region: "eu-south-1", }, }, + endpointKey{ + Region: "eu-south-2", + }: endpoint{ + Hostname: "waf-regional.eu-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-south-2", + }, + }, + endpointKey{ + Region: "eu-south-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "waf-regional-fips.eu-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-south-2", + }, + }, endpointKey{ Region: "eu-west-1", }: endpoint{ @@ -26302,6 +30114,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-ap-south-2", + }: endpoint{ + Hostname: "waf-regional-fips.ap-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-south-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-ap-southeast-1", }: endpoint{ @@ -26329,6 +30150,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-ap-southeast-4", + }: endpoint{ + Hostname: "waf-regional-fips.ap-southeast-4.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-4", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-ca-central-1", }: endpoint{ @@ -26347,6 +30177,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-eu-central-2", + }: endpoint{ + Hostname: "waf-regional-fips.eu-central-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-central-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-eu-north-1", }: endpoint{ @@ -26365,6 +30204,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-eu-south-2", + }: endpoint{ + Hostname: "waf-regional-fips.eu-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-south-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-eu-west-1", }: endpoint{ @@ -26392,6 +30240,24 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-il-central-1", + }: endpoint{ + Hostname: "waf-regional-fips.il-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "il-central-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-me-central-1", + }: endpoint{ + Hostname: "waf-regional-fips.me-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "me-central-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-me-south-1", }: endpoint{ @@ -26446,6 +30312,40 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{ + Hostname: "waf-regional.il-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "il-central-1", + }, + }, + endpointKey{ + Region: "il-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "waf-regional-fips.il-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "il-central-1", + }, + }, + endpointKey{ + Region: "me-central-1", + }: endpoint{ + Hostname: "waf-regional.me-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "me-central-1", + }, + }, + endpointKey{ + Region: "me-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "waf-regional-fips.me-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "me-central-1", + }, + }, endpointKey{ Region: "me-south-1", }: endpoint{ @@ -26654,6 +30554,23 @@ var awsPartition = partition{ Region: "ap-south-1", }, }, + endpointKey{ + Region: "ap-south-2", + }: endpoint{ + Hostname: "wafv2.ap-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-south-2", + }, + }, + endpointKey{ + Region: "ap-south-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "wafv2-fips.ap-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-south-2", + }, + }, endpointKey{ Region: "ap-southeast-1", }: endpoint{ @@ -26705,6 +30622,23 @@ var awsPartition = partition{ Region: "ap-southeast-3", }, }, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{ + Hostname: "wafv2.ap-southeast-4.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-4", + }, + }, + endpointKey{ + Region: "ap-southeast-4", + Variant: fipsVariant, + }: endpoint{ + Hostname: "wafv2-fips.ap-southeast-4.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-4", + }, + }, endpointKey{ Region: "ca-central-1", }: endpoint{ @@ -26739,6 +30673,23 @@ var awsPartition = partition{ Region: "eu-central-1", }, }, + endpointKey{ + Region: "eu-central-2", + }: endpoint{ + Hostname: "wafv2.eu-central-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-central-2", + }, + }, + endpointKey{ + Region: "eu-central-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "wafv2-fips.eu-central-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-central-2", + }, + }, endpointKey{ Region: "eu-north-1", }: endpoint{ @@ -26773,6 +30724,23 @@ var awsPartition = partition{ Region: "eu-south-1", }, }, + endpointKey{ + Region: "eu-south-2", + }: endpoint{ + Hostname: "wafv2.eu-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-south-2", + }, + }, + endpointKey{ + Region: "eu-south-2", + Variant: fipsVariant, + }: endpoint{ + Hostname: "wafv2-fips.eu-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-south-2", + }, + }, endpointKey{ Region: "eu-west-1", }: endpoint{ @@ -26878,6 +30846,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-ap-south-2", + }: endpoint{ + Hostname: "wafv2-fips.ap-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-south-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-ap-southeast-1", }: endpoint{ @@ -26905,6 +30882,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-ap-southeast-4", + }: endpoint{ + Hostname: "wafv2-fips.ap-southeast-4.amazonaws.com", + CredentialScope: credentialScope{ + Region: "ap-southeast-4", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-ca-central-1", }: endpoint{ @@ -26923,6 +30909,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-eu-central-2", + }: endpoint{ + Hostname: "wafv2-fips.eu-central-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-central-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-eu-north-1", }: endpoint{ @@ -26941,6 +30936,15 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-eu-south-2", + }: endpoint{ + Hostname: "wafv2-fips.eu-south-2.amazonaws.com", + CredentialScope: credentialScope{ + Region: "eu-south-2", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-eu-west-1", }: endpoint{ @@ -26968,6 +30972,24 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "fips-il-central-1", + }: endpoint{ + Hostname: "wafv2-fips.il-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "il-central-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-me-central-1", + }: endpoint{ + Hostname: "wafv2-fips.me-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "me-central-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-me-south-1", }: endpoint{ @@ -27022,6 +31044,40 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{ + Hostname: "wafv2.il-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "il-central-1", + }, + }, + endpointKey{ + Region: "il-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "wafv2-fips.il-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "il-central-1", + }, + }, + endpointKey{ + Region: "me-central-1", + }: endpoint{ + Hostname: "wafv2.me-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "me-central-1", + }, + }, + endpointKey{ + Region: "me-central-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "wafv2-fips.me-central-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "me-central-1", + }, + }, endpointKey{ Region: "me-south-1", }: endpoint{ @@ -27453,6 +31509,9 @@ var awsPartition = partition{ endpointKey{ Region: "ap-southeast-3", }: endpoint{}, + endpointKey{ + Region: "ap-southeast-4", + }: endpoint{}, endpointKey{ Region: "ca-central-1", }: endpoint{}, @@ -27516,6 +31575,9 @@ var awsPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "il-central-1", + }: endpoint{}, endpointKey{ Region: "me-central-1", }: endpoint{}, @@ -27655,6 +31717,16 @@ var awscnPartition = partition{ }: endpoint{}, }, }, + "airflow": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{}, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{}, + }, + }, "api.ecr": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -27782,6 +31854,16 @@ var awscnPartition = partition{ }: endpoint{}, }, }, + "arc-zonal-shift": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{}, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{}, + }, + }, "athena": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -27844,6 +31926,16 @@ var awscnPartition = partition{ }: endpoint{}, }, }, + "backupstorage": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{}, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{}, + }, + }, "batch": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -28033,7 +32125,10 @@ var awscnPartition = partition{ Endpoints: serviceEndpoints{ endpointKey{ Region: "cn-north-1", - }: endpoint{}, + }: endpoint{ + Hostname: "data.ats.iot.cn-north-1.amazonaws.com.cn", + Protocols: []string{"https"}, + }, endpointKey{ Region: "cn-northwest-1", }: endpoint{}, @@ -28059,6 +32154,16 @@ var awscnPartition = partition{ }: endpoint{}, }, }, + "datasync": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{}, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{}, + }, + }, "dax": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -28286,6 +32391,16 @@ var awscnPartition = partition{ }: endpoint{}, }, }, + "emr-serverless": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{}, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{}, + }, + }, "es": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -28451,14 +32566,32 @@ var awscnPartition = partition{ }, }, }, - "iot": service{ + "internetmonitor": service{ Defaults: endpointDefaults{ defaultKey{}: endpoint{ - CredentialScope: credentialScope{ - Service: "execute-api", - }, + DNSSuffix: "api.amazonwebservices.com.cn", + }, + defaultKey{ + Variant: fipsVariant, + }: endpoint{ + Hostname: "{service}-fips.{region}.{dnsSuffix}", + DNSSuffix: "api.amazonwebservices.com.cn", + }, + }, + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{ + Hostname: "internetmonitor.cn-north-1.api.amazonwebservices.com.cn", + }, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{ + Hostname: "internetmonitor.cn-northwest-1.api.amazonwebservices.com.cn", }, }, + }, + "iot": service{ Endpoints: serviceEndpoints{ endpointKey{ Region: "cn-north-1", @@ -28521,6 +32654,31 @@ var awscnPartition = partition{ }: endpoint{}, }, }, + "kendra-ranking": service{ + Defaults: endpointDefaults{ + defaultKey{}: endpoint{ + DNSSuffix: "api.amazonwebservices.com.cn", + }, + defaultKey{ + Variant: fipsVariant, + }: endpoint{ + Hostname: "{service}-fips.{region}.{dnsSuffix}", + DNSSuffix: "api.amazonwebservices.com.cn", + }, + }, + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{ + Hostname: "kendra-ranking.cn-north-1.api.amazonwebservices.com.cn", + }, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{ + Hostname: "kendra-ranking.cn-northwest-1.api.amazonwebservices.com.cn", + }, + }, + }, "kinesis": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -28541,6 +32699,13 @@ var awscnPartition = partition{ }: endpoint{}, }, }, + "kinesisvideo": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{}, + }, + }, "kms": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -28593,6 +32758,16 @@ var awscnPartition = partition{ }: endpoint{}, }, }, + "license-manager-linux-subscriptions": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{}, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{}, + }, + }, "logs": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -28680,6 +32855,16 @@ var awscnPartition = partition{ }, }, }, + "oam": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{}, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{}, + }, + }, "organizations": service{ PartitionEndpoint: "aws-cn-global", IsRegionalized: boxedFalse, @@ -28793,6 +32978,16 @@ var awscnPartition = partition{ }: endpoint{}, }, }, + "rolesanywhere": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{}, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{}, + }, + }, "route53": service{ PartitionEndpoint: "aws-cn-global", IsRegionalized: boxedFalse, @@ -28924,6 +33119,37 @@ var awscnPartition = partition{ }, }, }, + "savingsplans": service{ + IsRegionalized: boxedTrue, + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{ + Hostname: "savingsplans.cn-north-1.amazonaws.com.cn", + CredentialScope: credentialScope{ + Region: "cn-north-1", + }, + }, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{ + Hostname: "savingsplans.cn-northwest-1.amazonaws.com.cn", + CredentialScope: credentialScope{ + Region: "cn-northwest-1", + }, + }, + }, + }, + "schemas": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{}, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{}, + }, + }, "secretsmanager": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -28978,12 +33204,29 @@ var awscnPartition = partition{ endpointKey{ Region: "cn-north-1", }: endpoint{}, + endpointKey{ + Region: "cn-north-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.cn-north-1.api.amazonwebservices.com.cn", + }, endpointKey{ Region: "cn-northwest-1", }: endpoint{}, + endpointKey{ + Region: "cn-northwest-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.cn-northwest-1.api.amazonwebservices.com.cn", + }, }, }, - "sms": service{ + "servicequotas": service{ + Defaults: endpointDefaults{ + defaultKey{}: endpoint{ + Protocols: []string{"https"}, + }, + }, Endpoints: serviceEndpoints{ endpointKey{ Region: "cn-north-1", @@ -28993,6 +33236,23 @@ var awscnPartition = partition{ }: endpoint{}, }, }, + "signer": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{}, + endpointKey{ + Region: "cn-northwest-1", + }: endpoint{}, + }, + }, + "sms": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "cn-north-1", + }: endpoint{}, + }, + }, "snowball": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -29407,6 +33667,24 @@ var awsusgovPartition = partition{ Region: "us-gov-east-1", }, }, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "access-analyzer.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + }, + endpointKey{ + Region: "us-gov-east-1-fips", + }: endpoint{ + Hostname: "access-analyzer.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{ @@ -29415,6 +33693,24 @@ var awsusgovPartition = partition{ Region: "us-gov-west-1", }, }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "access-analyzer.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "access-analyzer.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, }, }, "acm": service{ @@ -29669,6 +33965,9 @@ var awsusgovPartition = partition{ }, }, Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, @@ -29838,13 +34137,45 @@ var awsusgovPartition = partition{ endpointKey{ Region: "us-gov-east-1", }: endpoint{ + Hostname: "application-autoscaling.us-gov-east-1.amazonaws.com", Protocols: []string{"http", "https"}, }, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "application-autoscaling.us-gov-east-1.amazonaws.com", + Protocols: []string{"http", "https"}, + }, + endpointKey{ + Region: "us-gov-east-1-fips", + }: endpoint{ + Hostname: "application-autoscaling.us-gov-east-1.amazonaws.com", + Protocols: []string{"http", "https"}, + + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{ + Hostname: "application-autoscaling.us-gov-west-1.amazonaws.com", Protocols: []string{"http", "https"}, }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "application-autoscaling.us-gov-west-1.amazonaws.com", + Protocols: []string{"http", "https"}, + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "application-autoscaling.us-gov-west-1.amazonaws.com", + Protocols: []string{"http", "https"}, + + Deprecated: boxedTrue, + }, }, }, "applicationinsights": service{ @@ -29886,6 +34217,24 @@ var awsusgovPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "appstream2-fips.us-gov-east-1.amazonaws.com", + }, + endpointKey{ + Region: "us-gov-east-1-fips", + }: endpoint{ + Hostname: "appstream2-fips.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, @@ -29941,6 +34290,12 @@ var awsusgovPartition = partition{ }: endpoint{ Hostname: "athena-fips.us-gov-east-1.amazonaws.com", }, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "athena-fips.us-gov-east-1.api.aws", + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, @@ -29956,6 +34311,12 @@ var awsusgovPartition = partition{ }: endpoint{ Hostname: "athena-fips.us-gov-west-1.amazonaws.com", }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "athena-fips.us-gov-west-1.api.aws", + }, }, }, "autoscaling": service{ @@ -30019,6 +34380,16 @@ var awsusgovPartition = partition{ }: endpoint{}, }, }, + "backupstorage": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{}, + }, + }, "batch": service{ Defaults: endpointDefaults{ defaultKey{}: endpoint{}, @@ -30077,6 +34448,24 @@ var awsusgovPartition = partition{ Region: "us-gov-east-1", }, }, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "cassandra.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + }, + endpointKey{ + Region: "us-gov-east-1-fips", + }: endpoint{ + Hostname: "cassandra.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{ @@ -30085,6 +34474,24 @@ var awsusgovPartition = partition{ Region: "us-gov-west-1", }, }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "cassandra.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "cassandra.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, }, }, "cloudcontrolapi": service{ @@ -30132,6 +34539,21 @@ var awsusgovPartition = partition{ endpointKey{ Region: "us-gov-west-1", }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "clouddirectory.us-gov-west-1.amazonaws.com", + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "clouddirectory.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, }, }, "cloudformation": service{ @@ -30144,6 +34566,24 @@ var awsusgovPartition = partition{ Region: "us-gov-east-1", }, }, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "cloudformation.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + }, + endpointKey{ + Region: "us-gov-east-1-fips", + }: endpoint{ + Hostname: "cloudformation.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{ @@ -30152,6 +34592,24 @@ var awsusgovPartition = partition{ Region: "us-gov-west-1", }, }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "cloudformation.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "cloudformation.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, }, }, "cloudhsm": service{ @@ -30357,6 +34815,15 @@ var awsusgovPartition = partition{ }, "codepipeline": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "fips-us-gov-east-1", + }: endpoint{ + Hostname: "codepipeline-fips.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-us-gov-west-1", }: endpoint{ @@ -30366,6 +34833,15 @@ var awsusgovPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "codepipeline-fips.us-gov-east-1.amazonaws.com", + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, @@ -30470,6 +34946,26 @@ var awsusgovPartition = partition{ }, }, }, + "compute-optimizer": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{ + Hostname: "compute-optimizer-fips.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + }, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{ + Hostname: "compute-optimizer-fips.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + }, + }, "config": service{ Defaults: endpointDefaults{ defaultKey{}: endpoint{}, @@ -30520,9 +35016,24 @@ var awsusgovPartition = partition{ }, "connect": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "fips-us-gov-west-1", + }: endpoint{ + Hostname: "connect.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "connect.us-gov-west-1.amazonaws.com", + }, }, }, "controltower": service{ @@ -30625,9 +35136,24 @@ var awsusgovPartition = partition{ }, "databrew": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "fips-us-gov-west-1", + }: endpoint{ + Hostname: "databrew.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "databrew.us-gov-west-1.amazonaws.com", + }, }, }, "datasync": service{ @@ -30695,9 +35221,39 @@ var awsusgovPartition = partition{ endpointKey{ Region: "us-gov-east-1", }: endpoint{}, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "dlm.us-gov-east-1.amazonaws.com", + }, + endpointKey{ + Region: "us-gov-east-1-fips", + }: endpoint{ + Hostname: "dlm.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "dlm.us-gov-west-1.amazonaws.com", + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "dlm.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, }, }, "dms": service{ @@ -31074,6 +35630,24 @@ var awsusgovPartition = partition{ Region: "us-gov-east-1", }, }, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "elasticbeanstalk.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + }, + endpointKey{ + Region: "us-gov-east-1-fips", + }: endpoint{ + Hostname: "elasticbeanstalk.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{ @@ -31082,6 +35656,24 @@ var awsusgovPartition = partition{ Region: "us-gov-west-1", }, }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "elasticbeanstalk.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "elasticbeanstalk.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, }, }, "elasticfilesystem": service{ @@ -31248,6 +35840,16 @@ var awsusgovPartition = partition{ }, }, }, + "emr-containers": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{}, + }, + }, "es": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -31519,21 +36121,43 @@ var awsusgovPartition = partition{ "glacier": service{ Endpoints: serviceEndpoints{ endpointKey{ - Region: "us-gov-east-1", + Region: "fips-us-gov-east-1", }: endpoint{ Hostname: "glacier.us-gov-east-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-gov-east-1", }, + Deprecated: boxedTrue, }, endpointKey{ - Region: "us-gov-west-1", + Region: "fips-us-gov-west-1", }: endpoint{ - Hostname: "glacier.us-gov-west-1.amazonaws.com", - Protocols: []string{"http", "https"}, + Hostname: "glacier.us-gov-west-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-gov-west-1", }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "glacier.us-gov-east-1.amazonaws.com", + }, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{ + Protocols: []string{"http", "https"}, + }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "glacier.us-gov-west-1.amazonaws.com", + Protocols: []string{"http", "https"}, }, }, }, @@ -31604,36 +36228,38 @@ var awsusgovPartition = partition{ endpointKey{ Region: "fips-us-gov-east-1", }: endpoint{ - Hostname: "greengrass-fips.us-gov-east-1.amazonaws.com", + Hostname: "greengrass.us-gov-east-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-gov-east-1", }, Deprecated: boxedTrue, }, endpointKey{ - Region: "us-gov-east-1", + Region: "fips-us-gov-west-1", }: endpoint{ - Hostname: "greengrass.us-gov-east-1.amazonaws.com", + Hostname: "greengrass.us-gov-west-1.amazonaws.com", CredentialScope: credentialScope{ - Region: "us-gov-east-1", + Region: "us-gov-west-1", }, + Deprecated: boxedTrue, }, + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, endpointKey{ Region: "us-gov-east-1", Variant: fipsVariant, }: endpoint{ - Hostname: "greengrass-fips.us-gov-east-1.amazonaws.com", - CredentialScope: credentialScope{ - Region: "us-gov-east-1", - }, + Hostname: "greengrass.us-gov-east-1.amazonaws.com", }, endpointKey{ Region: "us-gov-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, }: endpoint{ Hostname: "greengrass.us-gov-west-1.amazonaws.com", - CredentialScope: credentialScope{ - Region: "us-gov-west-1", - }, }, }, }, @@ -31832,6 +36458,21 @@ var awsusgovPartition = partition{ endpointKey{ Region: "us-gov-west-1", }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "ingest.timestream.us-gov-west-1.amazonaws.com", + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "ingest.timestream.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, }, }, "inspector": service{ @@ -31874,31 +36515,85 @@ var awsusgovPartition = partition{ }, }, }, - "iot": service{ - Defaults: endpointDefaults{ - defaultKey{}: endpoint{ + "inspector2": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "fips-us-gov-east-1", + }: endpoint{ + Hostname: "inspector2-fips.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-gov-west-1", + }: endpoint{ + Hostname: "inspector2-fips.us-gov-west-1.amazonaws.com", CredentialScope: credentialScope{ - Service: "execute-api", + Region: "us-gov-west-1", }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "inspector2-fips.us-gov-east-1.amazonaws.com", + }, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "inspector2-fips.us-gov-west-1.amazonaws.com", + }, + }, + }, + "internetmonitor": service{ + Defaults: endpointDefaults{ + defaultKey{}: endpoint{ + DNSSuffix: "api.aws", + }, + defaultKey{ + Variant: fipsVariant, + }: endpoint{ + Hostname: "{service}-fips.{region}.{dnsSuffix}", + DNSSuffix: "api.aws", + }, + }, + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{ + Hostname: "internetmonitor.us-gov-east-1.api.aws", + }, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{ + Hostname: "internetmonitor.us-gov-west-1.api.aws", }, }, + }, + "iot": service{ Endpoints: serviceEndpoints{ endpointKey{ Region: "fips-us-gov-east-1", }: endpoint{ Hostname: "iot-fips.us-gov-east-1.amazonaws.com", - CredentialScope: credentialScope{ - Service: "execute-api", - }, + Deprecated: boxedTrue, }, endpointKey{ Region: "fips-us-gov-west-1", }: endpoint{ Hostname: "iot-fips.us-gov-west-1.amazonaws.com", - CredentialScope: credentialScope{ - Service: "execute-api", - }, + Deprecated: boxedTrue, }, endpointKey{ @@ -32043,14 +36738,114 @@ var awsusgovPartition = partition{ }, }, }, + "iottwinmaker": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "api-us-gov-west-1", + }: endpoint{ + Hostname: "api.iottwinmaker.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "data-us-gov-west-1", + }: endpoint{ + Hostname: "data.iottwinmaker.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "fips-api-us-gov-west-1", + }: endpoint{ + Hostname: "api.iottwinmaker-fips.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "fips-data-us-gov-west-1", + }: endpoint{ + Hostname: "data.iottwinmaker-fips.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "fips-us-gov-west-1", + }: endpoint{ + Hostname: "iottwinmaker-fips.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "iottwinmaker-fips.us-gov-west-1.amazonaws.com", + }, + }, + }, "kafka": service{ Endpoints: serviceEndpoints{ endpointKey{ Region: "us-gov-east-1", - }: endpoint{}, + }: endpoint{ + Hostname: "kafka.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + }, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kafka.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + }, + endpointKey{ + Region: "us-gov-east-1-fips", + }: endpoint{ + Hostname: "kafka.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", - }: endpoint{}, + }: endpoint{ + Hostname: "kafka.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kafka.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "kafka.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, }, }, "kendra": service{ @@ -32075,8 +36870,51 @@ var awsusgovPartition = partition{ }, }, }, + "kendra-ranking": service{ + Defaults: endpointDefaults{ + defaultKey{}: endpoint{ + DNSSuffix: "api.aws", + }, + defaultKey{ + Variant: fipsVariant, + }: endpoint{ + Hostname: "{service}-fips.{region}.{dnsSuffix}", + DNSSuffix: "api.aws", + }, + }, + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{ + Hostname: "kendra-ranking.us-gov-east-1.api.aws", + }, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{ + Hostname: "kendra-ranking.us-gov-west-1.api.aws", + }, + }, + }, "kinesis": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "fips-us-gov-east-1", + }: endpoint{ + Hostname: "kinesis.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-gov-west-1", + }: endpoint{ + Hostname: "kinesis.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-east-1", }: endpoint{ @@ -32085,6 +36923,15 @@ var awsusgovPartition = partition{ Region: "us-gov-east-1", }, }, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kinesis.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{ @@ -32093,6 +36940,15 @@ var awsusgovPartition = partition{ Region: "us-gov-west-1", }, }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "kinesis.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, }, }, "kinesisanalytics": service{ @@ -32286,6 +37142,16 @@ var awsusgovPartition = partition{ }, }, }, + "license-manager-linux-subscriptions": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{}, + }, + }, "logs": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -32336,12 +37202,22 @@ var awsusgovPartition = partition{ "mediaconvert": service{ Endpoints: serviceEndpoints{ endpointKey{ - Region: "us-gov-west-1", + Region: "fips-us-gov-west-1", }: endpoint{ Hostname: "mediaconvert.us-gov-west-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-gov-west-1", }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "mediaconvert.us-gov-west-1.amazonaws.com", }, }, }, @@ -32404,11 +37280,54 @@ var awsusgovPartition = partition{ }, "metrics.sagemaker": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, }, }, + "mgn": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "fips-us-gov-east-1", + }: endpoint{ + Hostname: "mgn-fips.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-gov-west-1", + }: endpoint{ + Hostname: "mgn-fips.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "mgn-fips.us-gov-east-1.amazonaws.com", + }, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "mgn-fips.us-gov-west-1.amazonaws.com", + }, + }, + }, "models.lex": service{ Defaults: endpointDefaults{ defaultKey{}: endpoint{ @@ -32606,6 +37525,24 @@ var awsusgovPartition = partition{ Region: "us-gov-west-1", }, }, + endpointKey{ + Region: "aws-us-gov-global", + Variant: fipsVariant, + }: endpoint{ + Hostname: "networkmanager.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "fips-aws-us-gov-global", + }: endpoint{ + Hostname: "networkmanager.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, }, }, "oidc": service{ @@ -32663,35 +37600,75 @@ var awsusgovPartition = partition{ "outposts": service{ Endpoints: serviceEndpoints{ endpointKey{ - Region: "us-gov-east-1", + Region: "fips-us-gov-east-1", }: endpoint{ Hostname: "outposts.us-gov-east-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-gov-east-1", }, + Deprecated: boxedTrue, }, endpointKey{ - Region: "us-gov-west-1", + Region: "fips-us-gov-west-1", }: endpoint{ Hostname: "outposts.us-gov-west-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-gov-west-1", }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "outposts.us-gov-east-1.amazonaws.com", + }, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "outposts.us-gov-west-1.amazonaws.com", }, }, }, "participant.connect": service{ Endpoints: serviceEndpoints{ endpointKey{ - Region: "us-gov-west-1", + Region: "fips-us-gov-west-1", }: endpoint{ Hostname: "participant.connect.us-gov-west-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-gov-west-1", }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "participant.connect.us-gov-west-1.amazonaws.com", }, }, }, + "pi": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{}, + }, + }, "pinpoint": service{ Defaults: endpointDefaults{ defaultKey{}: endpoint{ @@ -32791,6 +37768,24 @@ var awsusgovPartition = partition{ Region: "us-gov-east-1", }, }, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "ram.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + }, + endpointKey{ + Region: "us-gov-east-1-fips", + }: endpoint{ + Hostname: "ram.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{ @@ -32799,6 +37794,24 @@ var awsusgovPartition = partition{ Region: "us-gov-west-1", }, }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "ram.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "ram.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, }, }, "rbin": service{ @@ -33093,9 +38106,35 @@ var awsusgovPartition = partition{ endpointKey{ Region: "us-gov-east-1", }: endpoint{}, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "route53resolver.us-gov-east-1.amazonaws.com", + }, + endpointKey{ + Region: "us-gov-east-1-fips", + }: endpoint{ + Hostname: "route53resolver.us-gov-east-1.amazonaws.com", + + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "route53resolver.us-gov-west-1.amazonaws.com", + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "route53resolver.us-gov-west-1.amazonaws.com", + + Deprecated: boxedTrue, + }, }, }, "runtime.lex": service{ @@ -33145,6 +38184,9 @@ var awsusgovPartition = partition{ }, }, Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, @@ -33489,21 +38531,45 @@ var awsusgovPartition = partition{ Endpoints: serviceEndpoints{ endpointKey{ Region: "us-gov-east-1", + }: endpoint{ + Protocols: []string{"https"}, + }, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, }: endpoint{ Hostname: "serverlessrepo.us-gov-east-1.amazonaws.com", Protocols: []string{"https"}, + }, + endpointKey{ + Region: "us-gov-east-1-fips", + }: endpoint{ + Hostname: "serverlessrepo.us-gov-east-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-gov-east-1", }, + Deprecated: boxedTrue, }, endpointKey{ Region: "us-gov-west-1", + }: endpoint{ + Protocols: []string{"https"}, + }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, }: endpoint{ Hostname: "serverlessrepo.us-gov-west-1.amazonaws.com", Protocols: []string{"https"}, + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "serverlessrepo.us-gov-west-1.amazonaws.com", CredentialScope: credentialScope{ Region: "us-gov-west-1", }, + Deprecated: boxedTrue, }, }, }, @@ -33597,12 +38663,24 @@ var awsusgovPartition = partition{ endpointKey{ Region: "us-gov-east-1", }: endpoint{}, + endpointKey{ + Region: "us-gov-east-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.us-gov-east-1.api.aws", + }, endpointKey{ Region: "us-gov-east-1", Variant: fipsVariant, }: endpoint{ Hostname: "servicediscovery-fips.us-gov-east-1.amazonaws.com", }, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery-fips.us-gov-east-1.api.aws", + }, endpointKey{ Region: "us-gov-east-1-fips", }: endpoint{ @@ -33615,12 +38693,24 @@ var awsusgovPartition = partition{ endpointKey{ Region: "us-gov-west-1", }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery.us-gov-west-1.api.aws", + }, endpointKey{ Region: "us-gov-west-1", Variant: fipsVariant, }: endpoint{ Hostname: "servicediscovery-fips.us-gov-west-1.amazonaws.com", }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant | dualStackVariant, + }: endpoint{ + Hostname: "servicediscovery-fips.us-gov-west-1.api.aws", + }, endpointKey{ Region: "us-gov-west-1-fips", }: endpoint{ @@ -33683,17 +38773,18 @@ var awsusgovPartition = partition{ }, }, }, - "sms": service{ + "simspaceweaver": service{ Endpoints: serviceEndpoints{ endpointKey{ - Region: "fips-us-gov-east-1", - }: endpoint{ - Hostname: "sms-fips.us-gov-east-1.amazonaws.com", - CredentialScope: credentialScope{ - Region: "us-gov-east-1", - }, - Deprecated: boxedTrue, - }, + Region: "us-gov-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + }: endpoint{}, + }, + }, + "sms": service{ + Endpoints: serviceEndpoints{ endpointKey{ Region: "fips-us-gov-west-1", }: endpoint{ @@ -33703,15 +38794,6 @@ var awsusgovPartition = partition{ }, Deprecated: boxedTrue, }, - endpointKey{ - Region: "us-gov-east-1", - }: endpoint{}, - endpointKey{ - Region: "us-gov-east-1", - Variant: fipsVariant, - }: endpoint{ - Hostname: "sms-fips.us-gov-east-1.amazonaws.com", - }, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, @@ -33725,9 +38807,24 @@ var awsusgovPartition = partition{ }, "sms-voice": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "fips-us-gov-west-1", + }: endpoint{ + Hostname: "sms-voice-fips.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "sms-voice-fips.us-gov-west-1.amazonaws.com", + }, }, }, "snowball": service{ @@ -33802,14 +38899,14 @@ var awsusgovPartition = partition{ endpointKey{ Region: "us-gov-west-1", }: endpoint{ - Protocols: []string{"http", "https"}, + Protocols: []string{"https"}, }, endpointKey{ Region: "us-gov-west-1", Variant: fipsVariant, }: endpoint{ Hostname: "sns.us-gov-west-1.amazonaws.com", - Protocols: []string{"http", "https"}, + Protocols: []string{"https"}, }, }, }, @@ -34153,6 +39250,24 @@ var awsusgovPartition = partition{ Region: "us-gov-east-1", }, }, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "swf.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + }, + endpointKey{ + Region: "us-gov-east-1-fips", + }: endpoint{ + Hostname: "swf.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{ @@ -34161,6 +39276,24 @@ var awsusgovPartition = partition{ Region: "us-gov-west-1", }, }, + endpointKey{ + Region: "us-gov-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "swf.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + }, + endpointKey{ + Region: "us-gov-west-1-fips", + }: endpoint{ + Hostname: "swf.us-gov-west-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-west-1", + }, + Deprecated: boxedTrue, + }, }, }, "synthetics": service{ @@ -34505,6 +39638,15 @@ var awsusgovPartition = partition{ }, "workspaces": service{ Endpoints: serviceEndpoints{ + endpointKey{ + Region: "fips-us-gov-east-1", + }: endpoint{ + Hostname: "workspaces-fips.us-gov-east-1.amazonaws.com", + CredentialScope: credentialScope{ + Region: "us-gov-east-1", + }, + Deprecated: boxedTrue, + }, endpointKey{ Region: "fips-us-gov-west-1", }: endpoint{ @@ -34514,6 +39656,15 @@ var awsusgovPartition = partition{ }, Deprecated: boxedTrue, }, + endpointKey{ + Region: "us-gov-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-gov-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "workspaces-fips.us-gov-east-1.amazonaws.com", + }, endpointKey{ Region: "us-gov-west-1", }: endpoint{}, @@ -34676,6 +39827,13 @@ var awsisoPartition = partition{ }: endpoint{}, }, }, + "athena": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-iso-east-1", + }: endpoint{}, + }, + }, "autoscaling": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -34688,6 +39846,16 @@ var awsisoPartition = partition{ }: endpoint{}, }, }, + "cloudcontrolapi": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-iso-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-iso-west-1", + }: endpoint{}, + }, + }, "cloudformation": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -34757,6 +39925,16 @@ var awsisoPartition = partition{ }: endpoint{}, }, }, + "dlm": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-iso-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-iso-west-1", + }: endpoint{}, + }, + }, "dms": service{ Defaults: endpointDefaults{ defaultKey{}: endpoint{}, @@ -34891,6 +40069,9 @@ var awsisoPartition = partition{ endpointKey{ Region: "us-iso-east-1", }: endpoint{}, + endpointKey{ + Region: "us-iso-west-1", + }: endpoint{}, }, }, "elasticache": service{ @@ -35009,6 +40190,13 @@ var awsisoPartition = partition{ }: endpoint{}, }, }, + "glue": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-iso-east-1", + }: endpoint{}, + }, + }, "health": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -35104,6 +40292,9 @@ var awsisoPartition = partition{ endpointKey{ Region: "us-iso-east-1", }: endpoint{}, + endpointKey{ + Region: "us-iso-west-1", + }: endpoint{}, }, }, "logs": service{ @@ -35164,6 +40355,46 @@ var awsisoPartition = partition{ }: endpoint{}, }, }, + "rbin": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "fips-us-iso-east-1", + }: endpoint{ + Hostname: "rbin-fips.us-iso-east-1.c2s.ic.gov", + CredentialScope: credentialScope{ + Region: "us-iso-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "fips-us-iso-west-1", + }: endpoint{ + Hostname: "rbin-fips.us-iso-west-1.c2s.ic.gov", + CredentialScope: credentialScope{ + Region: "us-iso-west-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "us-iso-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-iso-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "rbin-fips.us-iso-east-1.c2s.ic.gov", + }, + endpointKey{ + Region: "us-iso-west-1", + }: endpoint{}, + endpointKey{ + Region: "us-iso-west-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "rbin-fips.us-iso-west-1.c2s.ic.gov", + }, + }, + }, "rds": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -35184,6 +40415,16 @@ var awsisoPartition = partition{ }: endpoint{}, }, }, + "resource-groups": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-iso-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-iso-west-1", + }: endpoint{}, + }, + }, "route53": service{ PartitionEndpoint: "aws-iso-global", IsRegionalized: boxedFalse, @@ -35203,6 +40444,9 @@ var awsisoPartition = partition{ endpointKey{ Region: "us-iso-east-1", }: endpoint{}, + endpointKey{ + Region: "us-iso-west-1", + }: endpoint{}, }, }, "runtime.sagemaker": service{ @@ -35235,6 +40479,9 @@ var awsisoPartition = partition{ endpointKey{ Region: "us-iso-east-1", }: endpoint{}, + endpointKey{ + Region: "us-iso-west-1", + }: endpoint{}, }, }, "snowball": service{ @@ -35353,6 +40600,9 @@ var awsisoPartition = partition{ endpointKey{ Region: "us-iso-east-1", }: endpoint{}, + endpointKey{ + Region: "us-iso-west-1", + }: endpoint{}, }, }, "transcribe": service{ @@ -35391,6 +40641,9 @@ var awsisoPartition = partition{ endpointKey{ Region: "us-iso-east-1", }: endpoint{}, + endpointKey{ + Region: "us-iso-west-1", + }: endpoint{}, }, }, }, @@ -35517,6 +40770,13 @@ var awsisobPartition = partition{ }: endpoint{}, }, }, + "dlm": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-isob-east-1", + }: endpoint{}, + }, + }, "dms": service{ Defaults: endpointDefaults{ defaultKey{}: endpoint{}, @@ -35805,6 +41065,13 @@ var awsisobPartition = partition{ }: endpoint{}, }, }, + "outposts": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-isob-east-1", + }: endpoint{}, + }, + }, "ram": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -35812,6 +41079,28 @@ var awsisobPartition = partition{ }: endpoint{}, }, }, + "rbin": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "fips-us-isob-east-1", + }: endpoint{ + Hostname: "rbin-fips.us-isob-east-1.sc2s.sgov.gov", + CredentialScope: credentialScope{ + Region: "us-isob-east-1", + }, + Deprecated: boxedTrue, + }, + endpointKey{ + Region: "us-isob-east-1", + }: endpoint{}, + endpointKey{ + Region: "us-isob-east-1", + Variant: fipsVariant, + }: endpoint{ + Hostname: "rbin-fips.us-isob-east-1.sc2s.sgov.gov", + }, + }, + }, "rds": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -35867,6 +41156,13 @@ var awsisobPartition = partition{ }: endpoint{}, }, }, + "secretsmanager": service{ + Endpoints: serviceEndpoints{ + endpointKey{ + Region: "us-isob-east-1", + }: endpoint{}, + }, + }, "snowball": service{ Endpoints: serviceEndpoints{ endpointKey{ @@ -35978,3 +41274,71 @@ var awsisobPartition = partition{ }, }, } + +// AwsIsoEPartition returns the Resolver for AWS ISOE (Europe). +func AwsIsoEPartition() Partition { + return awsisoePartition.Partition() +} + +var awsisoePartition = partition{ + ID: "aws-iso-e", + Name: "AWS ISOE (Europe)", + DNSSuffix: "cloud.adc-e.uk", + RegionRegex: regionRegex{ + Regexp: func() *regexp.Regexp { + reg, _ := regexp.Compile("^eu\\-isoe\\-\\w+\\-\\d+$") + return reg + }(), + }, + Defaults: endpointDefaults{ + defaultKey{}: endpoint{ + Hostname: "{service}.{region}.{dnsSuffix}", + Protocols: []string{"https"}, + SignatureVersions: []string{"v4"}, + }, + defaultKey{ + Variant: fipsVariant, + }: endpoint{ + Hostname: "{service}-fips.{region}.{dnsSuffix}", + DNSSuffix: "cloud.adc-e.uk", + Protocols: []string{"https"}, + SignatureVersions: []string{"v4"}, + }, + }, + Regions: regions{}, + Services: services{}, +} + +// AwsIsoFPartition returns the Resolver for AWS ISOF. +func AwsIsoFPartition() Partition { + return awsisofPartition.Partition() +} + +var awsisofPartition = partition{ + ID: "aws-iso-f", + Name: "AWS ISOF", + DNSSuffix: "csp.hci.ic.gov", + RegionRegex: regionRegex{ + Regexp: func() *regexp.Regexp { + reg, _ := regexp.Compile("^us\\-isof\\-\\w+\\-\\d+$") + return reg + }(), + }, + Defaults: endpointDefaults{ + defaultKey{}: endpoint{ + Hostname: "{service}.{region}.{dnsSuffix}", + Protocols: []string{"https"}, + SignatureVersions: []string{"v4"}, + }, + defaultKey{ + Variant: fipsVariant, + }: endpoint{ + Hostname: "{service}-fips.{region}.{dnsSuffix}", + DNSSuffix: "csp.hci.ic.gov", + Protocols: []string{"https"}, + SignatureVersions: []string{"v4"}, + }, + }, + Regions: regions{}, + Services: services{}, +} diff --git a/vendor/github.com/aws/aws-sdk-go/aws/session/credentials.go b/vendor/github.com/aws/aws-sdk-go/aws/session/credentials.go index 1d3f4c3adc..ea8e353765 100644 --- a/vendor/github.com/aws/aws-sdk-go/aws/session/credentials.go +++ b/vendor/github.com/aws/aws-sdk-go/aws/session/credentials.go @@ -14,6 +14,7 @@ import ( "github.com/aws/aws-sdk-go/aws/defaults" "github.com/aws/aws-sdk-go/aws/request" "github.com/aws/aws-sdk-go/internal/shareddefaults" + "github.com/aws/aws-sdk-go/service/ssooidc" "github.com/aws/aws-sdk-go/service/sts" ) @@ -23,6 +24,10 @@ type CredentialsProviderOptions struct { // WebIdentityRoleProviderOptions configures a WebIdentityRoleProvider, // such as setting its ExpiryWindow. WebIdentityRoleProviderOptions func(*stscreds.WebIdentityRoleProvider) + + // ProcessProviderOptions configures a ProcessProvider, + // such as setting its Timeout. + ProcessProviderOptions func(*processcreds.ProcessProvider) } func resolveCredentials(cfg *aws.Config, @@ -33,7 +38,7 @@ func resolveCredentials(cfg *aws.Config, switch { case len(sessOpts.Profile) != 0: - // User explicitly provided an Profile in the session's configuration + // User explicitly provided a Profile in the session's configuration // so load that profile from shared config first. // Github(aws/aws-sdk-go#2727) return resolveCredsFromProfile(cfg, envCfg, sharedCfg, handlers, sessOpts) @@ -134,7 +139,11 @@ func resolveCredsFromProfile(cfg *aws.Config, case len(sharedCfg.CredentialProcess) != 0: // Get credentials from CredentialProcess - creds = processcreds.NewCredentials(sharedCfg.CredentialProcess) + var optFns []func(*processcreds.ProcessProvider) + if sessOpts.CredentialsProviderOptions != nil && sessOpts.CredentialsProviderOptions.ProcessProviderOptions != nil { + optFns = append(optFns, sessOpts.CredentialsProviderOptions.ProcessProviderOptions) + } + creds = processcreds.NewCredentials(sharedCfg.CredentialProcess, optFns...) default: // Fallback to default credentials provider, include mock errors for @@ -173,8 +182,28 @@ func resolveSSOCredentials(cfg *aws.Config, sharedCfg sharedConfig, handlers req return nil, err } + var optFns []func(provider *ssocreds.Provider) cfgCopy := cfg.Copy() - cfgCopy.Region = &sharedCfg.SSORegion + + if sharedCfg.SSOSession != nil { + cfgCopy.Region = &sharedCfg.SSOSession.SSORegion + cachedPath, err := ssocreds.StandardCachedTokenFilepath(sharedCfg.SSOSession.Name) + if err != nil { + return nil, err + } + // create oidcClient with AnonymousCredentials to avoid recursively resolving credentials + mySession := Must(NewSession(&aws.Config{ + Credentials: credentials.AnonymousCredentials, + })) + oidcClient := ssooidc.New(mySession, cfgCopy) + tokenProvider := ssocreds.NewSSOTokenProvider(oidcClient, cachedPath) + optFns = append(optFns, func(p *ssocreds.Provider) { + p.TokenProvider = tokenProvider + p.CachedTokenFilepath = cachedPath + }) + } else { + cfgCopy.Region = &sharedCfg.SSORegion + } return ssocreds.NewCredentials( &Session{ @@ -184,6 +213,7 @@ func resolveSSOCredentials(cfg *aws.Config, sharedCfg sharedConfig, handlers req sharedCfg.SSOAccountID, sharedCfg.SSORoleName, sharedCfg.SSOStartURL, + optFns..., ), nil } diff --git a/vendor/github.com/aws/aws-sdk-go/aws/session/session.go b/vendor/github.com/aws/aws-sdk-go/aws/session/session.go index 4293dbe10b..8127c99a9a 100644 --- a/vendor/github.com/aws/aws-sdk-go/aws/session/session.go +++ b/vendor/github.com/aws/aws-sdk-go/aws/session/session.go @@ -37,7 +37,7 @@ const ( // ErrSharedConfigSourceCollision will be returned if a section contains both // source_profile and credential_source -var ErrSharedConfigSourceCollision = awserr.New(ErrCodeSharedConfig, "only one credential type may be specified per profile: source profile, credential source, credential process, web identity token, or sso", nil) +var ErrSharedConfigSourceCollision = awserr.New(ErrCodeSharedConfig, "only one credential type may be specified per profile: source profile, credential source, credential process, web identity token", nil) // ErrSharedConfigECSContainerEnvVarEmpty will be returned if the environment // variables are empty and Environment was set as the credential source @@ -174,7 +174,6 @@ const ( // Options provides the means to control how a Session is created and what // configuration values will be loaded. -// type Options struct { // Provides config values for the SDK to use when creating service clients // and making API requests to services. Any value set in with this field @@ -224,7 +223,7 @@ type Options struct { // from stdin for the MFA token code. // // This field is only used if the shared configuration is enabled, and - // the config enables assume role wit MFA via the mfa_serial field. + // the config enables assume role with MFA via the mfa_serial field. AssumeRoleTokenProvider func() (string, error) // When the SDK's shared config is configured to assume a role this option @@ -322,24 +321,24 @@ type Options struct { // credentials file. Enabling the Shared Config will also allow the Session // to be built with retrieving credentials with AssumeRole set in the config. // -// // Equivalent to session.New -// sess := session.Must(session.NewSessionWithOptions(session.Options{})) +// // Equivalent to session.New +// sess := session.Must(session.NewSessionWithOptions(session.Options{})) // -// // Specify profile to load for the session's config -// sess := session.Must(session.NewSessionWithOptions(session.Options{ -// Profile: "profile_name", -// })) +// // Specify profile to load for the session's config +// sess := session.Must(session.NewSessionWithOptions(session.Options{ +// Profile: "profile_name", +// })) // -// // Specify profile for config and region for requests -// sess := session.Must(session.NewSessionWithOptions(session.Options{ -// Config: aws.Config{Region: aws.String("us-east-1")}, -// Profile: "profile_name", -// })) +// // Specify profile for config and region for requests +// sess := session.Must(session.NewSessionWithOptions(session.Options{ +// Config: aws.Config{Region: aws.String("us-east-1")}, +// Profile: "profile_name", +// })) // -// // Force enable Shared Config support -// sess := session.Must(session.NewSessionWithOptions(session.Options{ -// SharedConfigState: session.SharedConfigEnable, -// })) +// // Force enable Shared Config support +// sess := session.Must(session.NewSessionWithOptions(session.Options{ +// SharedConfigState: session.SharedConfigEnable, +// })) func NewSessionWithOptions(opts Options) (*Session, error) { var envCfg envConfig var err error @@ -375,7 +374,7 @@ func NewSessionWithOptions(opts Options) (*Session, error) { // This helper is intended to be used in variable initialization to load the // Session and configuration at startup. Such as: // -// var sess = session.Must(session.NewSession()) +// var sess = session.Must(session.NewSession()) func Must(sess *Session, err error) *Session { if err != nil { panic(err) @@ -780,16 +779,6 @@ func mergeConfigSrcs(cfg, userCfg *aws.Config, cfg.EndpointResolver = wrapEC2IMDSEndpoint(cfg.EndpointResolver, ec2IMDSEndpoint, endpointMode) } - // Configure credentials if not already set by the user when creating the - // Session. - if cfg.Credentials == credentials.AnonymousCredentials && userCfg.Credentials == nil { - creds, err := resolveCredentials(cfg, envCfg, sharedCfg, handlers, sessOpts) - if err != nil { - return err - } - cfg.Credentials = creds - } - cfg.S3UseARNRegion = userCfg.S3UseARNRegion if cfg.S3UseARNRegion == nil { cfg.S3UseARNRegion = &envCfg.S3UseARNRegion @@ -812,6 +801,17 @@ func mergeConfigSrcs(cfg, userCfg *aws.Config, } } + // Configure credentials if not already set by the user when creating the Session. + // Credentials are resolved last such that all _resolved_ config values are propagated to credential providers. + // ticket: P83606045 + if cfg.Credentials == credentials.AnonymousCredentials && userCfg.Credentials == nil { + creds, err := resolveCredentials(cfg, envCfg, sharedCfg, handlers, sessOpts) + if err != nil { + return err + } + cfg.Credentials = creds + } + return nil } @@ -845,8 +845,8 @@ func initHandlers(s *Session) { // and handlers. If any additional configs are provided they will be merged // on top of the Session's copied config. // -// // Create a copy of the current Session, configured for the us-west-2 region. -// sess.Copy(&aws.Config{Region: aws.String("us-west-2")}) +// // Create a copy of the current Session, configured for the us-west-2 region. +// sess.Copy(&aws.Config{Region: aws.String("us-west-2")}) func (s *Session) Copy(cfgs ...*aws.Config) *Session { newSession := &Session{ Config: s.Config.Copy(cfgs...), diff --git a/vendor/github.com/aws/aws-sdk-go/aws/session/shared_config.go b/vendor/github.com/aws/aws-sdk-go/aws/session/shared_config.go index 424c82b4d3..ea3ac0d031 100644 --- a/vendor/github.com/aws/aws-sdk-go/aws/session/shared_config.go +++ b/vendor/github.com/aws/aws-sdk-go/aws/session/shared_config.go @@ -26,6 +26,13 @@ const ( roleSessionNameKey = `role_session_name` // optional roleDurationSecondsKey = "duration_seconds" // optional + // Prefix to be used for SSO sections. These are supposed to only exist in + // the shared config file, not the credentials file. + ssoSectionPrefix = `sso-session ` + + // AWS Single Sign-On (AWS SSO) group + ssoSessionNameKey = "sso_session" + // AWS Single Sign-On (AWS SSO) group ssoAccountIDKey = "sso_account_id" ssoRegionKey = "sso_region" @@ -99,6 +106,10 @@ type sharedConfig struct { CredentialProcess string WebIdentityTokenFile string + // SSO session options + SSOSessionName string + SSOSession *ssoSession + SSOAccountID string SSORegion string SSORoleName string @@ -186,6 +197,20 @@ type sharedConfigFile struct { IniData ini.Sections } +// SSOSession provides the shared configuration parameters of the sso-session +// section. +type ssoSession struct { + Name string + SSORegion string + SSOStartURL string +} + +func (s *ssoSession) setFromIniSection(section ini.Section) { + updateString(&s.Name, section, ssoSessionNameKey) + updateString(&s.SSORegion, section, ssoRegionKey) + updateString(&s.SSOStartURL, section, ssoStartURL) +} + // loadSharedConfig retrieves the configuration from the list of files using // the profile provided. The order the files are listed will determine // precedence. Values in subsequent files will overwrite values defined in @@ -266,13 +291,13 @@ func (cfg *sharedConfig) setFromIniFiles(profiles map[string]struct{}, profile s // profile only have credential provider options. cfg.clearAssumeRoleOptions() } else { - // First time a profile has been seen, It must either be a assume role - // credentials, or SSO. Assert if the credential type requires a role ARN, - // the ARN is also set, or validate that the SSO configuration is complete. + // First time a profile has been seen. Assert if the credential type + // requires a role ARN, the ARN is also set if err := cfg.validateCredentialsConfig(profile); err != nil { return err } } + profiles[profile] = struct{}{} if err := cfg.validateCredentialType(); err != nil { @@ -308,6 +333,30 @@ func (cfg *sharedConfig) setFromIniFiles(profiles map[string]struct{}, profile s cfg.SourceProfile = srcCfg } + // If the profile contains an SSO session parameter, the session MUST exist + // as a section in the config file. Load the SSO session using the name + // provided. If the session section is not found or incomplete an error + // will be returned. + if cfg.hasSSOTokenProviderConfiguration() { + skippedFiles = 0 + for _, f := range files { + section, ok := f.IniData.GetSection(fmt.Sprintf(ssoSectionPrefix + strings.TrimSpace(cfg.SSOSessionName))) + if ok { + var ssoSession ssoSession + ssoSession.setFromIniSection(section) + ssoSession.Name = cfg.SSOSessionName + cfg.SSOSession = &ssoSession + break + } + skippedFiles++ + } + if skippedFiles == len(files) { + // If all files were skipped because the sso session section is not found, return + // the sso section not found error. + return fmt.Errorf("failed to find SSO session section, %v", cfg.SSOSessionName) + } + } + return nil } @@ -363,6 +412,10 @@ func (cfg *sharedConfig) setFromIniFile(profile string, file sharedConfigFile, e cfg.S3UsEast1RegionalEndpoint = sre } + // AWS Single Sign-On (AWS SSO) + // SSO session options + updateString(&cfg.SSOSessionName, section, ssoSessionNameKey) + // AWS Single Sign-On (AWS SSO) updateString(&cfg.SSOAccountID, section, ssoAccountIDKey) updateString(&cfg.SSORegion, section, ssoRegionKey) @@ -461,32 +514,20 @@ func (cfg *sharedConfig) validateCredentialType() error { } func (cfg *sharedConfig) validateSSOConfiguration() error { - if !cfg.hasSSOConfiguration() { + if cfg.hasSSOTokenProviderConfiguration() { + err := cfg.validateSSOTokenProviderConfiguration() + if err != nil { + return err + } return nil } - var missing []string - if len(cfg.SSOAccountID) == 0 { - missing = append(missing, ssoAccountIDKey) - } - - if len(cfg.SSORegion) == 0 { - missing = append(missing, ssoRegionKey) - } - - if len(cfg.SSORoleName) == 0 { - missing = append(missing, ssoRoleNameKey) - } - - if len(cfg.SSOStartURL) == 0 { - missing = append(missing, ssoStartURL) - } - - if len(missing) > 0 { - return fmt.Errorf("profile %q is configured to use SSO but is missing required configuration: %s", - cfg.Profile, strings.Join(missing, ", ")) + if cfg.hasLegacySSOConfiguration() { + err := cfg.validateLegacySSOConfiguration() + if err != nil { + return err + } } - return nil } @@ -525,15 +566,76 @@ func (cfg *sharedConfig) clearAssumeRoleOptions() { } func (cfg *sharedConfig) hasSSOConfiguration() bool { - switch { - case len(cfg.SSOAccountID) != 0: - case len(cfg.SSORegion) != 0: - case len(cfg.SSORoleName) != 0: - case len(cfg.SSOStartURL) != 0: - default: - return false + return cfg.hasSSOTokenProviderConfiguration() || cfg.hasLegacySSOConfiguration() +} + +func (c *sharedConfig) hasSSOTokenProviderConfiguration() bool { + return len(c.SSOSessionName) > 0 +} + +func (c *sharedConfig) hasLegacySSOConfiguration() bool { + return len(c.SSORegion) > 0 || len(c.SSOAccountID) > 0 || len(c.SSOStartURL) > 0 || len(c.SSORoleName) > 0 +} + +func (c *sharedConfig) validateSSOTokenProviderConfiguration() error { + var missing []string + + if len(c.SSOSessionName) == 0 { + missing = append(missing, ssoSessionNameKey) } - return true + + if c.SSOSession == nil { + missing = append(missing, ssoSectionPrefix) + } else { + if len(c.SSOSession.SSORegion) == 0 { + missing = append(missing, ssoRegionKey) + } + + if len(c.SSOSession.SSOStartURL) == 0 { + missing = append(missing, ssoStartURL) + } + } + + if len(missing) > 0 { + return fmt.Errorf("profile %q is configured to use SSO but is missing required configuration: %s", + c.Profile, strings.Join(missing, ", ")) + } + + if len(c.SSORegion) > 0 && c.SSORegion != c.SSOSession.SSORegion { + return fmt.Errorf("%s in profile %q must match %s in %s", ssoRegionKey, c.Profile, ssoRegionKey, ssoSectionPrefix) + } + + if len(c.SSOStartURL) > 0 && c.SSOStartURL != c.SSOSession.SSOStartURL { + return fmt.Errorf("%s in profile %q must match %s in %s", ssoStartURL, c.Profile, ssoStartURL, ssoSectionPrefix) + } + + return nil +} + +func (c *sharedConfig) validateLegacySSOConfiguration() error { + var missing []string + + if len(c.SSORegion) == 0 { + missing = append(missing, ssoRegionKey) + } + + if len(c.SSOStartURL) == 0 { + missing = append(missing, ssoStartURL) + } + + if len(c.SSOAccountID) == 0 { + missing = append(missing, ssoAccountIDKey) + } + + if len(c.SSORoleName) == 0 { + missing = append(missing, ssoRoleNameKey) + } + + if len(missing) > 0 { + return fmt.Errorf("profile %q is configured to use SSO but is missing required configuration: %s", + c.Profile, strings.Join(missing, ", ")) + } + return nil } func oneOrNone(bs ...bool) bool { diff --git a/vendor/github.com/aws/aws-sdk-go/aws/signer/v4/v4.go b/vendor/github.com/aws/aws-sdk-go/aws/signer/v4/v4.go index 4d78162c03..b209793744 100644 --- a/vendor/github.com/aws/aws-sdk-go/aws/signer/v4/v4.go +++ b/vendor/github.com/aws/aws-sdk-go/aws/signer/v4/v4.go @@ -3,21 +3,21 @@ // Provides request signing for request that need to be signed with // AWS V4 Signatures. // -// Standalone Signer +// # Standalone Signer // // Generally using the signer outside of the SDK should not require any additional // logic when using Go v1.5 or higher. The signer does this by taking advantage // of the URL.EscapedPath method. If your request URI requires additional escaping -// you many need to use the URL.Opaque to define what the raw URI should be sent +// you may need to use the URL.Opaque to define what the raw URI should be sent // to the service as. // // The signer will first check the URL.Opaque field, and use its value if set. // The signer does require the URL.Opaque field to be set in the form of: // -// "//<hostname>/<path>" +// "//<hostname>/<path>" // -// // e.g. -// "//example.com/some/path" +// // e.g. +// "//example.com/some/path" // // The leading "//" and hostname are required or the URL.Opaque escaping will // not work correctly. @@ -135,6 +135,7 @@ var requiredSignedHeaders = rules{ "X-Amz-Request-Payer": struct{}{}, "X-Amz-Server-Side-Encryption": struct{}{}, "X-Amz-Server-Side-Encryption-Aws-Kms-Key-Id": struct{}{}, + "X-Amz-Server-Side-Encryption-Context": struct{}{}, "X-Amz-Server-Side-Encryption-Customer-Algorithm": struct{}{}, "X-Amz-Server-Side-Encryption-Customer-Key": struct{}{}, "X-Amz-Server-Side-Encryption-Customer-Key-Md5": struct{}{}, @@ -695,7 +696,8 @@ func (ctx *signingCtx) buildBodyDigest() error { includeSHA256Header := ctx.unsignedPayload || ctx.ServiceName == "s3" || ctx.ServiceName == "s3-object-lambda" || - ctx.ServiceName == "glacier" + ctx.ServiceName == "glacier" || + ctx.ServiceName == "s3-outposts" s3Presign := ctx.isPresign && (ctx.ServiceName == "s3" || diff --git a/vendor/github.com/aws/aws-sdk-go/aws/version.go b/vendor/github.com/aws/aws-sdk-go/aws/version.go index 8604de2965..39522c2609 100644 --- a/vendor/github.com/aws/aws-sdk-go/aws/version.go +++ b/vendor/github.com/aws/aws-sdk-go/aws/version.go @@ -5,4 +5,4 @@ package aws const SDKName = "aws-sdk-go" // SDKVersion is the version of this SDK -const SDKVersion = "1.44.159" +const SDKVersion = "1.44.327" diff --git a/vendor/github.com/aws/aws-sdk-go/private/protocol/jsonrpc/unmarshal_error.go b/vendor/github.com/aws/aws-sdk-go/private/protocol/jsonrpc/unmarshal_error.go index c0c52e2db0..9c1ccde54a 100644 --- a/vendor/github.com/aws/aws-sdk-go/private/protocol/jsonrpc/unmarshal_error.go +++ b/vendor/github.com/aws/aws-sdk-go/private/protocol/jsonrpc/unmarshal_error.go @@ -13,17 +13,46 @@ import ( "github.com/aws/aws-sdk-go/private/protocol/json/jsonutil" ) +const ( + awsQueryError = "x-amzn-query-error" + // A valid header example - "x-amzn-query-error": "<QueryErrorCode>;<ErrorType>" + awsQueryErrorPartsCount = 2 +) + // UnmarshalTypedError provides unmarshaling errors API response errors // for both typed and untyped errors. type UnmarshalTypedError struct { - exceptions map[string]func(protocol.ResponseMetadata) error + exceptions map[string]func(protocol.ResponseMetadata) error + queryExceptions map[string]func(protocol.ResponseMetadata, string) error } // NewUnmarshalTypedError returns an UnmarshalTypedError initialized for the // set of exception names to the error unmarshalers func NewUnmarshalTypedError(exceptions map[string]func(protocol.ResponseMetadata) error) *UnmarshalTypedError { return &UnmarshalTypedError{ - exceptions: exceptions, + exceptions: exceptions, + queryExceptions: map[string]func(protocol.ResponseMetadata, string) error{}, + } +} + +// NewUnmarshalTypedErrorWithOptions works similar to NewUnmarshalTypedError applying options to the UnmarshalTypedError +// before returning it +func NewUnmarshalTypedErrorWithOptions(exceptions map[string]func(protocol.ResponseMetadata) error, optFns ...func(*UnmarshalTypedError)) *UnmarshalTypedError { + unmarshaledError := NewUnmarshalTypedError(exceptions) + for _, fn := range optFns { + fn(unmarshaledError) + } + return unmarshaledError +} + +// WithQueryCompatibility is a helper function to construct a functional option for use with NewUnmarshalTypedErrorWithOptions. +// The queryExceptions given act as an override for unmarshalling errors when query compatible error codes are found. +// See also [awsQueryCompatible trait] +// +// [awsQueryCompatible trait]: https://smithy.io/2.0/aws/protocols/aws-query-protocol.html#aws-protocols-awsquerycompatible-trait +func WithQueryCompatibility(queryExceptions map[string]func(protocol.ResponseMetadata, string) error) func(*UnmarshalTypedError) { + return func(typedError *UnmarshalTypedError) { + typedError.queryExceptions = queryExceptions } } @@ -50,18 +79,32 @@ func (u *UnmarshalTypedError) UnmarshalError( code := codeParts[len(codeParts)-1] msg := jsonErr.Message + queryCodeParts := queryCodeParts(resp, u) + if fn, ok := u.exceptions[code]; ok { - // If exception code is know, use associated constructor to get a value + // If query-compatible exceptions are found and query-error-header is found, + // then use associated constructor to get exception with query error code. + // + // If exception code is known, use associated constructor to get a value // for the exception that the JSON body can be unmarshaled into. - v := fn(respMeta) + var v error + queryErrFn, queryExceptionsFound := u.queryExceptions[code] + if len(queryCodeParts) == awsQueryErrorPartsCount && queryExceptionsFound { + v = queryErrFn(respMeta, queryCodeParts[0]) + } else { + v = fn(respMeta) + } err := jsonutil.UnmarshalJSONCaseInsensitive(v, body) if err != nil { return nil, err } - return v, nil } + if len(queryCodeParts) == awsQueryErrorPartsCount && len(u.queryExceptions) > 0 { + code = queryCodeParts[0] + } + // fallback to unmodeled generic exceptions return awserr.NewRequestFailure( awserr.New(code, msg, nil), @@ -70,6 +113,16 @@ func (u *UnmarshalTypedError) UnmarshalError( ), nil } +// A valid header example - "x-amzn-query-error": "<QueryErrorCode>;<ErrorType>" +func queryCodeParts(resp *http.Response, u *UnmarshalTypedError) []string { + queryCodeHeader := resp.Header.Get(awsQueryError) + var queryCodeParts []string + if queryCodeHeader != "" && len(u.queryExceptions) > 0 { + queryCodeParts = strings.Split(queryCodeHeader, ";") + } + return queryCodeParts +} + // UnmarshalErrorHandler is a named request handler for unmarshaling jsonrpc // protocol request errors var UnmarshalErrorHandler = request.NamedHandler{ diff --git a/vendor/github.com/aws/aws-sdk-go/private/protocol/rest/build.go b/vendor/github.com/aws/aws-sdk-go/private/protocol/rest/build.go index 1d273ff0ec..ecc521f88f 100644 --- a/vendor/github.com/aws/aws-sdk-go/private/protocol/rest/build.go +++ b/vendor/github.com/aws/aws-sdk-go/private/protocol/rest/build.go @@ -287,6 +287,10 @@ func convertType(v reflect.Value, tag reflect.StructTag) (str string, err error) if tag.Get("location") != "header" || tag.Get("enum") == "" { return "", fmt.Errorf("%T is only supported with location header and enum shapes", value) } + if len(value) == 0 { + return "", errValueNotSet + } + buff := &bytes.Buffer{} for i, sv := range value { if sv == nil || len(*sv) == 0 { diff --git a/vendor/github.com/aws/aws-sdk-go/private/protocol/restjson/unmarshal_error.go b/vendor/github.com/aws/aws-sdk-go/private/protocol/restjson/unmarshal_error.go index d756d8cc52..5366a646d9 100644 --- a/vendor/github.com/aws/aws-sdk-go/private/protocol/restjson/unmarshal_error.go +++ b/vendor/github.com/aws/aws-sdk-go/private/protocol/restjson/unmarshal_error.go @@ -2,6 +2,7 @@ package restjson import ( "bytes" + "encoding/json" "io" "io/ioutil" "net/http" @@ -40,52 +41,30 @@ func (u *UnmarshalTypedError) UnmarshalError( resp *http.Response, respMeta protocol.ResponseMetadata, ) (error, error) { - - code := resp.Header.Get(errorTypeHeader) - msg := resp.Header.Get(errorMessageHeader) - - body := resp.Body - if len(code) == 0 { - // If unable to get code from HTTP headers have to parse JSON message - // to determine what kind of exception this will be. - var buf bytes.Buffer - var jsonErr jsonErrorResponse - teeReader := io.TeeReader(resp.Body, &buf) - err := jsonutil.UnmarshalJSONError(&jsonErr, teeReader) - if err != nil { - return nil, err - } - - body = ioutil.NopCloser(&buf) - code = jsonErr.Code - msg = jsonErr.Message + code, msg, err := unmarshalErrorInfo(resp) + if err != nil { + return nil, err } - // If code has colon separators remove them so can compare against modeled - // exception names. - code = strings.SplitN(code, ":", 2)[0] - - if fn, ok := u.exceptions[code]; ok { - // If exception code is know, use associated constructor to get a value - // for the exception that the JSON body can be unmarshaled into. - v := fn(respMeta) - if err := jsonutil.UnmarshalJSONCaseInsensitive(v, body); err != nil { - return nil, err - } + fn, ok := u.exceptions[code] + if !ok { + return awserr.NewRequestFailure( + awserr.New(code, msg, nil), + respMeta.StatusCode, + respMeta.RequestID, + ), nil + } - if err := rest.UnmarshalResponse(resp, v, true); err != nil { - return nil, err - } + v := fn(respMeta) + if err := jsonutil.UnmarshalJSONCaseInsensitive(v, resp.Body); err != nil { + return nil, err + } - return v, nil + if err := rest.UnmarshalResponse(resp, v, true); err != nil { + return nil, err } - // fallback to unmodeled generic exceptions - return awserr.NewRequestFailure( - awserr.New(code, msg, nil), - respMeta.StatusCode, - respMeta.RequestID, - ), nil + return v, nil } // UnmarshalErrorHandler is a named request handler for unmarshaling restjson @@ -99,36 +78,80 @@ var UnmarshalErrorHandler = request.NamedHandler{ func UnmarshalError(r *request.Request) { defer r.HTTPResponse.Body.Close() - var jsonErr jsonErrorResponse - err := jsonutil.UnmarshalJSONError(&jsonErr, r.HTTPResponse.Body) + code, msg, err := unmarshalErrorInfo(r.HTTPResponse) if err != nil { r.Error = awserr.NewRequestFailure( - awserr.New(request.ErrCodeSerialization, - "failed to unmarshal response error", err), + awserr.New(request.ErrCodeSerialization, "failed to unmarshal response error", err), r.HTTPResponse.StatusCode, r.RequestID, ) return } - code := r.HTTPResponse.Header.Get(errorTypeHeader) - if code == "" { - code = jsonErr.Code - } - msg := r.HTTPResponse.Header.Get(errorMessageHeader) - if msg == "" { - msg = jsonErr.Message - } - - code = strings.SplitN(code, ":", 2)[0] r.Error = awserr.NewRequestFailure( - awserr.New(code, jsonErr.Message, nil), + awserr.New(code, msg, nil), r.HTTPResponse.StatusCode, r.RequestID, ) } type jsonErrorResponse struct { + Type string `json:"__type"` Code string `json:"code"` Message string `json:"message"` } + +func (j *jsonErrorResponse) SanitizedCode() string { + code := j.Code + if len(j.Type) > 0 { + code = j.Type + } + return sanitizeCode(code) +} + +// Remove superfluous components from a restJson error code. +// - If a : character is present, then take only the contents before the +// first : character in the value. +// - If a # character is present, then take only the contents after the first +// # character in the value. +// +// All of the following error values resolve to FooError: +// - FooError +// - FooError:http://internal.amazon.com/coral/com.amazon.coral.validate/ +// - aws.protocoltests.restjson#FooError +// - aws.protocoltests.restjson#FooError:http://internal.amazon.com/coral/com.amazon.coral.validate/ +func sanitizeCode(code string) string { + noColon := strings.SplitN(code, ":", 2)[0] + hashSplit := strings.SplitN(noColon, "#", 2) + return hashSplit[len(hashSplit)-1] +} + +// attempt to garner error details from the response, preferring header values +// when present +func unmarshalErrorInfo(resp *http.Response) (code string, msg string, err error) { + code = sanitizeCode(resp.Header.Get(errorTypeHeader)) + msg = resp.Header.Get(errorMessageHeader) + if len(code) > 0 && len(msg) > 0 { + return + } + + // a modeled error will have to be re-deserialized later, so the body must + // be preserved + var buf bytes.Buffer + tee := io.TeeReader(resp.Body, &buf) + defer func() { resp.Body = ioutil.NopCloser(&buf) }() + + var jsonErr jsonErrorResponse + if decodeErr := json.NewDecoder(tee).Decode(&jsonErr); decodeErr != nil && decodeErr != io.EOF { + err = awserr.NewUnmarshalError(decodeErr, "failed to decode response body", buf.Bytes()) + return + } + + if len(code) == 0 { + code = jsonErr.SanitizedCode() + } + if len(msg) == 0 { + msg = jsonErr.Message + } + return +} diff --git a/vendor/github.com/aws/aws-sdk-go/service/ssooidc/api.go b/vendor/github.com/aws/aws-sdk-go/service/ssooidc/api.go new file mode 100644 index 0000000000..c743913c57 --- /dev/null +++ b/vendor/github.com/aws/aws-sdk-go/service/ssooidc/api.go @@ -0,0 +1,1682 @@ +// Code generated by private/model/cli/gen-api/main.go. DO NOT EDIT. + +package ssooidc + +import ( + "fmt" + + "github.com/aws/aws-sdk-go/aws" + "github.com/aws/aws-sdk-go/aws/awsutil" + "github.com/aws/aws-sdk-go/aws/credentials" + "github.com/aws/aws-sdk-go/aws/request" + "github.com/aws/aws-sdk-go/private/protocol" +) + +const opCreateToken = "CreateToken" + +// CreateTokenRequest generates a "aws/request.Request" representing the +// client's request for the CreateToken operation. The "output" return +// value will be populated with the request's response once the request completes +// successfully. +// +// Use "Send" method on the returned Request to send the API call to the service. +// the "output" return value is not valid until after Send returns without error. +// +// See CreateToken for more information on using the CreateToken +// API call, and error handling. +// +// This method is useful when you want to inject custom logic or configuration +// into the SDK's request lifecycle. Such as custom headers, or retry logic. +// +// // Example sending a request using the CreateTokenRequest method. +// req, resp := client.CreateTokenRequest(params) +// +// err := req.Send() +// if err == nil { // resp is now filled +// fmt.Println(resp) +// } +// +// See also, https://docs.aws.amazon.com/goto/WebAPI/sso-oidc-2019-06-10/CreateToken +func (c *SSOOIDC) CreateTokenRequest(input *CreateTokenInput) (req *request.Request, output *CreateTokenOutput) { + op := &request.Operation{ + Name: opCreateToken, + HTTPMethod: "POST", + HTTPPath: "/token", + } + + if input == nil { + input = &CreateTokenInput{} + } + + output = &CreateTokenOutput{} + req = c.newRequest(op, input, output) + req.Config.Credentials = credentials.AnonymousCredentials + return +} + +// CreateToken API operation for AWS SSO OIDC. +// +// Creates and returns an access token for the authorized client. The access +// token issued will be used to fetch short-term credentials for the assigned +// roles in the AWS account. +// +// Returns awserr.Error for service API and SDK errors. Use runtime type assertions +// with awserr.Error's Code and Message methods to get detailed information about +// the error. +// +// See the AWS API reference guide for AWS SSO OIDC's +// API operation CreateToken for usage and error information. +// +// Returned Error Types: +// +// - InvalidRequestException +// Indicates that something is wrong with the input to the request. For example, +// a required parameter might be missing or out of range. +// +// - InvalidClientException +// Indicates that the clientId or clientSecret in the request is invalid. For +// example, this can occur when a client sends an incorrect clientId or an expired +// clientSecret. +// +// - InvalidGrantException +// Indicates that a request contains an invalid grant. This can occur if a client +// makes a CreateToken request with an invalid grant type. +// +// - UnauthorizedClientException +// Indicates that the client is not currently authorized to make the request. +// This can happen when a clientId is not issued for a public client. +// +// - UnsupportedGrantTypeException +// Indicates that the grant type in the request is not supported by the service. +// +// - InvalidScopeException +// Indicates that the scope provided in the request is invalid. +// +// - AuthorizationPendingException +// Indicates that a request to authorize a client with an access user session +// token is pending. +// +// - SlowDownException +// Indicates that the client is making the request too frequently and is more +// than the service can handle. +// +// - AccessDeniedException +// You do not have sufficient access to perform this action. +// +// - ExpiredTokenException +// Indicates that the token issued by the service is expired and is no longer +// valid. +// +// - InternalServerException +// Indicates that an error from the service occurred while trying to process +// a request. +// +// See also, https://docs.aws.amazon.com/goto/WebAPI/sso-oidc-2019-06-10/CreateToken +func (c *SSOOIDC) CreateToken(input *CreateTokenInput) (*CreateTokenOutput, error) { + req, out := c.CreateTokenRequest(input) + return out, req.Send() +} + +// CreateTokenWithContext is the same as CreateToken with the addition of +// the ability to pass a context and additional request options. +// +// See CreateToken for details on how to use this API operation. +// +// The context must be non-nil and will be used for request cancellation. If +// the context is nil a panic will occur. In the future the SDK may create +// sub-contexts for http.Requests. See https://golang.org/pkg/context/ +// for more information on using Contexts. +func (c *SSOOIDC) CreateTokenWithContext(ctx aws.Context, input *CreateTokenInput, opts ...request.Option) (*CreateTokenOutput, error) { + req, out := c.CreateTokenRequest(input) + req.SetContext(ctx) + req.ApplyOptions(opts...) + return out, req.Send() +} + +const opRegisterClient = "RegisterClient" + +// RegisterClientRequest generates a "aws/request.Request" representing the +// client's request for the RegisterClient operation. The "output" return +// value will be populated with the request's response once the request completes +// successfully. +// +// Use "Send" method on the returned Request to send the API call to the service. +// the "output" return value is not valid until after Send returns without error. +// +// See RegisterClient for more information on using the RegisterClient +// API call, and error handling. +// +// This method is useful when you want to inject custom logic or configuration +// into the SDK's request lifecycle. Such as custom headers, or retry logic. +// +// // Example sending a request using the RegisterClientRequest method. +// req, resp := client.RegisterClientRequest(params) +// +// err := req.Send() +// if err == nil { // resp is now filled +// fmt.Println(resp) +// } +// +// See also, https://docs.aws.amazon.com/goto/WebAPI/sso-oidc-2019-06-10/RegisterClient +func (c *SSOOIDC) RegisterClientRequest(input *RegisterClientInput) (req *request.Request, output *RegisterClientOutput) { + op := &request.Operation{ + Name: opRegisterClient, + HTTPMethod: "POST", + HTTPPath: "/client/register", + } + + if input == nil { + input = &RegisterClientInput{} + } + + output = &RegisterClientOutput{} + req = c.newRequest(op, input, output) + req.Config.Credentials = credentials.AnonymousCredentials + return +} + +// RegisterClient API operation for AWS SSO OIDC. +// +// Registers a client with IAM Identity Center. This allows clients to initiate +// device authorization. The output should be persisted for reuse through many +// authentication requests. +// +// Returns awserr.Error for service API and SDK errors. Use runtime type assertions +// with awserr.Error's Code and Message methods to get detailed information about +// the error. +// +// See the AWS API reference guide for AWS SSO OIDC's +// API operation RegisterClient for usage and error information. +// +// Returned Error Types: +// +// - InvalidRequestException +// Indicates that something is wrong with the input to the request. For example, +// a required parameter might be missing or out of range. +// +// - InvalidScopeException +// Indicates that the scope provided in the request is invalid. +// +// - InvalidClientMetadataException +// Indicates that the client information sent in the request during registration +// is invalid. +// +// - InternalServerException +// Indicates that an error from the service occurred while trying to process +// a request. +// +// See also, https://docs.aws.amazon.com/goto/WebAPI/sso-oidc-2019-06-10/RegisterClient +func (c *SSOOIDC) RegisterClient(input *RegisterClientInput) (*RegisterClientOutput, error) { + req, out := c.RegisterClientRequest(input) + return out, req.Send() +} + +// RegisterClientWithContext is the same as RegisterClient with the addition of +// the ability to pass a context and additional request options. +// +// See RegisterClient for details on how to use this API operation. +// +// The context must be non-nil and will be used for request cancellation. If +// the context is nil a panic will occur. In the future the SDK may create +// sub-contexts for http.Requests. See https://golang.org/pkg/context/ +// for more information on using Contexts. +func (c *SSOOIDC) RegisterClientWithContext(ctx aws.Context, input *RegisterClientInput, opts ...request.Option) (*RegisterClientOutput, error) { + req, out := c.RegisterClientRequest(input) + req.SetContext(ctx) + req.ApplyOptions(opts...) + return out, req.Send() +} + +const opStartDeviceAuthorization = "StartDeviceAuthorization" + +// StartDeviceAuthorizationRequest generates a "aws/request.Request" representing the +// client's request for the StartDeviceAuthorization operation. The "output" return +// value will be populated with the request's response once the request completes +// successfully. +// +// Use "Send" method on the returned Request to send the API call to the service. +// the "output" return value is not valid until after Send returns without error. +// +// See StartDeviceAuthorization for more information on using the StartDeviceAuthorization +// API call, and error handling. +// +// This method is useful when you want to inject custom logic or configuration +// into the SDK's request lifecycle. Such as custom headers, or retry logic. +// +// // Example sending a request using the StartDeviceAuthorizationRequest method. +// req, resp := client.StartDeviceAuthorizationRequest(params) +// +// err := req.Send() +// if err == nil { // resp is now filled +// fmt.Println(resp) +// } +// +// See also, https://docs.aws.amazon.com/goto/WebAPI/sso-oidc-2019-06-10/StartDeviceAuthorization +func (c *SSOOIDC) StartDeviceAuthorizationRequest(input *StartDeviceAuthorizationInput) (req *request.Request, output *StartDeviceAuthorizationOutput) { + op := &request.Operation{ + Name: opStartDeviceAuthorization, + HTTPMethod: "POST", + HTTPPath: "/device_authorization", + } + + if input == nil { + input = &StartDeviceAuthorizationInput{} + } + + output = &StartDeviceAuthorizationOutput{} + req = c.newRequest(op, input, output) + req.Config.Credentials = credentials.AnonymousCredentials + return +} + +// StartDeviceAuthorization API operation for AWS SSO OIDC. +// +// Initiates device authorization by requesting a pair of verification codes +// from the authorization service. +// +// Returns awserr.Error for service API and SDK errors. Use runtime type assertions +// with awserr.Error's Code and Message methods to get detailed information about +// the error. +// +// See the AWS API reference guide for AWS SSO OIDC's +// API operation StartDeviceAuthorization for usage and error information. +// +// Returned Error Types: +// +// - InvalidRequestException +// Indicates that something is wrong with the input to the request. For example, +// a required parameter might be missing or out of range. +// +// - InvalidClientException +// Indicates that the clientId or clientSecret in the request is invalid. For +// example, this can occur when a client sends an incorrect clientId or an expired +// clientSecret. +// +// - UnauthorizedClientException +// Indicates that the client is not currently authorized to make the request. +// This can happen when a clientId is not issued for a public client. +// +// - SlowDownException +// Indicates that the client is making the request too frequently and is more +// than the service can handle. +// +// - InternalServerException +// Indicates that an error from the service occurred while trying to process +// a request. +// +// See also, https://docs.aws.amazon.com/goto/WebAPI/sso-oidc-2019-06-10/StartDeviceAuthorization +func (c *SSOOIDC) StartDeviceAuthorization(input *StartDeviceAuthorizationInput) (*StartDeviceAuthorizationOutput, error) { + req, out := c.StartDeviceAuthorizationRequest(input) + return out, req.Send() +} + +// StartDeviceAuthorizationWithContext is the same as StartDeviceAuthorization with the addition of +// the ability to pass a context and additional request options. +// +// See StartDeviceAuthorization for details on how to use this API operation. +// +// The context must be non-nil and will be used for request cancellation. If +// the context is nil a panic will occur. In the future the SDK may create +// sub-contexts for http.Requests. See https://golang.org/pkg/context/ +// for more information on using Contexts. +func (c *SSOOIDC) StartDeviceAuthorizationWithContext(ctx aws.Context, input *StartDeviceAuthorizationInput, opts ...request.Option) (*StartDeviceAuthorizationOutput, error) { + req, out := c.StartDeviceAuthorizationRequest(input) + req.SetContext(ctx) + req.ApplyOptions(opts...) + return out, req.Send() +} + +// You do not have sufficient access to perform this action. +type AccessDeniedException struct { + _ struct{} `type:"structure"` + RespMetadata protocol.ResponseMetadata `json:"-" xml:"-"` + + Error_ *string `locationName:"error" type:"string"` + + Error_description *string `locationName:"error_description" type:"string"` + + Message_ *string `locationName:"message" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s AccessDeniedException) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s AccessDeniedException) GoString() string { + return s.String() +} + +func newErrorAccessDeniedException(v protocol.ResponseMetadata) error { + return &AccessDeniedException{ + RespMetadata: v, + } +} + +// Code returns the exception type name. +func (s *AccessDeniedException) Code() string { + return "AccessDeniedException" +} + +// Message returns the exception's message. +func (s *AccessDeniedException) Message() string { + if s.Message_ != nil { + return *s.Message_ + } + return "" +} + +// OrigErr always returns nil, satisfies awserr.Error interface. +func (s *AccessDeniedException) OrigErr() error { + return nil +} + +func (s *AccessDeniedException) Error() string { + return fmt.Sprintf("%s: %s\n%s", s.Code(), s.Message(), s.String()) +} + +// Status code returns the HTTP status code for the request's response error. +func (s *AccessDeniedException) StatusCode() int { + return s.RespMetadata.StatusCode +} + +// RequestID returns the service's response RequestID for request. +func (s *AccessDeniedException) RequestID() string { + return s.RespMetadata.RequestID +} + +// Indicates that a request to authorize a client with an access user session +// token is pending. +type AuthorizationPendingException struct { + _ struct{} `type:"structure"` + RespMetadata protocol.ResponseMetadata `json:"-" xml:"-"` + + Error_ *string `locationName:"error" type:"string"` + + Error_description *string `locationName:"error_description" type:"string"` + + Message_ *string `locationName:"message" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s AuthorizationPendingException) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s AuthorizationPendingException) GoString() string { + return s.String() +} + +func newErrorAuthorizationPendingException(v protocol.ResponseMetadata) error { + return &AuthorizationPendingException{ + RespMetadata: v, + } +} + +// Code returns the exception type name. +func (s *AuthorizationPendingException) Code() string { + return "AuthorizationPendingException" +} + +// Message returns the exception's message. +func (s *AuthorizationPendingException) Message() string { + if s.Message_ != nil { + return *s.Message_ + } + return "" +} + +// OrigErr always returns nil, satisfies awserr.Error interface. +func (s *AuthorizationPendingException) OrigErr() error { + return nil +} + +func (s *AuthorizationPendingException) Error() string { + return fmt.Sprintf("%s: %s\n%s", s.Code(), s.Message(), s.String()) +} + +// Status code returns the HTTP status code for the request's response error. +func (s *AuthorizationPendingException) StatusCode() int { + return s.RespMetadata.StatusCode +} + +// RequestID returns the service's response RequestID for request. +func (s *AuthorizationPendingException) RequestID() string { + return s.RespMetadata.RequestID +} + +type CreateTokenInput struct { + _ struct{} `type:"structure"` + + // The unique identifier string for each client. This value should come from + // the persisted result of the RegisterClient API. + // + // ClientId is a required field + ClientId *string `locationName:"clientId" type:"string" required:"true"` + + // A secret string generated for the client. This value should come from the + // persisted result of the RegisterClient API. + // + // ClientSecret is a required field + ClientSecret *string `locationName:"clientSecret" type:"string" required:"true"` + + // The authorization code received from the authorization service. This parameter + // is required to perform an authorization grant request to get access to a + // token. + Code *string `locationName:"code" type:"string"` + + // Used only when calling this API for the device code grant type. This short-term + // code is used to identify this authentication attempt. This should come from + // an in-memory reference to the result of the StartDeviceAuthorization API. + DeviceCode *string `locationName:"deviceCode" type:"string"` + + // Supports grant types for the authorization code, refresh token, and device + // code request. For device code requests, specify the following value: + // + // urn:ietf:params:oauth:grant-type:device_code + // + // For information about how to obtain the device code, see the StartDeviceAuthorization + // topic. + // + // GrantType is a required field + GrantType *string `locationName:"grantType" type:"string" required:"true"` + + // The location of the application that will receive the authorization code. + // Users authorize the service to send the request to this location. + RedirectUri *string `locationName:"redirectUri" type:"string"` + + // Currently, refreshToken is not yet implemented and is not supported. For + // more information about the features and limitations of the current IAM Identity + // Center OIDC implementation, see Considerations for Using this Guide in the + // IAM Identity Center OIDC API Reference (https://docs.aws.amazon.com/singlesignon/latest/OIDCAPIReference/Welcome.html). + // + // The token used to obtain an access token in the event that the access token + // is invalid or expired. + RefreshToken *string `locationName:"refreshToken" type:"string"` + + // The list of scopes that is defined by the client. Upon authorization, this + // list is used to restrict permissions when granting an access token. + Scope []*string `locationName:"scope" type:"list"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s CreateTokenInput) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s CreateTokenInput) GoString() string { + return s.String() +} + +// Validate inspects the fields of the type to determine if they are valid. +func (s *CreateTokenInput) Validate() error { + invalidParams := request.ErrInvalidParams{Context: "CreateTokenInput"} + if s.ClientId == nil { + invalidParams.Add(request.NewErrParamRequired("ClientId")) + } + if s.ClientSecret == nil { + invalidParams.Add(request.NewErrParamRequired("ClientSecret")) + } + if s.GrantType == nil { + invalidParams.Add(request.NewErrParamRequired("GrantType")) + } + + if invalidParams.Len() > 0 { + return invalidParams + } + return nil +} + +// SetClientId sets the ClientId field's value. +func (s *CreateTokenInput) SetClientId(v string) *CreateTokenInput { + s.ClientId = &v + return s +} + +// SetClientSecret sets the ClientSecret field's value. +func (s *CreateTokenInput) SetClientSecret(v string) *CreateTokenInput { + s.ClientSecret = &v + return s +} + +// SetCode sets the Code field's value. +func (s *CreateTokenInput) SetCode(v string) *CreateTokenInput { + s.Code = &v + return s +} + +// SetDeviceCode sets the DeviceCode field's value. +func (s *CreateTokenInput) SetDeviceCode(v string) *CreateTokenInput { + s.DeviceCode = &v + return s +} + +// SetGrantType sets the GrantType field's value. +func (s *CreateTokenInput) SetGrantType(v string) *CreateTokenInput { + s.GrantType = &v + return s +} + +// SetRedirectUri sets the RedirectUri field's value. +func (s *CreateTokenInput) SetRedirectUri(v string) *CreateTokenInput { + s.RedirectUri = &v + return s +} + +// SetRefreshToken sets the RefreshToken field's value. +func (s *CreateTokenInput) SetRefreshToken(v string) *CreateTokenInput { + s.RefreshToken = &v + return s +} + +// SetScope sets the Scope field's value. +func (s *CreateTokenInput) SetScope(v []*string) *CreateTokenInput { + s.Scope = v + return s +} + +type CreateTokenOutput struct { + _ struct{} `type:"structure"` + + // An opaque token to access IAM Identity Center resources assigned to a user. + AccessToken *string `locationName:"accessToken" type:"string"` + + // Indicates the time in seconds when an access token will expire. + ExpiresIn *int64 `locationName:"expiresIn" type:"integer"` + + // Currently, idToken is not yet implemented and is not supported. For more + // information about the features and limitations of the current IAM Identity + // Center OIDC implementation, see Considerations for Using this Guide in the + // IAM Identity Center OIDC API Reference (https://docs.aws.amazon.com/singlesignon/latest/OIDCAPIReference/Welcome.html). + // + // The identifier of the user that associated with the access token, if present. + IdToken *string `locationName:"idToken" type:"string"` + + // Currently, refreshToken is not yet implemented and is not supported. For + // more information about the features and limitations of the current IAM Identity + // Center OIDC implementation, see Considerations for Using this Guide in the + // IAM Identity Center OIDC API Reference (https://docs.aws.amazon.com/singlesignon/latest/OIDCAPIReference/Welcome.html). + // + // A token that, if present, can be used to refresh a previously issued access + // token that might have expired. + RefreshToken *string `locationName:"refreshToken" type:"string"` + + // Used to notify the client that the returned token is an access token. The + // supported type is BearerToken. + TokenType *string `locationName:"tokenType" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s CreateTokenOutput) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s CreateTokenOutput) GoString() string { + return s.String() +} + +// SetAccessToken sets the AccessToken field's value. +func (s *CreateTokenOutput) SetAccessToken(v string) *CreateTokenOutput { + s.AccessToken = &v + return s +} + +// SetExpiresIn sets the ExpiresIn field's value. +func (s *CreateTokenOutput) SetExpiresIn(v int64) *CreateTokenOutput { + s.ExpiresIn = &v + return s +} + +// SetIdToken sets the IdToken field's value. +func (s *CreateTokenOutput) SetIdToken(v string) *CreateTokenOutput { + s.IdToken = &v + return s +} + +// SetRefreshToken sets the RefreshToken field's value. +func (s *CreateTokenOutput) SetRefreshToken(v string) *CreateTokenOutput { + s.RefreshToken = &v + return s +} + +// SetTokenType sets the TokenType field's value. +func (s *CreateTokenOutput) SetTokenType(v string) *CreateTokenOutput { + s.TokenType = &v + return s +} + +// Indicates that the token issued by the service is expired and is no longer +// valid. +type ExpiredTokenException struct { + _ struct{} `type:"structure"` + RespMetadata protocol.ResponseMetadata `json:"-" xml:"-"` + + Error_ *string `locationName:"error" type:"string"` + + Error_description *string `locationName:"error_description" type:"string"` + + Message_ *string `locationName:"message" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s ExpiredTokenException) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s ExpiredTokenException) GoString() string { + return s.String() +} + +func newErrorExpiredTokenException(v protocol.ResponseMetadata) error { + return &ExpiredTokenException{ + RespMetadata: v, + } +} + +// Code returns the exception type name. +func (s *ExpiredTokenException) Code() string { + return "ExpiredTokenException" +} + +// Message returns the exception's message. +func (s *ExpiredTokenException) Message() string { + if s.Message_ != nil { + return *s.Message_ + } + return "" +} + +// OrigErr always returns nil, satisfies awserr.Error interface. +func (s *ExpiredTokenException) OrigErr() error { + return nil +} + +func (s *ExpiredTokenException) Error() string { + return fmt.Sprintf("%s: %s\n%s", s.Code(), s.Message(), s.String()) +} + +// Status code returns the HTTP status code for the request's response error. +func (s *ExpiredTokenException) StatusCode() int { + return s.RespMetadata.StatusCode +} + +// RequestID returns the service's response RequestID for request. +func (s *ExpiredTokenException) RequestID() string { + return s.RespMetadata.RequestID +} + +// Indicates that an error from the service occurred while trying to process +// a request. +type InternalServerException struct { + _ struct{} `type:"structure"` + RespMetadata protocol.ResponseMetadata `json:"-" xml:"-"` + + Error_ *string `locationName:"error" type:"string"` + + Error_description *string `locationName:"error_description" type:"string"` + + Message_ *string `locationName:"message" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s InternalServerException) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s InternalServerException) GoString() string { + return s.String() +} + +func newErrorInternalServerException(v protocol.ResponseMetadata) error { + return &InternalServerException{ + RespMetadata: v, + } +} + +// Code returns the exception type name. +func (s *InternalServerException) Code() string { + return "InternalServerException" +} + +// Message returns the exception's message. +func (s *InternalServerException) Message() string { + if s.Message_ != nil { + return *s.Message_ + } + return "" +} + +// OrigErr always returns nil, satisfies awserr.Error interface. +func (s *InternalServerException) OrigErr() error { + return nil +} + +func (s *InternalServerException) Error() string { + return fmt.Sprintf("%s: %s\n%s", s.Code(), s.Message(), s.String()) +} + +// Status code returns the HTTP status code for the request's response error. +func (s *InternalServerException) StatusCode() int { + return s.RespMetadata.StatusCode +} + +// RequestID returns the service's response RequestID for request. +func (s *InternalServerException) RequestID() string { + return s.RespMetadata.RequestID +} + +// Indicates that the clientId or clientSecret in the request is invalid. For +// example, this can occur when a client sends an incorrect clientId or an expired +// clientSecret. +type InvalidClientException struct { + _ struct{} `type:"structure"` + RespMetadata protocol.ResponseMetadata `json:"-" xml:"-"` + + Error_ *string `locationName:"error" type:"string"` + + Error_description *string `locationName:"error_description" type:"string"` + + Message_ *string `locationName:"message" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s InvalidClientException) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s InvalidClientException) GoString() string { + return s.String() +} + +func newErrorInvalidClientException(v protocol.ResponseMetadata) error { + return &InvalidClientException{ + RespMetadata: v, + } +} + +// Code returns the exception type name. +func (s *InvalidClientException) Code() string { + return "InvalidClientException" +} + +// Message returns the exception's message. +func (s *InvalidClientException) Message() string { + if s.Message_ != nil { + return *s.Message_ + } + return "" +} + +// OrigErr always returns nil, satisfies awserr.Error interface. +func (s *InvalidClientException) OrigErr() error { + return nil +} + +func (s *InvalidClientException) Error() string { + return fmt.Sprintf("%s: %s\n%s", s.Code(), s.Message(), s.String()) +} + +// Status code returns the HTTP status code for the request's response error. +func (s *InvalidClientException) StatusCode() int { + return s.RespMetadata.StatusCode +} + +// RequestID returns the service's response RequestID for request. +func (s *InvalidClientException) RequestID() string { + return s.RespMetadata.RequestID +} + +// Indicates that the client information sent in the request during registration +// is invalid. +type InvalidClientMetadataException struct { + _ struct{} `type:"structure"` + RespMetadata protocol.ResponseMetadata `json:"-" xml:"-"` + + Error_ *string `locationName:"error" type:"string"` + + Error_description *string `locationName:"error_description" type:"string"` + + Message_ *string `locationName:"message" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s InvalidClientMetadataException) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s InvalidClientMetadataException) GoString() string { + return s.String() +} + +func newErrorInvalidClientMetadataException(v protocol.ResponseMetadata) error { + return &InvalidClientMetadataException{ + RespMetadata: v, + } +} + +// Code returns the exception type name. +func (s *InvalidClientMetadataException) Code() string { + return "InvalidClientMetadataException" +} + +// Message returns the exception's message. +func (s *InvalidClientMetadataException) Message() string { + if s.Message_ != nil { + return *s.Message_ + } + return "" +} + +// OrigErr always returns nil, satisfies awserr.Error interface. +func (s *InvalidClientMetadataException) OrigErr() error { + return nil +} + +func (s *InvalidClientMetadataException) Error() string { + return fmt.Sprintf("%s: %s\n%s", s.Code(), s.Message(), s.String()) +} + +// Status code returns the HTTP status code for the request's response error. +func (s *InvalidClientMetadataException) StatusCode() int { + return s.RespMetadata.StatusCode +} + +// RequestID returns the service's response RequestID for request. +func (s *InvalidClientMetadataException) RequestID() string { + return s.RespMetadata.RequestID +} + +// Indicates that a request contains an invalid grant. This can occur if a client +// makes a CreateToken request with an invalid grant type. +type InvalidGrantException struct { + _ struct{} `type:"structure"` + RespMetadata protocol.ResponseMetadata `json:"-" xml:"-"` + + Error_ *string `locationName:"error" type:"string"` + + Error_description *string `locationName:"error_description" type:"string"` + + Message_ *string `locationName:"message" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s InvalidGrantException) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s InvalidGrantException) GoString() string { + return s.String() +} + +func newErrorInvalidGrantException(v protocol.ResponseMetadata) error { + return &InvalidGrantException{ + RespMetadata: v, + } +} + +// Code returns the exception type name. +func (s *InvalidGrantException) Code() string { + return "InvalidGrantException" +} + +// Message returns the exception's message. +func (s *InvalidGrantException) Message() string { + if s.Message_ != nil { + return *s.Message_ + } + return "" +} + +// OrigErr always returns nil, satisfies awserr.Error interface. +func (s *InvalidGrantException) OrigErr() error { + return nil +} + +func (s *InvalidGrantException) Error() string { + return fmt.Sprintf("%s: %s\n%s", s.Code(), s.Message(), s.String()) +} + +// Status code returns the HTTP status code for the request's response error. +func (s *InvalidGrantException) StatusCode() int { + return s.RespMetadata.StatusCode +} + +// RequestID returns the service's response RequestID for request. +func (s *InvalidGrantException) RequestID() string { + return s.RespMetadata.RequestID +} + +// Indicates that something is wrong with the input to the request. For example, +// a required parameter might be missing or out of range. +type InvalidRequestException struct { + _ struct{} `type:"structure"` + RespMetadata protocol.ResponseMetadata `json:"-" xml:"-"` + + Error_ *string `locationName:"error" type:"string"` + + Error_description *string `locationName:"error_description" type:"string"` + + Message_ *string `locationName:"message" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s InvalidRequestException) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s InvalidRequestException) GoString() string { + return s.String() +} + +func newErrorInvalidRequestException(v protocol.ResponseMetadata) error { + return &InvalidRequestException{ + RespMetadata: v, + } +} + +// Code returns the exception type name. +func (s *InvalidRequestException) Code() string { + return "InvalidRequestException" +} + +// Message returns the exception's message. +func (s *InvalidRequestException) Message() string { + if s.Message_ != nil { + return *s.Message_ + } + return "" +} + +// OrigErr always returns nil, satisfies awserr.Error interface. +func (s *InvalidRequestException) OrigErr() error { + return nil +} + +func (s *InvalidRequestException) Error() string { + return fmt.Sprintf("%s: %s\n%s", s.Code(), s.Message(), s.String()) +} + +// Status code returns the HTTP status code for the request's response error. +func (s *InvalidRequestException) StatusCode() int { + return s.RespMetadata.StatusCode +} + +// RequestID returns the service's response RequestID for request. +func (s *InvalidRequestException) RequestID() string { + return s.RespMetadata.RequestID +} + +// Indicates that the scope provided in the request is invalid. +type InvalidScopeException struct { + _ struct{} `type:"structure"` + RespMetadata protocol.ResponseMetadata `json:"-" xml:"-"` + + Error_ *string `locationName:"error" type:"string"` + + Error_description *string `locationName:"error_description" type:"string"` + + Message_ *string `locationName:"message" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s InvalidScopeException) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s InvalidScopeException) GoString() string { + return s.String() +} + +func newErrorInvalidScopeException(v protocol.ResponseMetadata) error { + return &InvalidScopeException{ + RespMetadata: v, + } +} + +// Code returns the exception type name. +func (s *InvalidScopeException) Code() string { + return "InvalidScopeException" +} + +// Message returns the exception's message. +func (s *InvalidScopeException) Message() string { + if s.Message_ != nil { + return *s.Message_ + } + return "" +} + +// OrigErr always returns nil, satisfies awserr.Error interface. +func (s *InvalidScopeException) OrigErr() error { + return nil +} + +func (s *InvalidScopeException) Error() string { + return fmt.Sprintf("%s: %s\n%s", s.Code(), s.Message(), s.String()) +} + +// Status code returns the HTTP status code for the request's response error. +func (s *InvalidScopeException) StatusCode() int { + return s.RespMetadata.StatusCode +} + +// RequestID returns the service's response RequestID for request. +func (s *InvalidScopeException) RequestID() string { + return s.RespMetadata.RequestID +} + +type RegisterClientInput struct { + _ struct{} `type:"structure"` + + // The friendly name of the client. + // + // ClientName is a required field + ClientName *string `locationName:"clientName" type:"string" required:"true"` + + // The type of client. The service supports only public as a client type. Anything + // other than public will be rejected by the service. + // + // ClientType is a required field + ClientType *string `locationName:"clientType" type:"string" required:"true"` + + // The list of scopes that are defined by the client. Upon authorization, this + // list is used to restrict permissions when granting an access token. + Scopes []*string `locationName:"scopes" type:"list"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s RegisterClientInput) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s RegisterClientInput) GoString() string { + return s.String() +} + +// Validate inspects the fields of the type to determine if they are valid. +func (s *RegisterClientInput) Validate() error { + invalidParams := request.ErrInvalidParams{Context: "RegisterClientInput"} + if s.ClientName == nil { + invalidParams.Add(request.NewErrParamRequired("ClientName")) + } + if s.ClientType == nil { + invalidParams.Add(request.NewErrParamRequired("ClientType")) + } + + if invalidParams.Len() > 0 { + return invalidParams + } + return nil +} + +// SetClientName sets the ClientName field's value. +func (s *RegisterClientInput) SetClientName(v string) *RegisterClientInput { + s.ClientName = &v + return s +} + +// SetClientType sets the ClientType field's value. +func (s *RegisterClientInput) SetClientType(v string) *RegisterClientInput { + s.ClientType = &v + return s +} + +// SetScopes sets the Scopes field's value. +func (s *RegisterClientInput) SetScopes(v []*string) *RegisterClientInput { + s.Scopes = v + return s +} + +type RegisterClientOutput struct { + _ struct{} `type:"structure"` + + // The endpoint where the client can request authorization. + AuthorizationEndpoint *string `locationName:"authorizationEndpoint" type:"string"` + + // The unique identifier string for each client. This client uses this identifier + // to get authenticated by the service in subsequent calls. + ClientId *string `locationName:"clientId" type:"string"` + + // Indicates the time at which the clientId and clientSecret were issued. + ClientIdIssuedAt *int64 `locationName:"clientIdIssuedAt" type:"long"` + + // A secret string generated for the client. The client will use this string + // to get authenticated by the service in subsequent calls. + ClientSecret *string `locationName:"clientSecret" type:"string"` + + // Indicates the time at which the clientId and clientSecret will become invalid. + ClientSecretExpiresAt *int64 `locationName:"clientSecretExpiresAt" type:"long"` + + // The endpoint where the client can get an access token. + TokenEndpoint *string `locationName:"tokenEndpoint" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s RegisterClientOutput) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s RegisterClientOutput) GoString() string { + return s.String() +} + +// SetAuthorizationEndpoint sets the AuthorizationEndpoint field's value. +func (s *RegisterClientOutput) SetAuthorizationEndpoint(v string) *RegisterClientOutput { + s.AuthorizationEndpoint = &v + return s +} + +// SetClientId sets the ClientId field's value. +func (s *RegisterClientOutput) SetClientId(v string) *RegisterClientOutput { + s.ClientId = &v + return s +} + +// SetClientIdIssuedAt sets the ClientIdIssuedAt field's value. +func (s *RegisterClientOutput) SetClientIdIssuedAt(v int64) *RegisterClientOutput { + s.ClientIdIssuedAt = &v + return s +} + +// SetClientSecret sets the ClientSecret field's value. +func (s *RegisterClientOutput) SetClientSecret(v string) *RegisterClientOutput { + s.ClientSecret = &v + return s +} + +// SetClientSecretExpiresAt sets the ClientSecretExpiresAt field's value. +func (s *RegisterClientOutput) SetClientSecretExpiresAt(v int64) *RegisterClientOutput { + s.ClientSecretExpiresAt = &v + return s +} + +// SetTokenEndpoint sets the TokenEndpoint field's value. +func (s *RegisterClientOutput) SetTokenEndpoint(v string) *RegisterClientOutput { + s.TokenEndpoint = &v + return s +} + +// Indicates that the client is making the request too frequently and is more +// than the service can handle. +type SlowDownException struct { + _ struct{} `type:"structure"` + RespMetadata protocol.ResponseMetadata `json:"-" xml:"-"` + + Error_ *string `locationName:"error" type:"string"` + + Error_description *string `locationName:"error_description" type:"string"` + + Message_ *string `locationName:"message" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s SlowDownException) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s SlowDownException) GoString() string { + return s.String() +} + +func newErrorSlowDownException(v protocol.ResponseMetadata) error { + return &SlowDownException{ + RespMetadata: v, + } +} + +// Code returns the exception type name. +func (s *SlowDownException) Code() string { + return "SlowDownException" +} + +// Message returns the exception's message. +func (s *SlowDownException) Message() string { + if s.Message_ != nil { + return *s.Message_ + } + return "" +} + +// OrigErr always returns nil, satisfies awserr.Error interface. +func (s *SlowDownException) OrigErr() error { + return nil +} + +func (s *SlowDownException) Error() string { + return fmt.Sprintf("%s: %s\n%s", s.Code(), s.Message(), s.String()) +} + +// Status code returns the HTTP status code for the request's response error. +func (s *SlowDownException) StatusCode() int { + return s.RespMetadata.StatusCode +} + +// RequestID returns the service's response RequestID for request. +func (s *SlowDownException) RequestID() string { + return s.RespMetadata.RequestID +} + +type StartDeviceAuthorizationInput struct { + _ struct{} `type:"structure"` + + // The unique identifier string for the client that is registered with IAM Identity + // Center. This value should come from the persisted result of the RegisterClient + // API operation. + // + // ClientId is a required field + ClientId *string `locationName:"clientId" type:"string" required:"true"` + + // A secret string that is generated for the client. This value should come + // from the persisted result of the RegisterClient API operation. + // + // ClientSecret is a required field + ClientSecret *string `locationName:"clientSecret" type:"string" required:"true"` + + // The URL for the AWS access portal. For more information, see Using the AWS + // access portal (https://docs.aws.amazon.com/singlesignon/latest/userguide/using-the-portal.html) + // in the IAM Identity Center User Guide. + // + // StartUrl is a required field + StartUrl *string `locationName:"startUrl" type:"string" required:"true"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s StartDeviceAuthorizationInput) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s StartDeviceAuthorizationInput) GoString() string { + return s.String() +} + +// Validate inspects the fields of the type to determine if they are valid. +func (s *StartDeviceAuthorizationInput) Validate() error { + invalidParams := request.ErrInvalidParams{Context: "StartDeviceAuthorizationInput"} + if s.ClientId == nil { + invalidParams.Add(request.NewErrParamRequired("ClientId")) + } + if s.ClientSecret == nil { + invalidParams.Add(request.NewErrParamRequired("ClientSecret")) + } + if s.StartUrl == nil { + invalidParams.Add(request.NewErrParamRequired("StartUrl")) + } + + if invalidParams.Len() > 0 { + return invalidParams + } + return nil +} + +// SetClientId sets the ClientId field's value. +func (s *StartDeviceAuthorizationInput) SetClientId(v string) *StartDeviceAuthorizationInput { + s.ClientId = &v + return s +} + +// SetClientSecret sets the ClientSecret field's value. +func (s *StartDeviceAuthorizationInput) SetClientSecret(v string) *StartDeviceAuthorizationInput { + s.ClientSecret = &v + return s +} + +// SetStartUrl sets the StartUrl field's value. +func (s *StartDeviceAuthorizationInput) SetStartUrl(v string) *StartDeviceAuthorizationInput { + s.StartUrl = &v + return s +} + +type StartDeviceAuthorizationOutput struct { + _ struct{} `type:"structure"` + + // The short-lived code that is used by the device when polling for a session + // token. + DeviceCode *string `locationName:"deviceCode" type:"string"` + + // Indicates the number of seconds in which the verification code will become + // invalid. + ExpiresIn *int64 `locationName:"expiresIn" type:"integer"` + + // Indicates the number of seconds the client must wait between attempts when + // polling for a session. + Interval *int64 `locationName:"interval" type:"integer"` + + // A one-time user verification code. This is needed to authorize an in-use + // device. + UserCode *string `locationName:"userCode" type:"string"` + + // The URI of the verification page that takes the userCode to authorize the + // device. + VerificationUri *string `locationName:"verificationUri" type:"string"` + + // An alternate URL that the client can use to automatically launch a browser. + // This process skips the manual step in which the user visits the verification + // page and enters their code. + VerificationUriComplete *string `locationName:"verificationUriComplete" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s StartDeviceAuthorizationOutput) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s StartDeviceAuthorizationOutput) GoString() string { + return s.String() +} + +// SetDeviceCode sets the DeviceCode field's value. +func (s *StartDeviceAuthorizationOutput) SetDeviceCode(v string) *StartDeviceAuthorizationOutput { + s.DeviceCode = &v + return s +} + +// SetExpiresIn sets the ExpiresIn field's value. +func (s *StartDeviceAuthorizationOutput) SetExpiresIn(v int64) *StartDeviceAuthorizationOutput { + s.ExpiresIn = &v + return s +} + +// SetInterval sets the Interval field's value. +func (s *StartDeviceAuthorizationOutput) SetInterval(v int64) *StartDeviceAuthorizationOutput { + s.Interval = &v + return s +} + +// SetUserCode sets the UserCode field's value. +func (s *StartDeviceAuthorizationOutput) SetUserCode(v string) *StartDeviceAuthorizationOutput { + s.UserCode = &v + return s +} + +// SetVerificationUri sets the VerificationUri field's value. +func (s *StartDeviceAuthorizationOutput) SetVerificationUri(v string) *StartDeviceAuthorizationOutput { + s.VerificationUri = &v + return s +} + +// SetVerificationUriComplete sets the VerificationUriComplete field's value. +func (s *StartDeviceAuthorizationOutput) SetVerificationUriComplete(v string) *StartDeviceAuthorizationOutput { + s.VerificationUriComplete = &v + return s +} + +// Indicates that the client is not currently authorized to make the request. +// This can happen when a clientId is not issued for a public client. +type UnauthorizedClientException struct { + _ struct{} `type:"structure"` + RespMetadata protocol.ResponseMetadata `json:"-" xml:"-"` + + Error_ *string `locationName:"error" type:"string"` + + Error_description *string `locationName:"error_description" type:"string"` + + Message_ *string `locationName:"message" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s UnauthorizedClientException) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s UnauthorizedClientException) GoString() string { + return s.String() +} + +func newErrorUnauthorizedClientException(v protocol.ResponseMetadata) error { + return &UnauthorizedClientException{ + RespMetadata: v, + } +} + +// Code returns the exception type name. +func (s *UnauthorizedClientException) Code() string { + return "UnauthorizedClientException" +} + +// Message returns the exception's message. +func (s *UnauthorizedClientException) Message() string { + if s.Message_ != nil { + return *s.Message_ + } + return "" +} + +// OrigErr always returns nil, satisfies awserr.Error interface. +func (s *UnauthorizedClientException) OrigErr() error { + return nil +} + +func (s *UnauthorizedClientException) Error() string { + return fmt.Sprintf("%s: %s\n%s", s.Code(), s.Message(), s.String()) +} + +// Status code returns the HTTP status code for the request's response error. +func (s *UnauthorizedClientException) StatusCode() int { + return s.RespMetadata.StatusCode +} + +// RequestID returns the service's response RequestID for request. +func (s *UnauthorizedClientException) RequestID() string { + return s.RespMetadata.RequestID +} + +// Indicates that the grant type in the request is not supported by the service. +type UnsupportedGrantTypeException struct { + _ struct{} `type:"structure"` + RespMetadata protocol.ResponseMetadata `json:"-" xml:"-"` + + Error_ *string `locationName:"error" type:"string"` + + Error_description *string `locationName:"error_description" type:"string"` + + Message_ *string `locationName:"message" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s UnsupportedGrantTypeException) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s UnsupportedGrantTypeException) GoString() string { + return s.String() +} + +func newErrorUnsupportedGrantTypeException(v protocol.ResponseMetadata) error { + return &UnsupportedGrantTypeException{ + RespMetadata: v, + } +} + +// Code returns the exception type name. +func (s *UnsupportedGrantTypeException) Code() string { + return "UnsupportedGrantTypeException" +} + +// Message returns the exception's message. +func (s *UnsupportedGrantTypeException) Message() string { + if s.Message_ != nil { + return *s.Message_ + } + return "" +} + +// OrigErr always returns nil, satisfies awserr.Error interface. +func (s *UnsupportedGrantTypeException) OrigErr() error { + return nil +} + +func (s *UnsupportedGrantTypeException) Error() string { + return fmt.Sprintf("%s: %s\n%s", s.Code(), s.Message(), s.String()) +} + +// Status code returns the HTTP status code for the request's response error. +func (s *UnsupportedGrantTypeException) StatusCode() int { + return s.RespMetadata.StatusCode +} + +// RequestID returns the service's response RequestID for request. +func (s *UnsupportedGrantTypeException) RequestID() string { + return s.RespMetadata.RequestID +} diff --git a/vendor/github.com/aws/aws-sdk-go/service/ssooidc/doc.go b/vendor/github.com/aws/aws-sdk-go/service/ssooidc/doc.go new file mode 100644 index 0000000000..8b5ee6019a --- /dev/null +++ b/vendor/github.com/aws/aws-sdk-go/service/ssooidc/doc.go @@ -0,0 +1,66 @@ +// Code generated by private/model/cli/gen-api/main.go. DO NOT EDIT. + +// Package ssooidc provides the client and types for making API +// requests to AWS SSO OIDC. +// +// AWS IAM Identity Center (successor to AWS Single Sign-On) OpenID Connect +// (OIDC) is a web service that enables a client (such as AWS CLI or a native +// application) to register with IAM Identity Center. The service also enables +// the client to fetch the user’s access token upon successful authentication +// and authorization with IAM Identity Center. +// +// Although AWS Single Sign-On was renamed, the sso and identitystore API namespaces +// will continue to retain their original name for backward compatibility purposes. +// For more information, see IAM Identity Center rename (https://docs.aws.amazon.com/singlesignon/latest/userguide/what-is.html#renamed). +// +// # Considerations for Using This Guide +// +// Before you begin using this guide, we recommend that you first review the +// following important information about how the IAM Identity Center OIDC service +// works. +// +// - The IAM Identity Center OIDC service currently implements only the portions +// of the OAuth 2.0 Device Authorization Grant standard (https://tools.ietf.org/html/rfc8628 +// (https://tools.ietf.org/html/rfc8628)) that are necessary to enable single +// sign-on authentication with the AWS CLI. Support for other OIDC flows +// frequently needed for native applications, such as Authorization Code +// Flow (+ PKCE), will be addressed in future releases. +// +// - The service emits only OIDC access tokens, such that obtaining a new +// token (For example, token refresh) requires explicit user re-authentication. +// +// - The access tokens provided by this service grant access to all AWS account +// entitlements assigned to an IAM Identity Center user, not just a particular +// application. +// +// - The documentation in this guide does not describe the mechanism to convert +// the access token into AWS Auth (“sigv4”) credentials for use with +// IAM-protected AWS service endpoints. For more information, see GetRoleCredentials +// (https://docs.aws.amazon.com/singlesignon/latest/PortalAPIReference/API_GetRoleCredentials.html) +// in the IAM Identity Center Portal API Reference Guide. +// +// For general information about IAM Identity Center, see What is IAM Identity +// Center? (https://docs.aws.amazon.com/singlesignon/latest/userguide/what-is.html) +// in the IAM Identity Center User Guide. +// +// See https://docs.aws.amazon.com/goto/WebAPI/sso-oidc-2019-06-10 for more information on this service. +// +// See ssooidc package documentation for more information. +// https://docs.aws.amazon.com/sdk-for-go/api/service/ssooidc/ +// +// # Using the Client +// +// To contact AWS SSO OIDC with the SDK use the New function to create +// a new service client. With that client you can make API requests to the service. +// These clients are safe to use concurrently. +// +// See the SDK's documentation for more information on how to use the SDK. +// https://docs.aws.amazon.com/sdk-for-go/api/ +// +// See aws.Config documentation for more information on configuring SDK clients. +// https://docs.aws.amazon.com/sdk-for-go/api/aws/#Config +// +// See the AWS SSO OIDC client SSOOIDC for more +// information on creating client for this service. +// https://docs.aws.amazon.com/sdk-for-go/api/service/ssooidc/#New +package ssooidc diff --git a/vendor/github.com/aws/aws-sdk-go/service/ssooidc/errors.go b/vendor/github.com/aws/aws-sdk-go/service/ssooidc/errors.go new file mode 100644 index 0000000000..6983770126 --- /dev/null +++ b/vendor/github.com/aws/aws-sdk-go/service/ssooidc/errors.go @@ -0,0 +1,107 @@ +// Code generated by private/model/cli/gen-api/main.go. DO NOT EDIT. + +package ssooidc + +import ( + "github.com/aws/aws-sdk-go/private/protocol" +) + +const ( + + // ErrCodeAccessDeniedException for service response error code + // "AccessDeniedException". + // + // You do not have sufficient access to perform this action. + ErrCodeAccessDeniedException = "AccessDeniedException" + + // ErrCodeAuthorizationPendingException for service response error code + // "AuthorizationPendingException". + // + // Indicates that a request to authorize a client with an access user session + // token is pending. + ErrCodeAuthorizationPendingException = "AuthorizationPendingException" + + // ErrCodeExpiredTokenException for service response error code + // "ExpiredTokenException". + // + // Indicates that the token issued by the service is expired and is no longer + // valid. + ErrCodeExpiredTokenException = "ExpiredTokenException" + + // ErrCodeInternalServerException for service response error code + // "InternalServerException". + // + // Indicates that an error from the service occurred while trying to process + // a request. + ErrCodeInternalServerException = "InternalServerException" + + // ErrCodeInvalidClientException for service response error code + // "InvalidClientException". + // + // Indicates that the clientId or clientSecret in the request is invalid. For + // example, this can occur when a client sends an incorrect clientId or an expired + // clientSecret. + ErrCodeInvalidClientException = "InvalidClientException" + + // ErrCodeInvalidClientMetadataException for service response error code + // "InvalidClientMetadataException". + // + // Indicates that the client information sent in the request during registration + // is invalid. + ErrCodeInvalidClientMetadataException = "InvalidClientMetadataException" + + // ErrCodeInvalidGrantException for service response error code + // "InvalidGrantException". + // + // Indicates that a request contains an invalid grant. This can occur if a client + // makes a CreateToken request with an invalid grant type. + ErrCodeInvalidGrantException = "InvalidGrantException" + + // ErrCodeInvalidRequestException for service response error code + // "InvalidRequestException". + // + // Indicates that something is wrong with the input to the request. For example, + // a required parameter might be missing or out of range. + ErrCodeInvalidRequestException = "InvalidRequestException" + + // ErrCodeInvalidScopeException for service response error code + // "InvalidScopeException". + // + // Indicates that the scope provided in the request is invalid. + ErrCodeInvalidScopeException = "InvalidScopeException" + + // ErrCodeSlowDownException for service response error code + // "SlowDownException". + // + // Indicates that the client is making the request too frequently and is more + // than the service can handle. + ErrCodeSlowDownException = "SlowDownException" + + // ErrCodeUnauthorizedClientException for service response error code + // "UnauthorizedClientException". + // + // Indicates that the client is not currently authorized to make the request. + // This can happen when a clientId is not issued for a public client. + ErrCodeUnauthorizedClientException = "UnauthorizedClientException" + + // ErrCodeUnsupportedGrantTypeException for service response error code + // "UnsupportedGrantTypeException". + // + // Indicates that the grant type in the request is not supported by the service. + ErrCodeUnsupportedGrantTypeException = "UnsupportedGrantTypeException" +) + +var exceptionFromCode = map[string]func(protocol.ResponseMetadata) error{ + "AccessDeniedException": newErrorAccessDeniedException, + "AuthorizationPendingException": newErrorAuthorizationPendingException, + "ExpiredTokenException": newErrorExpiredTokenException, + "InternalServerException": newErrorInternalServerException, + "InvalidClientException": newErrorInvalidClientException, + "InvalidClientMetadataException": newErrorInvalidClientMetadataException, + "InvalidGrantException": newErrorInvalidGrantException, + "InvalidRequestException": newErrorInvalidRequestException, + "InvalidScopeException": newErrorInvalidScopeException, + "SlowDownException": newErrorSlowDownException, + "UnauthorizedClientException": newErrorUnauthorizedClientException, + "UnsupportedGrantTypeException": newErrorUnsupportedGrantTypeException, +} diff --git a/vendor/github.com/aws/aws-sdk-go/service/ssooidc/service.go b/vendor/github.com/aws/aws-sdk-go/service/ssooidc/service.go new file mode 100644 index 0000000000..969f33c37b --- /dev/null +++ b/vendor/github.com/aws/aws-sdk-go/service/ssooidc/service.go @@ -0,0 +1,106 @@ +// Code generated by private/model/cli/gen-api/main.go. DO NOT EDIT. + +package ssooidc + +import ( + "github.com/aws/aws-sdk-go/aws" + "github.com/aws/aws-sdk-go/aws/client" + "github.com/aws/aws-sdk-go/aws/client/metadata" + "github.com/aws/aws-sdk-go/aws/request" + "github.com/aws/aws-sdk-go/aws/signer/v4" + "github.com/aws/aws-sdk-go/private/protocol" + "github.com/aws/aws-sdk-go/private/protocol/restjson" +) + +// SSOOIDC provides the API operation methods for making requests to +// AWS SSO OIDC. See this package's package overview docs +// for details on the service. +// +// SSOOIDC methods are safe to use concurrently. It is not safe to +// modify mutate any of the struct's properties though. +type SSOOIDC struct { + *client.Client +} + +// Used for custom client initialization logic +var initClient func(*client.Client) + +// Used for custom request initialization logic +var initRequest func(*request.Request) + +// Service information constants +const ( + ServiceName = "SSO OIDC" // Name of service. + EndpointsID = "oidc" // ID to lookup a service endpoint with. + ServiceID = "SSO OIDC" // ServiceID is a unique identifier of a specific service. +) + +// New creates a new instance of the SSOOIDC client with a session. +// If additional configuration is needed for the client instance use the optional +// aws.Config parameter to add your extra config. +// +// Example: +// +// mySession := session.Must(session.NewSession()) +// +// // Create a SSOOIDC client from just a session. +// svc := ssooidc.New(mySession) +// +// // Create a SSOOIDC client with additional configuration +// svc := ssooidc.New(mySession, aws.NewConfig().WithRegion("us-west-2")) +func New(p client.ConfigProvider, cfgs ...*aws.Config) *SSOOIDC { + c := p.ClientConfig(EndpointsID, cfgs...) + if c.SigningNameDerived || len(c.SigningName) == 0 { + c.SigningName = "awsssooidc" + } + return newClient(*c.Config, c.Handlers, c.PartitionID, c.Endpoint, c.SigningRegion, c.SigningName, c.ResolvedRegion) +} + +// newClient creates, initializes and returns a new service client instance. +func newClient(cfg aws.Config, handlers request.Handlers, partitionID, endpoint, signingRegion, signingName, resolvedRegion string) *SSOOIDC { + svc := &SSOOIDC{ + Client: client.New( + cfg, + metadata.ClientInfo{ + ServiceName: ServiceName, + ServiceID: ServiceID, + SigningName: signingName, + SigningRegion: signingRegion, + PartitionID: partitionID, + Endpoint: endpoint, + APIVersion: "2019-06-10", + ResolvedRegion: resolvedRegion, + }, + handlers, + ), + } + + // Handlers + svc.Handlers.Sign.PushBackNamed(v4.SignRequestHandler) + svc.Handlers.Build.PushBackNamed(restjson.BuildHandler) + svc.Handlers.Unmarshal.PushBackNamed(restjson.UnmarshalHandler) + svc.Handlers.UnmarshalMeta.PushBackNamed(restjson.UnmarshalMetaHandler) + svc.Handlers.UnmarshalError.PushBackNamed( + protocol.NewUnmarshalErrorHandler(restjson.NewUnmarshalTypedError(exceptionFromCode)).NamedHandler(), + ) + + // Run custom client initialization if present + if initClient != nil { + initClient(svc.Client) + } + + return svc +} + +// newRequest creates a new request for a SSOOIDC operation and runs any +// custom request initialization. +func (c *SSOOIDC) newRequest(op *request.Operation, params, data interface{}) *request.Request { + req := c.NewRequest(op, params, data) + + // Run custom request initialization if present + if initRequest != nil { + initRequest(req) + } + + return req +} diff --git a/vendor/github.com/aws/aws-sdk-go/service/sts/api.go b/vendor/github.com/aws/aws-sdk-go/service/sts/api.go index c0706bec93..11af63b4d8 100644 --- a/vendor/github.com/aws/aws-sdk-go/service/sts/api.go +++ b/vendor/github.com/aws/aws-sdk-go/service/sts/api.go @@ -56,12 +56,11 @@ func (c *STS) AssumeRoleRequest(input *AssumeRoleInput) (req *request.Request, o // AssumeRole API operation for AWS Security Token Service. // // Returns a set of temporary security credentials that you can use to access -// Amazon Web Services resources that you might not normally have access to. -// These temporary credentials consist of an access key ID, a secret access -// key, and a security token. Typically, you use AssumeRole within your account -// or for cross-account access. For a comparison of AssumeRole with other API -// operations that produce temporary credentials, see Requesting Temporary Security -// Credentials (https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp_request.html) +// Amazon Web Services resources. These temporary credentials consist of an +// access key ID, a secret access key, and a security token. Typically, you +// use AssumeRole within your account or for cross-account access. For a comparison +// of AssumeRole with other API operations that produce temporary credentials, +// see Requesting Temporary Security Credentials (https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp_request.html) // and Comparing the Amazon Web Services STS API operations (https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp_request.html#stsapi_comparison) // in the IAM User Guide. // @@ -86,9 +85,9 @@ func (c *STS) AssumeRoleRequest(input *AssumeRoleInput) (req *request.Request, o // assumed. For more information, see Session Policies (https://docs.aws.amazon.com/IAM/latest/UserGuide/access_policies.html#policies_session) // in the IAM User Guide. // -// When you create a role, you create two policies: A role trust policy that -// specifies who can assume the role and a permissions policy that specifies -// what can be done with the role. You specify the trusted principal who is +// When you create a role, you create two policies: a role trust policy that +// specifies who can assume the role, and a permissions policy that specifies +// what can be done with the role. You specify the trusted principal that is // allowed to assume the role in the role trust policy. // // To assume a role from a different account, your Amazon Web Services account @@ -97,9 +96,9 @@ func (c *STS) AssumeRoleRequest(input *AssumeRoleInput) (req *request.Request, o // are allowed to delegate that access to users in the account. // // A user who wants to access a role in a different account must also have permissions -// that are delegated from the user account administrator. The administrator -// must attach a policy that allows the user to call AssumeRole for the ARN -// of the role in the other account. +// that are delegated from the account administrator. The administrator must +// attach a policy that allows the user to call AssumeRole for the ARN of the +// role in the other account. // // To allow a user to assume a role in the same account, you can do either of // the following: @@ -518,10 +517,8 @@ func (c *STS) AssumeRoleWithWebIdentityRequest(input *AssumeRoleWithWebIdentityI // a user. You can also supply the user with a consistent identity throughout // the lifetime of an application. // -// To learn more about Amazon Cognito, see Amazon Cognito Overview (https://docs.aws.amazon.com/mobile/sdkforandroid/developerguide/cognito-auth.html#d0e840) -// in Amazon Web Services SDK for Android Developer Guide and Amazon Cognito -// Overview (https://docs.aws.amazon.com/mobile/sdkforios/developerguide/cognito-auth.html#d0e664) -// in the Amazon Web Services SDK for iOS Developer Guide. +// To learn more about Amazon Cognito, see Amazon Cognito identity pools (https://docs.aws.amazon.com/cognito/latest/developerguide/cognito-identity.html) +// in Amazon Cognito Developer Guide. // // Calling AssumeRoleWithWebIdentity does not require the use of Amazon Web // Services security credentials. Therefore, you can distribute an application @@ -985,11 +982,11 @@ func (c *STS) GetCallerIdentityRequest(input *GetCallerIdentityInput) (req *requ // call the operation. // // No permissions are required to perform this operation. If an administrator -// adds a policy to your IAM user or role that explicitly denies access to the -// sts:GetCallerIdentity action, you can still perform this operation. Permissions -// are not required because the same information is returned when an IAM user -// or role is denied access. To view an example response, see I Am Not Authorized -// to Perform: iam:DeleteVirtualMFADevice (https://docs.aws.amazon.com/IAM/latest/UserGuide/troubleshoot_general.html#troubleshoot_general_access-denied-delete-mfa) +// attaches a policy to your identity that explicitly denies access to the sts:GetCallerIdentity +// action, you can still perform this operation. Permissions are not required +// because the same information is returned when access is denied. To view an +// example response, see I Am Not Authorized to Perform: iam:DeleteVirtualMFADevice +// (https://docs.aws.amazon.com/IAM/latest/UserGuide/troubleshoot_general.html#troubleshoot_general_access-denied-delete-mfa) // in the IAM User Guide. // // Returns awserr.Error for service API and SDK errors. Use runtime type assertions @@ -1064,18 +1061,26 @@ func (c *STS) GetFederationTokenRequest(input *GetFederationTokenInput) (req *re // GetFederationToken API operation for AWS Security Token Service. // // Returns a set of temporary security credentials (consisting of an access -// key ID, a secret access key, and a security token) for a federated user. -// A typical use is in a proxy application that gets temporary security credentials -// on behalf of distributed applications inside a corporate network. You must -// call the GetFederationToken operation using the long-term security credentials -// of an IAM user. As a result, this call is appropriate in contexts where those -// credentials can be safely stored, usually in a server-based application. +// key ID, a secret access key, and a security token) for a user. A typical +// use is in a proxy application that gets temporary security credentials on +// behalf of distributed applications inside a corporate network. +// +// You must call the GetFederationToken operation using the long-term security +// credentials of an IAM user. As a result, this call is appropriate in contexts +// where those credentials can be safeguarded, usually in a server-based application. // For a comparison of GetFederationToken with the other API operations that // produce temporary credentials, see Requesting Temporary Security Credentials // (https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp_request.html) // and Comparing the Amazon Web Services STS API operations (https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp_request.html#stsapi_comparison) // in the IAM User Guide. // +// Although it is possible to call GetFederationToken using the security credentials +// of an Amazon Web Services account root user rather than an IAM user that +// you create for the purpose of a proxy application, we do not recommend it. +// For more information, see Safeguard your root user credentials and don't +// use them for everyday tasks (https://docs.aws.amazon.com/IAM/latest/UserGuide/best-practices.html#lock-away-credentials) +// in the IAM User Guide. +// // You can create a mobile-based or browser-based app that can authenticate // users using a web identity provider like Login with Amazon, Facebook, Google, // or an OpenID Connect-compatible identity provider. In this case, we recommend @@ -1084,32 +1089,26 @@ func (c *STS) GetFederationTokenRequest(input *GetFederationTokenInput) (req *re // (https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp_request.html#api_assumerolewithwebidentity) // in the IAM User Guide. // -// You can also call GetFederationToken using the security credentials of an -// Amazon Web Services account root user, but we do not recommend it. Instead, -// we recommend that you create an IAM user for the purpose of the proxy application. -// Then attach a policy to the IAM user that limits federated users to only -// the actions and resources that they need to access. For more information, -// see IAM Best Practices (https://docs.aws.amazon.com/IAM/latest/UserGuide/best-practices.html) -// in the IAM User Guide. -// // # Session duration // // The temporary credentials are valid for the specified duration, from 900 // seconds (15 minutes) up to a maximum of 129,600 seconds (36 hours). The default // session duration is 43,200 seconds (12 hours). Temporary credentials obtained -// by using the Amazon Web Services account root user credentials have a maximum -// duration of 3,600 seconds (1 hour). +// by using the root user credentials have a maximum duration of 3,600 seconds +// (1 hour). // // # Permissions // // You can use the temporary credentials created by GetFederationToken in any -// Amazon Web Services service except the following: +// Amazon Web Services service with the following exceptions: // // - You cannot call any IAM operations using the CLI or the Amazon Web Services -// API. +// API. This limitation does not apply to console sessions. // // - You cannot call any STS operations except GetCallerIdentity. // +// You can use temporary credentials for single sign-on (SSO) to the console. +// // You must pass an inline or managed session policy (https://docs.aws.amazon.com/IAM/latest/UserGuide/access_policies.html#policies_session) // to this operation. You can pass a single JSON policy document to use as an // inline session policy. You can also specify up to 10 managed policy Amazon @@ -1266,12 +1265,13 @@ func (c *STS) GetSessionTokenRequest(input *GetSessionTokenInput) (req *request. // or IAM user. The credentials consist of an access key ID, a secret access // key, and a security token. Typically, you use GetSessionToken if you want // to use MFA to protect programmatic calls to specific Amazon Web Services -// API operations like Amazon EC2 StopInstances. MFA-enabled IAM users would -// need to call GetSessionToken and submit an MFA code that is associated with -// their MFA device. Using the temporary security credentials that are returned -// from the call, IAM users can then make programmatic calls to API operations -// that require MFA authentication. If you do not supply a correct MFA code, -// then the API returns an access denied error. For a comparison of GetSessionToken +// API operations like Amazon EC2 StopInstances. +// +// MFA-enabled IAM users must call GetSessionToken and submit an MFA code that +// is associated with their MFA device. Using the temporary security credentials +// that the call returns, IAM users can then make programmatic calls to API +// operations that require MFA authentication. An incorrect MFA code causes +// the API to return an access denied error. For a comparison of GetSessionToken // with the other API operations that produce temporary credentials, see Requesting // Temporary Security Credentials (https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp_request.html) // and Comparing the Amazon Web Services STS API operations (https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp_request.html#stsapi_comparison) @@ -1286,13 +1286,12 @@ func (c *STS) GetSessionTokenRequest(input *GetSessionTokenInput) (req *request. // # Session Duration // // The GetSessionToken operation must be called by using the long-term Amazon -// Web Services security credentials of the Amazon Web Services account root -// user or an IAM user. Credentials that are created by IAM users are valid -// for the duration that you specify. This duration can range from 900 seconds -// (15 minutes) up to a maximum of 129,600 seconds (36 hours), with a default -// of 43,200 seconds (12 hours). Credentials based on account credentials can -// range from 900 seconds (15 minutes) up to 3,600 seconds (1 hour), with a -// default of 1 hour. +// Web Services security credentials of an IAM user. Credentials that are created +// by IAM users are valid for the duration that you specify. This duration can +// range from 900 seconds (15 minutes) up to a maximum of 129,600 seconds (36 +// hours), with a default of 43,200 seconds (12 hours). Credentials based on +// account credentials can range from 900 seconds (15 minutes) up to 3,600 seconds +// (1 hour), with a default of 1 hour. // // # Permissions // @@ -1304,20 +1303,20 @@ func (c *STS) GetSessionTokenRequest(input *GetSessionTokenInput) (req *request. // // - You cannot call any STS API except AssumeRole or GetCallerIdentity. // -// We recommend that you do not call GetSessionToken with Amazon Web Services -// account root user credentials. Instead, follow our best practices (https://docs.aws.amazon.com/IAM/latest/UserGuide/best-practices.html#create-iam-users) -// by creating one or more IAM users, giving them the necessary permissions, -// and using IAM users for everyday interaction with Amazon Web Services. +// The credentials that GetSessionToken returns are based on permissions associated +// with the IAM user whose credentials were used to call the operation. The +// temporary credentials have the same permissions as the IAM user. // -// The credentials that are returned by GetSessionToken are based on permissions -// associated with the user whose credentials were used to call the operation. -// If GetSessionToken is called using Amazon Web Services account root user -// credentials, the temporary credentials have root user permissions. Similarly, -// if GetSessionToken is called using the credentials of an IAM user, the temporary -// credentials have the same permissions as the IAM user. +// Although it is possible to call GetSessionToken using the security credentials +// of an Amazon Web Services account root user rather than an IAM user, we do +// not recommend it. If GetSessionToken is called using root user credentials, +// the temporary credentials have root user permissions. For more information, +// see Safeguard your root user credentials and don't use them for everyday +// tasks (https://docs.aws.amazon.com/IAM/latest/UserGuide/best-practices.html#lock-away-credentials) +// in the IAM User Guide // // For more information about using GetSessionToken to create temporary credentials, -// go to Temporary Credentials for Users in Untrusted Environments (https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp_request.html#api_getsessiontoken) +// see Temporary Credentials for Users in Untrusted Environments (https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp_request.html#api_getsessiontoken) // in the IAM User Guide. // // Returns awserr.Error for service API and SDK errors. Use runtime type assertions @@ -1461,6 +1460,9 @@ type AssumeRoleInput struct { // in the IAM User Guide. PolicyArns []*PolicyDescriptorType `type:"list"` + // Reserved for future use. + ProvidedContexts []*ProvidedContext `type:"list"` + // The Amazon Resource Name (ARN) of the role to assume. // // RoleArn is a required field @@ -1634,6 +1636,16 @@ func (s *AssumeRoleInput) Validate() error { } } } + if s.ProvidedContexts != nil { + for i, v := range s.ProvidedContexts { + if v == nil { + continue + } + if err := v.Validate(); err != nil { + invalidParams.AddNested(fmt.Sprintf("%s[%v]", "ProvidedContexts", i), err.(request.ErrInvalidParams)) + } + } + } if s.Tags != nil { for i, v := range s.Tags { if v == nil { @@ -1675,6 +1687,12 @@ func (s *AssumeRoleInput) SetPolicyArns(v []*PolicyDescriptorType) *AssumeRoleIn return s } +// SetProvidedContexts sets the ProvidedContexts field's value. +func (s *AssumeRoleInput) SetProvidedContexts(v []*ProvidedContext) *AssumeRoleInput { + s.ProvidedContexts = v + return s +} + // SetRoleArn sets the RoleArn field's value. func (s *AssumeRoleInput) SetRoleArn(v string) *AssumeRoleInput { s.RoleArn = &v @@ -1899,8 +1917,12 @@ type AssumeRoleWithSAMLInput struct { // For more information, see Configuring a Relying Party and Adding Claims (https://docs.aws.amazon.com/IAM/latest/UserGuide/create-role-saml-IdP-tasks.html) // in the IAM User Guide. // + // SAMLAssertion is a sensitive parameter and its value will be + // replaced with "sensitive" in string returned by AssumeRoleWithSAMLInput's + // String and GoString methods. + // // SAMLAssertion is a required field - SAMLAssertion *string `min:"4" type:"string" required:"true"` + SAMLAssertion *string `min:"4" type:"string" required:"true" sensitive:"true"` } // String returns the string representation. @@ -2035,7 +2057,7 @@ type AssumeRoleWithSAMLOutput struct { // IAM. // // The combination of NameQualifier and Subject can be used to uniquely identify - // a federated user. + // a user. // // The following pseudocode shows how the hash value is calculated: // @@ -2263,10 +2285,15 @@ type AssumeRoleWithWebIdentityInput struct { // The OAuth 2.0 access token or OpenID Connect ID token that is provided by // the identity provider. Your application must get this token by authenticating // the user who is using your application with a web identity provider before - // the application makes an AssumeRoleWithWebIdentity call. + // the application makes an AssumeRoleWithWebIdentity call. Only tokens with + // RSA algorithms (RS256) are supported. + // + // WebIdentityToken is a sensitive parameter and its value will be + // replaced with "sensitive" in string returned by AssumeRoleWithWebIdentityInput's + // String and GoString methods. // // WebIdentityToken is a required field - WebIdentityToken *string `min:"4" type:"string" required:"true"` + WebIdentityToken *string `min:"4" type:"string" required:"true" sensitive:"true"` } // String returns the string representation. @@ -2572,8 +2599,12 @@ type Credentials struct { // The secret access key that can be used to sign requests. // + // SecretAccessKey is a sensitive parameter and its value will be + // replaced with "sensitive" in string returned by Credentials's + // String and GoString methods. + // // SecretAccessKey is a required field - SecretAccessKey *string `type:"string" required:"true"` + SecretAccessKey *string `type:"string" required:"true" sensitive:"true"` // The token that users must pass to the service API to use the temporary credentials. // @@ -2921,10 +2952,9 @@ type GetFederationTokenInput struct { // The duration, in seconds, that the session should last. Acceptable durations // for federation sessions range from 900 seconds (15 minutes) to 129,600 seconds // (36 hours), with 43,200 seconds (12 hours) as the default. Sessions obtained - // using Amazon Web Services account root user credentials are restricted to - // a maximum of 3,600 seconds (one hour). If the specified duration is longer - // than one hour, the session obtained by using root user credentials defaults - // to one hour. + // using root user credentials are restricted to a maximum of 3,600 seconds + // (one hour). If the specified duration is longer than one hour, the session + // obtained by using root user credentials defaults to one hour. DurationSeconds *int64 `min:"900" type:"integer"` // The name of the federated user. The name is used as an identifier for the @@ -3375,6 +3405,63 @@ func (s *PolicyDescriptorType) SetArn(v string) *PolicyDescriptorType { return s } +// Reserved for future use. +type ProvidedContext struct { + _ struct{} `type:"structure"` + + // Reserved for future use. + ContextAssertion *string `min:"4" type:"string"` + + // Reserved for future use. + ProviderArn *string `min:"20" type:"string"` +} + +// String returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s ProvidedContext) String() string { + return awsutil.Prettify(s) +} + +// GoString returns the string representation. +// +// API parameter values that are decorated as "sensitive" in the API will not +// be included in the string output. The member name will be present, but the +// value will be replaced with "sensitive". +func (s ProvidedContext) GoString() string { + return s.String() +} + +// Validate inspects the fields of the type to determine if they are valid. +func (s *ProvidedContext) Validate() error { + invalidParams := request.ErrInvalidParams{Context: "ProvidedContext"} + if s.ContextAssertion != nil && len(*s.ContextAssertion) < 4 { + invalidParams.Add(request.NewErrParamMinLen("ContextAssertion", 4)) + } + if s.ProviderArn != nil && len(*s.ProviderArn) < 20 { + invalidParams.Add(request.NewErrParamMinLen("ProviderArn", 20)) + } + + if invalidParams.Len() > 0 { + return invalidParams + } + return nil +} + +// SetContextAssertion sets the ContextAssertion field's value. +func (s *ProvidedContext) SetContextAssertion(v string) *ProvidedContext { + s.ContextAssertion = &v + return s +} + +// SetProviderArn sets the ProviderArn field's value. +func (s *ProvidedContext) SetProviderArn(v string) *ProvidedContext { + s.ProviderArn = &v + return s +} + // You can pass custom key-value pair attributes when you assume a role or federate // a user. These are called session tags. You can then use the session tags // to control access to resources. For more information, see Tagging Amazon diff --git a/vendor/github.com/aws/aws-sdk-go/service/sts/doc.go b/vendor/github.com/aws/aws-sdk-go/service/sts/doc.go index c40f5a2a52..ea1d9eb0cc 100644 --- a/vendor/github.com/aws/aws-sdk-go/service/sts/doc.go +++ b/vendor/github.com/aws/aws-sdk-go/service/sts/doc.go @@ -4,10 +4,9 @@ // requests to AWS Security Token Service. // // Security Token Service (STS) enables you to request temporary, limited-privilege -// credentials for Identity and Access Management (IAM) users or for users that -// you authenticate (federated users). This guide provides descriptions of the -// STS API. For more information about using this service, see Temporary Security -// Credentials (https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp.html). +// credentials for users. This guide provides descriptions of the STS API. For +// more information about using this service, see Temporary Security Credentials +// (https://docs.aws.amazon.com/IAM/latest/UserGuide/id_credentials_temp.html). // // See https://docs.aws.amazon.com/goto/WebAPI/sts-2011-06-15 for more information on this service. // diff --git a/vendor/github.com/efficientgo/core/backoff/backoff.go b/vendor/github.com/efficientgo/core/backoff/backoff.go index af70914f5d..edd00ab27f 100644 --- a/vendor/github.com/efficientgo/core/backoff/backoff.go +++ b/vendor/github.com/efficientgo/core/backoff/backoff.go @@ -3,6 +3,8 @@ // Initially copied from Cortex project. +// Package backoff implements backoff timers which increases wait time on every retry, incredibly useful +// in distributed system timeout functionalities. package backoff import ( diff --git a/vendor/github.com/efficientgo/core/errcapture/doc.go b/vendor/github.com/efficientgo/core/errcapture/doc.go index 96c1c22918..ab7f2ed82b 100644 --- a/vendor/github.com/efficientgo/core/errcapture/doc.go +++ b/vendor/github.com/efficientgo/core/errcapture/doc.go @@ -1,29 +1,43 @@ // Copyright (c) The EfficientGo Authors. // Licensed under the Apache License 2.0. -package errcapture - +// Package errcapture implements robust error handling in defer statements using provided return argument. +// // Close a `io.Closer` interface or execute any function that returns error safely while capturing error. // It's often forgotten but it's a caller responsibility to close all implementations of `Closer`, // such as *os.File or io.ReaderCloser. Commonly we would use: // -// defer closer.Close() +// defer closer.Close() // // This is wrong. Close() usually return important error (e.g for os.File the actual file flush might happen and fail on `Close` method). // It's very important to *always* check error. `errcapture` provides utility functions to capture error and add to provided one, // still allowing to put them in a convenient `defer` statement: // -// func <...>(...) (err error) { -// ... -// defer errcapture.Do(&err, closer.Close, "log format message") +// func <...>(...) (err error) { +// ... +// defer errcapture.Do(&err, closer.Close, "log format message") // -// ... -// } +// ... +// } // // If Close returns error, `errcapture.Do` will capture it, add to input error if not nil and return by argument. // +// Example: +// +// func DoAndClose(f *os.File) (err error) { +// defer errcapture.Do(&err, f.Close, "close file at the end") +// +// // Do something... +// if err := do(); err != nil { +// return err +// } +// +// return nil +// } +// // The errcapture.ExhaustClose function provide the same functionality but takes an io.ReadCloser and exhausts the whole // reader before closing. This is useful when trying to use http keep-alive connections because for the same connection // to be re-used the whole response body needs to be exhausted. // // Check https://pkg.go.dev/github.com/efficientgo/tools/pkg/logerrcapture if you want to just log an error instead. +package errcapture diff --git a/vendor/github.com/efficientgo/core/errors/doc.go b/vendor/github.com/efficientgo/core/errors/doc.go index 881fea02f9..c489b2e2f2 100644 --- a/vendor/github.com/efficientgo/core/errors/doc.go +++ b/vendor/github.com/efficientgo/core/errors/doc.go @@ -6,9 +6,8 @@ // Copyright (c) The Thanos Authors. // Licensed under the Apache License 2.0. -package errors - // Package errors provides basic utilities to manipulate errors with a useful stacktrace. It combines the // benefits of errors.New and fmt.Errorf world into a single package. It is an improved and minimal version of the popular // https://github.com/pkg/errors (archived) package allowing reliable wrapping of errors with stacktrace. Unfortunately, // the standard library recommended error wrapping using `%+w` is prone to errors and does not support stacktraces. +package errors diff --git a/vendor/github.com/efficientgo/core/merrors/doc.go b/vendor/github.com/efficientgo/core/merrors/doc.go index 250992e812..a670493f46 100644 --- a/vendor/github.com/efficientgo/core/merrors/doc.go +++ b/vendor/github.com/efficientgo/core/merrors/doc.go @@ -1,21 +1,29 @@ // Copyright (c) The EfficientGo Authors. // Licensed under the Apache License 2.0. -package merrors - -// Safe multi error implementation that chains errors on the same level. +// Package merrors implements multi error implementation that chains errors on the same level. // Supports errors.As and errors.Is functions. // // Example 1: // -// return merrors.New(err1, err2).Err() +// return merrors.New(err1, err2).Err() // // Example 2: // -// merr := merrors.New(err1) -// merr.Add(err2, errOrNil3) -// for _, err := range errs { -// merr.Add(err) -// } -// return merr.Err() +// merr := merrors.New(err1) +// merr.Add(err2, errOrNil3) +// for _, err := range errs { +// merr.Add(err) +// } +// return merr.Err() // +// Example 3: +// +// func CloseAll(closers []io.Closer) error { +// errs := merrors.New() +// for _ , c := range closers { +// errs.Add(c.Close()) +// } +// return errs.Err() +// } +package merrors diff --git a/vendor/github.com/efficientgo/e2e/Makefile b/vendor/github.com/efficientgo/e2e/Makefile index f588b35100..89e137e597 100644 --- a/vendor/github.com/efficientgo/e2e/Makefile +++ b/vendor/github.com/efficientgo/e2e/Makefile @@ -13,6 +13,8 @@ GIT ?= $(shell which git) # Support gsed on OSX (installed via brew), falling back to sed. On Linux # systems gsed won't be installed, so will use sed as expected. SED ?= $(shell which gsed 2>/dev/null || which sed) +# Same as above, but for xargs. +XARGS ?= $(shell which gxargs 2>/dev/null || which xargs) define require_clean_work_tree @git update-index -q --ignore-submodules --refresh @@ -119,7 +121,7 @@ lint: $(FAILLINT) $(GOLANGCI_LINT) $(MISSPELL) $(COPYRIGHT) build format docs ch cd $${dir} && $(GOLANGCI_LINT) run; \ done @echo ">> detecting misspells" - @find . -type f | grep -v vendor/ | grep -vE '\./\..*' | xargs $(MISSPELL) -error + @find . -type f | grep -v vendor/ | grep -vE '\./\..*' | $(XARGS) $(MISSPELL) -error @echo ">> ensuring Copyright headers" - @$(COPYRIGHT) $(shell go list -f "{{.Dir}}" ./... | xargs -i find "{}" -name "*.go") + @$(COPYRIGHT) $(shell go list -f "{{.Dir}}" ./... | $(XARGS) -i find "{}" -name "*.go") $(call require_clean_work_tree,"detected files without copyright - run make lint and commit changes.") diff --git a/vendor/github.com/efficientgo/e2e/README.md b/vendor/github.com/efficientgo/e2e/README.md index 8f2ef59146..f3f25960ca 100644 --- a/vendor/github.com/efficientgo/e2e/README.md +++ b/vendor/github.com/efficientgo/e2e/README.md @@ -48,7 +48,7 @@ Let's go through an example leveraging the `go test` flow: 4. Use `e2emon.AsInstrumented` if you want to be able to query your service for metrics, which is a great way to assess it's internal state in tests! For example see following Etcd definition: - ```go mdox-exec="sed -n '216,228p' db/db.go" + ```go mdox-exec="sed -n '351,363p' db/db.go" return e2emon.AsInstrumented(env.Runnable(name).WithPorts(map[string]int{AccessPortName: 2379, "metrics": 9000}).Init( e2e.StartOptions{ Image: o.image, @@ -187,6 +187,23 @@ In the profiling UI choose a profile type, filter by instances (autocompleted) a For runnables that are both instrumented and profiled you can use [`e2eobs.AsObservable`](observable/observable.go). +### Debugging flaky tests + +Sometimes tests might fail due to timing problems on highly CPU constrained systems such as GitHub actions. To facilitate fixing these issues, `e2e` supports limiting CPU time allocated to Docker containers through `E2E_DOCKER_CPUS` environment variable: + +```go mdox-exec="sed -n '285,288p' env_docker.go" + dockerCPUsEnv := os.Getenv(dockerCPUEnvName) + if dockerCPUsEnv != "" { + dockerCPUsParam = dockerCPUsEnv + } +``` + +You can set it either through command line parameters or `t.Setenv("E2E_DOCKER_CPUS", "...")`. + +Alternatively, you could pass `WithCPUs` through environment options so that some e2e test would have permanently reduced available CPU time. + +See what values you can pass to the `--cpus` flag on [Docker website](https://docs.docker.com/config/containers/resource_constraints/#configure-the-default-cfs-scheduler). + ### Troubleshooting #### Can't create docker network diff --git a/vendor/github.com/efficientgo/e2e/env.go b/vendor/github.com/efficientgo/e2e/env.go index 389294cca5..6d921bf42e 100644 --- a/vendor/github.com/efficientgo/e2e/env.go +++ b/vendor/github.com/efficientgo/e2e/env.go @@ -28,6 +28,13 @@ type environmentOptions struct { name string volumes []string + cpus string +} + +func WithCPUs(cpus string) EnvironmentOption { + return func(o *environmentOptions) { + o.cpus = cpus + } } // WithLogger tells environment to use custom logger to default one (stdout). @@ -191,10 +198,19 @@ type runnable interface { type ExecOption func(o *ExecOptions) type ExecOptions struct { + Stdin io.Reader Stdout io.Writer Stderr io.Writer } +// WithExecOptionStdin sets stdin reader to be used when exec is performed. +// By default, it is nil. +func WithExecOptionStdin(stdin io.Reader) ExecOption { + return func(o *ExecOptions) { + o.Stdin = stdin + } +} + // WithExecOptionStdout sets stdout writer to be used when exec is performed. // By default, it is streaming to the env logger. func WithExecOptionStdout(stdout io.Writer) ExecOption { diff --git a/vendor/github.com/efficientgo/e2e/env_docker.go b/vendor/github.com/efficientgo/e2e/env_docker.go index b72f3d232f..eedbe9fd83 100644 --- a/vendor/github.com/efficientgo/e2e/env_docker.go +++ b/vendor/github.com/efficientgo/e2e/env_docker.go @@ -9,6 +9,7 @@ import ( "crypto/sha256" "encoding/json" "fmt" + "net" "os" "os/exec" "path/filepath" @@ -18,12 +19,14 @@ import ( "strings" "time" + "github.com/efficientgo/e2e/host" + "github.com/efficientgo/core/backoff" "github.com/efficientgo/core/errors" ) const ( - dockerMacOSGatewayAddr = "host.docker.internal" + dockerGatewayAddr = "host.docker.internal" ) var ( @@ -41,6 +44,7 @@ type DockerEnvironment struct { hostAddr string dockerVolumes []string + cpus string registered map[string]struct{} listeners []EnvironmentListener @@ -110,6 +114,7 @@ func New(opts ...EnvironmentOption) (_ *DockerEnvironment, err error) { verbose: e.verbose, registered: map[string]struct{}{}, dockerVolumes: e.volumes, + cpus: e.cpus, } // Force a shutdown in order to cleanup from a spurious situation in case @@ -129,10 +134,10 @@ func New(opts ...EnvironmentOption) (_ *DockerEnvironment, err error) { return nil, errors.Wrapf(err, "create docker network '%s'", d.networkName) } - switch runtime.GOOS { - case "darwin": - d.hostAddr = dockerMacOSGatewayAddr - default: + switch host.OSPlatform() { + case "darwin", "WSL2": + d.hostAddr = dockerGatewayAddr + default: // the "linux" behavior is default out, err := d.exec("docker", "network", "inspect", d.networkName).CombinedOutput() if err != nil { e.logger.Log(string(out)) @@ -266,12 +271,28 @@ func (e *DockerEnvironment) SharedDir() string { return e.dir } +const dockerCPUEnvName = "E2E_DOCKER_CPUS" + func (e *DockerEnvironment) buildDockerRunArgs(name string, ports map[string]int, opts StartOptions) []string { args := []string{"--rm", "--net=" + e.networkName, "--name=" + dockerNetworkContainerHost(e.networkName, name), "--hostname=" + name} // Mount the docker env working directory into the container. It's shared across all containers to allow easier scenarios. args = append(args, "-v", fmt.Sprintf("%s:%s:z", e.dir, e.dir)) + // Allow reducing available CPU Time via environment variables or + // environment parameters. The latter takes precedence. + dockerCPUsParam := "" + dockerCPUsEnv := os.Getenv(dockerCPUEnvName) + if dockerCPUsEnv != "" { + dockerCPUsParam = dockerCPUsEnv + } + if e.cpus != "" { + dockerCPUsParam = e.cpus + } + if dockerCPUsParam != "" { + args = append(args, "--cpus", dockerCPUsParam) + } + for _, v := range e.dockerVolumes { args = append(args, "-v", v) } @@ -521,7 +542,18 @@ func (d *dockerRunnable) Endpoint(portName string) string { } // Do not use "localhost", because it doesn't work with the AWS DynamoDB client. - return fmt.Sprintf("127.0.0.1:%d", localPort) + addr := "127.0.0.1" + // If we are running inside Docker then 127.0.0.1 is not accessible. + // To access the host's network, let's use host.docker.internal. + // See: https://docs.docker.com/desktop/networking/#i-want-to-connect-from-a-container-to-a-service-on-the-host. + if _, err := os.Stat("/.dockerenv"); err == nil { + dockerAddrs, err := net.LookupIP(dockerGatewayAddr) + if err == nil && len(dockerAddrs) > 0 { + addr = dockerGatewayAddr + } + } + + return fmt.Sprintf("%s:%d", addr, localPort) } // InternalEndpoint returns internal service endpoint (host:port) for given internal port. @@ -663,7 +695,13 @@ func (d *dockerRunnable) Exec(command Command, opts ...ExecOption) error { args := []string{"exec", d.containerName()} args = append(args, command.Cmd) args = append(args, command.Args...) + if o.Stdin != nil { + args = append(args[:1], append([]string{"-i"}, args[1:]...)...) + } cmd := d.env.exec("docker", args...) + if o.Stdin != nil { + cmd.Stdin = o.Stdin + } cmd.Stdout = o.Stdout cmd.Stderr = o.Stderr return cmd.Run() diff --git a/vendor/github.com/efficientgo/e2e/env_kind.go b/vendor/github.com/efficientgo/e2e/env_kind.go new file mode 100644 index 0000000000..f70add336e --- /dev/null +++ b/vendor/github.com/efficientgo/e2e/env_kind.go @@ -0,0 +1,826 @@ +// Copyright (c) The EfficientGo Authors. +// Licensed under the Apache License 2.0. + +package e2e + +import ( + "bytes" + "context" + "encoding/json" + "fmt" + "html/template" + "io" + "net" + "os" + "os/exec" + "path/filepath" + "regexp" + "strings" + "sync" + "time" + + "github.com/efficientgo/core/backoff" + "github.com/efficientgo/core/errors" +) + +var ( + kindNamePattern = regexp.MustCompile(`^[a-z0-9.-]+$`) + + _ Environment = &KindEnvironment{} +) + +// KindEnvironment defines single node kind cluster that allows running services. +type KindEnvironment struct { + dir string + logger Logger + clusterName string + + nodeIP net.IP + volumes []string + verbose bool + + mutex sync.Mutex + // Access to the following fields must be guarded + // by a mutex. + registered map[string]struct{} + listeners []EnvironmentListener + started []Runnable + closers []func() + closed bool +} + +func validateKindName(name string) error { + if len(name) == 0 { + return errors.New("name can't be empty") + } + if !kindNamePattern.MatchString(name) { + return errors.Newf("name can have only %v characters due to kind cluster name constraints, got: %v", kindNamePattern.String(), name) + + } + return nil +} + +func unwrapQuotes(b []byte) []byte { + return []byte(strings.Trim(string(b), "'")) +} + +var kindConfig = template.Must(template.New("config").Parse(`kind: Cluster +apiVersion: kind.x-k8s.io/v1alpha4 +nodes: +- role: control-plane + {{- with .}} + extraMounts: + {{- range .}} + - hostPath: {{.}} + containerPath: {{.}} + {{- end}} + {{- end}} +`)) + +// NewKindEnvironment creates a new, isolated kind environment. +func NewKindEnvironment(opts ...EnvironmentOption) (_ *KindEnvironment, err error) { + e := environmentOptions{} + for _, o := range opts { + o(&e) + } + if e.name == "" { + e.name, err = generateName() + if err != nil { + return nil, err + } + e.name = strings.ToLower(e.name) + } + if err := validateKindName(e.name); err != nil { + return nil, err + } + + if e.logger == nil { + e.logger = NewLogger(os.Stdout) + } + + k := &KindEnvironment{ + logger: e.logger, + clusterName: e.name, + verbose: e.verbose, + registered: map[string]struct{}{}, + volumes: e.volumes, + } + + // Force a shutdown in order to cleanup from a spurious situation in case + // the previous tests run didn't cleanup correctly. + k.close() + + dir, err := getTmpDirectory() + if err != nil { + return nil, err + } + k.dir = dir + var buf bytes.Buffer + if err := kindConfig.Execute(&buf, append([]string{k.dir}, k.volumes...)); err != nil { + k.Close() + return nil, errors.Wrap(err, "generate cluster kind configuration") + } + kindConfigPath := filepath.Join(k.dir, "kind.yaml") + if err := os.WriteFile(kindConfigPath, buf.Bytes(), 0644); err != nil { + k.Close() + return nil, errors.Wrap(err, "write cluster kind configuration") + } + + // Setup the kind cluster. + if out, err := k.exec("kind", "create", "cluster", "--kubeconfig", k.kubeconfig(), "--config", kindConfigPath, "--name", k.clusterName).CombinedOutput(); err != nil { + e.logger.Log(string(out)) + k.Close() + return nil, errors.Wrapf(err, "create kind cluster %q", k.clusterName) + } + + out, err := k.exec("kubectl", "--kubeconfig", k.kubeconfig(), "get", "nodes", fmt.Sprintf("%s-control-plane", k.clusterName), "--output", `jsonpath='{.status.addresses}'`).CombinedOutput() + if err != nil { + e.logger.Log(string(out)) + k.Close() + return nil, errors.Wrapf(err, "get details of kind cluster node '%s-control-plane'", k.clusterName) + } + + type address struct { + Address string + Type string + } + var addresses []address + out = unwrapQuotes(out) + if err := json.Unmarshal(out, &addresses); err != nil { + e.logger.Log("my string without quotes") + e.logger.Log(len(out)) + e.logger.Log(string(out)) + k.Close() + return nil, errors.Wrap(err, "unmarshal kubectl output to get node IP") + } + + var internalIPs []address + for _, a := range addresses { + if a.Type == "InternalIP" { + internalIPs = append(internalIPs, a) + } + } + if len(internalIPs) != 1 { + k.Close() + return nil, errors.Newf("unexpected output of kubectl get node; expected exactly one internal IP, got %d", len(internalIPs)) + } + k.nodeIP = net.ParseIP(internalIPs[0].Address) + + return k, e.logger.Log("msg", "started kind environment", "name", k.clusterName) +} + +func (e *KindEnvironment) kubeconfig() string { return filepath.Join(e.dir, "kubeconfig") } + +func (e *KindEnvironment) HostAddr() string { return e.nodeIP.String() } +func (e *KindEnvironment) Name() string { return e.clusterName } + +func (e *KindEnvironment) AddCloser(f func()) { + defer e.mutex.Unlock() + e.mutex.Lock() + e.closers = append(e.closers, f) +} + +// Runnable returns a new RunnableBuilder for the KindEnvironment. +// Note: runnables are modeled as Kubernetes Deployments with a single replica. +// If a runnable of a different Kubernetes kind is needed, then it must be +// manually deployed using the kubeconfig in the environment's shared directory. +func (e *KindEnvironment) Runnable(name string) RunnableBuilder { + defer e.mutex.Unlock() + e.mutex.Lock() + if e.closed { + return errorer{name: name, err: errors.New("environment close was already invoked")} + } + + if e.isRegistered(name) { + return errorer{name: name, err: errors.Newf("there is already one runnable created with the same name %q", name)} + } + + r := &kindRunnable{ + env: e, + name: name, + logger: e.logger, + ports: map[string]int{}, + hostPorts: map[string]int{}, + extensions: map[any]any{}, + } + if err := os.MkdirAll(r.Dir(), 0750); err != nil { + return errorer{name: name, err: err} + } + e.register(name) + return r +} + +// AddListener registers the given listener to be notified on environment runnable changes. +func (e *KindEnvironment) AddListener(listener EnvironmentListener) { + defer e.mutex.Unlock() + e.mutex.Lock() + e.listeners = append(e.listeners, listener) +} + +func (e *KindEnvironment) isRegistered(name string) bool { + _, ok := e.registered[name] + return ok +} + +func (e *KindEnvironment) register(name string) { + e.registered[name] = struct{}{} +} + +func (e *KindEnvironment) registerStarted(r Runnable) error { + e.started = append(e.started, r) + + for _, l := range e.listeners { + if err := l.OnRunnableChange(e.started); err != nil { + return err + } + } + return nil +} + +func (e *KindEnvironment) registerStopped(name string) error { + for i, r := range e.started { + if r.Name() == name { + e.started = append(e.started[:i], e.started[i+1:]...) + for _, l := range e.listeners { + if err := l.OnRunnableChange(e.started); err != nil { + return err + } + } + return nil + } + } + return nil +} + +func (e *KindEnvironment) SharedDir() string { + return e.dir +} + +func (e *KindEnvironment) buildManifest(name string, ports map[string]int, opts StartOptions) (io.Reader, error) { + values := kindManifestValues{ + Name: name, + Image: opts.Image, + Command: opts.Command.Cmd, + Args: opts.Command.Args, + Ports: ports, + Envs: opts.EnvVars, + Bytes: opts.LimitMemoryBytes, + CPUs: opts.LimitCPUs, + Privileged: opts.Privileged, + Capabilities: opts.Capabilities, + Volumes: map[string]string{ + // Mount the working directory into the container. It's shared across all containers to allow easier scenarios. + "working-directory": e.dir, + }, + User: opts.User, + UserNs: opts.UserNs, + } + for i, v := range e.volumes { + values.Volumes[fmt.Sprintf("volume%d", i)] = v + } + for i, v := range opts.Volumes { + values.Volumes[fmt.Sprintf("volume%d", i+len(e.volumes))] = v + } + var buf bytes.Buffer + if err := kindManifest.Execute(&buf, values); err != nil { + return nil, err + } + return &buf, nil +} + +var kindManifest = template.Must(template.New("manifest").Parse(`apiVersion: apps/v1 +kind: Deployment +metadata: + labels: + app.kubernetes.io/name: "{{.Name}}" + name: "{{.Name}}" +spec: + selector: + matchLabels: + app.kubernetes.io/name: "{{.Name}}" + template: + metadata: + labels: + app.kubernetes.io/name: "{{.Name}}" + spec: + containers: + - name: "{{.Name}}" + image: "{{.Image}}" + {{- with .Command}} + command: + - "{{.}}" + {{- end}} + {{- with .Args}} + args: + {{- range .}} + - "{{.}}" + {{- end}} + {{- end}} + {{- with .Ports}} + ports: + {{- range $k, $v := .}} + - name: "{{$k}}" + containerPort: {{$v}} + {{- end}} + {{- end}} + {{- with .Envs}} + env: + {{- range $k, $v := .}} + - name: "{{$k}}" + value: "{{$v}}" + {{- end}} + {{- end}} + {{- if or .Bytes .CPUs}} + resources: + limits: + {{- with .Bytes}} + memory: {{.}} + {{- end}} + {{- with .CPUs}} + cpu: {{.}} + {{- end}} + requests: + {{- with .Bytes}} + memory: {{.}} + {{- end}} + {{- with .CPUs}} + cpu: {{.}} + {{- end}} + {{- end}} + {{- if or .Privileged .Capabilities .User}} + securityContext: + {{- with .User}} + runAsUser: {{.}} + {{- end}} + {{- if .Privileged}} + privileged: true + {{- end}} + {{- with .Capabilities}} + capabilities: + add: + {{- range .}} + - {{.}} + {{- end}} + {{- end}} + {{- end}} + {{- with .Volumes}} + volumeMounts: + {{- range $k, $v := .}} + - name: "{{$k}}" + mountPath: {{$v}} + {{- end}} + {{- end}} + {{- with .Volumes}} + volumes: + {{- range $k, $v := .}} + - name: "{{$k}}" + hostPath: + path: {{$v}} + {{- end}} + {{- end}} +{{- if .Ports}} +--- +apiVersion: v1 +kind: Service +metadata: + labels: + app.kubernetes.io/name: "{{.Name}}" + name: "{{.Name}}" +spec: + type: NodePort + selector: + app.kubernetes.io/name: "{{.Name}}" + {{- with .Ports}} + ports: + {{- range $k, $v := .}} + - name: "{{$k}}" + port: {{$v}} + {{- end}} + {{- end}} +{{- end}} +`)) + +type kindManifestValues struct { + Name string + Image string + Command string + Args []string + Ports map[string]int + Envs map[string]string + Bytes uint + CPUs float64 + Privileged bool + Capabilities []RunnableCapabilities + Volumes map[string]string + User string + UserNs string +} + +func (e *KindEnvironment) Close() { + defer e.mutex.Unlock() + e.mutex.Lock() + for _, c := range e.closers { + c() + } + e.close() + e.closed = true +} + +func (e *KindEnvironment) exec(cmd string, args ...string) *exec.Cmd { + return e.execContext(context.Background(), cmd, args...) +} + +func (e *KindEnvironment) execContext(ctx context.Context, cmd string, args ...string) *exec.Cmd { + c := NewCommand(cmd, args...) + if e.verbose { + e.logger.Log("kindEnv:", c.toString()) + } + return c.exec(ctx) +} + +func (e *KindEnvironment) close() { + if e == nil || e.closed { + return + } + + // Teardown the kind cluter. + // Kind is idempotent and doesn't care if the cluster doesn't exist, it won't throw an error. + if out, err := e.exec("kind", "delete", "cluster", "--name", e.clusterName).CombinedOutput(); err != nil { + e.logger.Log(string(out)) + e.logger.Log("Unable to delete kind cluster", e.clusterName, ":", err.Error()) + } + + if e.dir != "" { + if err := e.exec("chmod", "-R", "777", e.dir).Run(); err != nil { + e.logger.Log("Error while chmod sharedDir", e.dir, "err:", err) + } + if err := os.RemoveAll(e.dir); err != nil { + e.logger.Log("Error while removing sharedDir", e.dir, "err:", err) + } + } +} + +type kindRunnable struct { + env *KindEnvironment + name string + logger Logger + + mutex sync.Mutex + // Access to the following fields must be guarded + // by a mutex. + ports map[string]int + opts StartOptions + running bool + hostPorts map[string]int + extensions map[any]any + waitBackoffReady *backoff.Backoff +} + +func (r *kindRunnable) Name() string { + return r.name +} + +func (r *kindRunnable) BuildErr() error { + return nil +} + +func (r *kindRunnable) Dir() string { + return filepath.Join(r.env.SharedDir(), "data", r.Name()) +} + +func (r *kindRunnable) InternalDir() string { + return r.Dir() +} + +func (r *kindRunnable) Init(opts StartOptions) Runnable { + defer r.mutex.Unlock() + r.mutex.Lock() + + if opts.WaitReadyBackoff == nil { + opts.WaitReadyBackoff = &backoff.Config{ + Min: 300 * time.Millisecond, + Max: 600 * time.Millisecond, + MaxRetries: 50, // Sometimes the CI is slow ¯\_(ツ)_/¯. + } + } + + r.opts = opts + r.waitBackoffReady = backoff.New(context.Background(), *opts.WaitReadyBackoff) + return r +} + +func (r *kindRunnable) WithPorts(ports map[string]int) RunnableBuilder { + defer r.mutex.Unlock() + r.mutex.Lock() + + r.ports = ports + return r +} + +func (r *kindRunnable) SetMetadata(key, value any) { + defer r.mutex.Unlock() + r.mutex.Lock() + + r.extensions[key] = value +} + +func (r *kindRunnable) GetMetadata(key any) (any, bool) { + defer r.mutex.Unlock() + r.mutex.Lock() + + v, ok := r.extensions[key] + return v, ok +} + +func (r *kindRunnable) Future() FutureRunnable { + return r +} + +func (r *kindRunnable) IsRunning() bool { + defer r.mutex.Unlock() + r.mutex.Lock() + + return r.running +} + +// Start starts the runnable. +func (r *kindRunnable) Start() (err error) { + if r.IsRunning() { + return errors.Newf("%q is running; stop or kill it first to restart", r.Name()) + } + + r.logger.Log("Starting", r.Name()) + + // In case of any error, if the container was already created, we + // have to cleanup removing it. + defer func() { + if err != nil { + if out, err := r.env.exec("kubernetes", "delete", "deployment", r.Name(), "--ignore-not-found", "--grace-period", "0", "--force").CombinedOutput(); err != nil { + r.logger.Log(string(out)) + return + } + if out, err := r.env.exec("kubernetes", "delete", "service", r.Name(), "--ignore-not-found", "--grace-period", "0", "--force").CombinedOutput(); err != nil { + r.logger.Log(string(out)) + return + } + } + }() + + // Make sure the image is available locally; if not wait for it to download. + if err := r.prePullImage(context.TODO()); err != nil { + return err + } + + defer r.mutex.Unlock() + r.mutex.Lock() + manifest, err := r.env.buildManifest(r.name, r.ports, r.opts) + if err != nil { + return errors.Wrap(err, "building manifest") + } + cmd := r.env.exec("kubectl", "--kubeconfig", r.env.kubeconfig(), "apply", "--filename", "-") + l := &LinePrefixLogger{prefix: r.Name() + ": ", logger: r.logger} + cmd.Stdout = l + cmd.Stderr = l + cmd.Stdin = manifest + if err := cmd.Start(); err != nil { + return err + } + r.running = true + + // Wait until the container has been started. + if err := r.waitForRunning(); err != nil { + return err + } + + if err := r.env.registerStarted(r); err != nil { + return err + } + + if len(r.ports) > 0 { + // Get the dynamic local ports mapped to the container. + out, err := r.env.exec("kubectl", "--kubeconfig", r.env.kubeconfig(), "get", "service", r.Name(), "--output", `jsonpath='{.spec.ports}'`).CombinedOutput() + if err != nil { + return errors.Wrapf(err, "unable to get mapping for ports for service %q; output: %q", r.Name(), out) + } + var ports []struct { + Name string + NodePort int + } + out = unwrapQuotes(out) + if err := json.Unmarshal(out, &ports); err != nil { + return errors.Wrap(err, "unmarshal kubectl output to get ports") + } + if len(ports) != len(r.ports) { + return errors.Newf("found inconsistent ports: the running service %q has a different number of ports than declared", r.Name()) + } + for _, port := range ports { + if _, ok := r.ports[port.Name]; !ok { + return errors.Newf("found inconsistent ports: port %q is not declared in service %q", port.Name, r.Name()) + } + r.hostPorts[port.Name] = port.NodePort + } + + r.logger.Log("Ports for container", r.Name(), ">> Local ports:", r.ports, "Ports available from host:", r.hostPorts) + } + + return nil +} + +func (r *kindRunnable) Stop() error { + if !r.IsRunning() { + return nil + } + + r.logger.Log("Stopping", r.Name()) + if out, err := r.env.exec("kubernetes", "delete", "deployment", r.Name(), "--ignore-not-found", "--grace-period", "30").CombinedOutput(); err != nil { + r.logger.Log(string(out)) + return err + } + if out, err := r.env.exec("kubernetes", "delete", "service", r.Name(), "--ignore-not-found", "--grace-period", "30").CombinedOutput(); err != nil { + r.logger.Log(string(out)) + return err + } + defer r.mutex.Unlock() + r.mutex.Lock() + r.running = false + return r.env.registerStopped(r.Name()) +} + +func (r *kindRunnable) Kill() error { + if !r.IsRunning() { + return nil + } + + r.logger.Log("Killing", r.Name()) + if out, err := r.env.exec("kubernetes", "delete", "deployment", r.Name(), "--ignore-not-found", "--grace-period", "0", "--force").CombinedOutput(); err != nil { + r.logger.Log(string(out)) + return err + } + if out, err := r.env.exec("kubernetes", "delete", "service", r.Name(), "--ignore-not-found", "--grace-period", "0", "--force").CombinedOutput(); err != nil { + r.logger.Log(string(out)) + return err + } + + defer r.mutex.Unlock() + r.mutex.Lock() + r.running = false + return r.env.registerStopped(r.Name()) +} + +// Endpoint returns the external service endpoint (host:port) for a given port name. +// External means that it will be accessible from the host. +// If the service is not running, this method returns the incorrect `stopped` endpoint. +func (r *kindRunnable) Endpoint(portName string) string { + if !r.IsRunning() { + return "stopped" + } + + defer r.mutex.Unlock() + r.mutex.Lock() + + // Map the container port to the local port. + localPort, ok := r.hostPorts[portName] + if !ok { + return "" + } + + return fmt.Sprintf("%s:%d", r.env.nodeIP, localPort) +} + +// InternalEndpoint returns the internal service endpoint (host:port) for a given internal port. +// Internal means that it will be accessible only from containers in the environment that this +// service is running in. Use `Endpoint` for host access. +func (r *kindRunnable) InternalEndpoint(portName string) string { + defer r.mutex.Unlock() + r.mutex.Lock() + + // Map the port name to the container port. + port, ok := r.ports[portName] + if !ok { + return "" + } + + return fmt.Sprintf("%s:%d", r.Name(), port) +} + +func (r *kindRunnable) Ready() error { + if !r.IsRunning() { + return errors.Newf("service %s is stopped", r.Name()) + } + + r.mutex.Lock() + readiness := r.opts.Readiness + r.mutex.Unlock() + // Ensure the service has a readiness probe configured. + if readiness == nil { + return nil + } + + return readiness.Ready(r) +} + +func (r *kindRunnable) waitForRunning() (err error) { + if !r.running { + return errors.Newf("service %s is stopped", r.Name()) + } + + var out []byte + for r.waitBackoffReady.Reset(); r.waitBackoffReady.Ongoing(); { + // Enforce a timeout on the command execution because we've seen some flaky tests + // stuck here. + + ctx, cancel := context.WithTimeout(context.Background(), 5*time.Second) + defer cancel() + out, err = r.env.execContext( + ctx, + "kubectl", + "--kubeconfig", + r.env.kubeconfig(), + "wait", + "pod", + "--for", + "condition=Ready", + "--selector", + fmt.Sprintf("app.kubernetes.io/name=%s", r.Name()), + "--timeout", + "5s", + ).CombinedOutput() + if err != nil { + r.waitBackoffReady.Wait() + continue + } + + return nil + } + + if len(out) > 0 { + r.logger.Log(string(out)) + } + return errors.Wrapf(err, "pod %q failed to start", r.Name()) +} + +// We want to pre-pull all images using Docker and then load them into the cluster. +// This ensures that the cluster will always have access to any locally built images. +func (r *kindRunnable) prePullImage(ctx context.Context) (err error) { + if r.running { + return errors.Newf("service %q is running; expected stopped", r.Name()) + } + + if _, err = r.env.execContext(ctx, "docker", "image", "inspect", r.opts.Image).CombinedOutput(); err == nil { + return nil + } + + // Assuming Error: No such image: <image>. + cmd := r.env.execContext(ctx, "docker", "pull", r.opts.Image) + l := &LinePrefixLogger{prefix: r.Name() + ": ", logger: r.logger} + cmd.Stdout = l + cmd.Stderr = l + if err = cmd.Run(); err != nil { + return errors.Wrapf(err, "docker image %q failed to download", r.opts.Image) + } + + if err := r.env.execContext(ctx, "docker", "image", "inspect", r.opts.Image).Run(); err == nil { + return errors.Wrapf(err, "load image %q into cluster", r.opts.Image) + + } + + return nil +} + +func (r *kindRunnable) WaitReady() (err error) { + if !r.IsRunning() { + return errors.Newf("service %s is stopped", r.Name()) + } + + for r.waitBackoffReady.Reset(); r.waitBackoffReady.Ongoing(); { + err = r.Ready() + if err == nil { + return nil + } + + r.waitBackoffReady.Wait() + } + return errors.Wrapf(err, "service %q is not ready", r.Name()) +} + +// Exec runs the provided command in the container specified by this +// service. +func (r *kindRunnable) Exec(command Command, opts ...ExecOption) error { + if !r.IsRunning() { + return errors.Newf("service %q is stopped", r.Name()) + } + + l := &LinePrefixLogger{prefix: r.Name() + "-exec: ", logger: r.logger} + o := ExecOptions{Stdout: l, Stderr: l} + for _, opt := range opts { + opt(&o) + } + + args := []string{"kubectl", "--kubeconfig", r.env.kubeconfig(), "exec", "deployment/" + r.name, "--"} + args = append(args, command.Cmd) + args = append(args, command.Args...) + cmd := r.env.exec(args[0], args[1:]...) + cmd.Stdout = o.Stdout + cmd.Stderr = o.Stderr + return cmd.Run() +} diff --git a/vendor/github.com/efficientgo/e2e/host/host.go b/vendor/github.com/efficientgo/e2e/host/host.go new file mode 100644 index 0000000000..6334440005 --- /dev/null +++ b/vendor/github.com/efficientgo/e2e/host/host.go @@ -0,0 +1,32 @@ +// Copyright (c) The EfficientGo Authors. +// Licensed under the Apache License 2.0. + +package host + +import ( + "bytes" + "os" + "runtime" +) + +// OSPlatform returns the host's OS platform akin to `runtime.GOOS`, with +// added awareness of Windows Subsystem for Linux (WSL) 2 environments. +// The possible values are the same as `runtime.GOOS`, plus "WSL2". +// TODO: move this to a new home, potentially github.com/efficientgo/core. +func OSPlatform() string { + if isWSL2() { + return "WSL2" + } + return runtime.GOOS +} + +func isWSL2() bool { + if runtime.GOOS != "linux" { + return false + } + version, err := os.ReadFile("/proc/version") + if err != nil { + return false + } + return bytes.Contains(version, []byte("WSL2")) +} diff --git a/vendor/github.com/efficientgo/e2e/interactive/interactive.go b/vendor/github.com/efficientgo/e2e/interactive/interactive.go index 303e0da44b..94d7bec6dd 100644 --- a/vendor/github.com/efficientgo/e2e/interactive/interactive.go +++ b/vendor/github.com/efficientgo/e2e/interactive/interactive.go @@ -11,10 +11,11 @@ import ( "os" "os/exec" "os/signal" - "runtime" "sync" "syscall" + "github.com/efficientgo/e2e/host" + "github.com/efficientgo/core/errors" ) @@ -22,7 +23,9 @@ import ( func OpenInBrowser(url string) error { fmt.Println("Opening", url, "in browser.") var err error - switch runtime.GOOS { + switch host.OSPlatform() { + case "WSL2": + err = exec.Command("rundll32.exe", "url.dll,FileProtocolHandler", url).Run() case "linux": err = exec.Command("xdg-open", url).Run() case "windows": @@ -42,13 +45,18 @@ func OpenInBrowser(url string) error { // This function is useful when you want to interact with e2e tests and manually decide when to finish. Use this function // as opposed to RunUntilSignal for certain IDEs that does not send correct signal on stop (e.g. Goland pre 2022.3, // see https://youtrack.jetbrains.com/issue/GO-5982). -func RunUntilEndpointHit() (err error) { +func RunUntilEndpointHit() error { + return RunUntilEndpointHitWithPort(0) +} + +// RunUntilEndpointHitWithPort is like RunUntilEndpointHit, but it allows specifying static port. +func RunUntilEndpointHitWithPort(port int) (err error) { once := sync.Once{} wg := sync.WaitGroup{} stopWG := sync.WaitGroup{} stopWG.Add(1) - l, err := net.Listen("tcp", "localhost:0") + l, err := net.Listen("tcp", fmt.Sprintf("localhost:%v", port)) if err != nil { return err } @@ -78,7 +86,7 @@ func RunUntilEndpointHit() (err error) { wg.Done() }() - fmt.Println("Waiting for user HTTP request on ", "http://"+l.Addr().String(), " or SIGINT, SIGKILL or SIGHUP signal...") + fmt.Println("Waiting for user HTTP request on", "http://"+l.Addr().String(), " or SIGINT, SIGKILL or SIGHUP signal...") stopWG.Wait() // Cleanup. diff --git a/vendor/github.com/efficientgo/e2e/monitoring/metrics.go b/vendor/github.com/efficientgo/e2e/monitoring/metrics.go index ba4b7af0c5..7471c90f2c 100644 --- a/vendor/github.com/efficientgo/e2e/monitoring/metrics.go +++ b/vendor/github.com/efficientgo/e2e/monitoring/metrics.go @@ -201,6 +201,17 @@ func Less(value float64) MetricValueExpectation { } } +// Between is a MetricValueExpectation function for WaitSumMetrics that returns true if given single sum is between +// the lower and upper bounds (non-inclusive, as in `lower < x < upper`). +func Between(lower, upper float64) MetricValueExpectation { + return func(sums ...float64) bool { + if len(sums) != 1 { + panic("between: expected one value") + } + return sums[0] > lower && sums[0] < upper + } +} + // EqualsAmongTwo is an isExpected function for WaitSumMetrics that returns true if first sum is equal to the second. // NOTE: Be careful on scrapes in between of process that changes two metrics. Those are // usually not atomic. diff --git a/vendor/github.com/efficientgo/e2e/monitoring/monitoring.go b/vendor/github.com/efficientgo/e2e/monitoring/monitoring.go index 69631a2a0a..571903feef 100644 --- a/vendor/github.com/efficientgo/e2e/monitoring/monitoring.go +++ b/vendor/github.com/efficientgo/e2e/monitoring/monitoring.go @@ -15,6 +15,8 @@ import ( "sync" "time" + "github.com/efficientgo/e2e/host" + "github.com/efficientgo/core/errcapture" "github.com/efficientgo/core/errors" "github.com/efficientgo/e2e" @@ -259,8 +261,16 @@ func Start(env e2e.Environment, opts ...Option) (_ *Service, err error) { h.ServeHTTP(w, req) })) - // Listen on all addresses, since we need to connect to it from docker container. - list, err := net.Listen("tcp", "0.0.0.0:0") + // Listen on all tcp4 addresses, since we need to connect to it from Docker container. + // For unknown reasons, when using WSL 2, if the network type is "tcp" it will + // end up only binding to the IPv6 in the WSL host, which later cannot be acessed + // via IPv4 to confirm Prometheus can scrape the local endpoint. + // Explicitly asking for an IPv4 listener works. + networkType := "tcp" + if host.OSPlatform() == "WSL2" { + networkType = "tcp4" + } + list, err := net.Listen(networkType, "0.0.0.0:0") if err != nil { return nil, err } @@ -282,6 +292,9 @@ func Start(env e2e.Environment, opts ...Option) (_ *Service, err error) { env.AddListener(l) if opt.useCadvisor { + if host.OSPlatform() == "WSL2" { + return nil, errors.New("cadvisor is not supported in WSL 2 environments") + } c := newCadvisor(env, "cadvisor") if err := e2e.StartAndWaitReady(c); err != nil { return nil, errors.Wrap(err, "starting cadvisor and waiting until ready") @@ -349,3 +362,27 @@ func newCadvisor(env e2e.Environment, name string, cgroupPrefixes ...string) *In Privileged: true, }), "http") } + +const nginxImage = "docker.io/nginx:1.21.1-alpine" + +// NewStaticMetricsServer creates a new nginx server that serves the content of metrics as /metrics endpoint. +// This is useful for testing different metrics scrapers. +func NewStaticMetricsServer(e e2e.Environment, name string, metrics []byte) *InstrumentedRunnable { + f := e.Runnable(name).WithPorts(map[string]int{"http": 80}).Future() + if err := os.MkdirAll(f.Dir(), 0750); err != nil { + return &InstrumentedRunnable{Runnable: e2e.NewFailedRunnable(name, errors.Wrap(err, "create static metrics dir"))} + } + metricsFilePath := filepath.Join(f.Dir(), "metrics.txt") + if err := os.WriteFile(metricsFilePath, metrics, 0644); err != nil { + return &InstrumentedRunnable{Runnable: e2e.NewFailedRunnable(name, errors.Wrap(err, "creating static metrics file"))} + } + probe := e2e.NewHTTPReadinessProbe("http", "/metrics", 200, 200) + return AsInstrumented( + f.Init(e2e.StartOptions{ + Image: nginxImage, + Volumes: []string{metricsFilePath + ":/usr/share/nginx/html/metrics:ro"}, + Readiness: probe, + }), + "http", + ) +} diff --git a/vendor/github.com/go-logfmt/logfmt/CHANGELOG.md b/vendor/github.com/go-logfmt/logfmt/CHANGELOG.md index 1a9a27bcf6..8f349c4b8f 100644 --- a/vendor/github.com/go-logfmt/logfmt/CHANGELOG.md +++ b/vendor/github.com/go-logfmt/logfmt/CHANGELOG.md @@ -1,48 +1,82 @@ # Changelog + All notable changes to this project will be documented in this file. The format is based on [Keep a Changelog](https://keepachangelog.com/en/1.0.0/), and this project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.html). +## [0.6.0] - 2023-01-30 + +[0.6.0]: https://github.com/go-logfmt/logfmt/compare/v0.5.1...v0.6.0 + +### Added + +- NewDecoderSize by [@alexanderjophus] + +## [0.5.1] - 2021-08-18 + +[0.5.1]: https://github.com/go-logfmt/logfmt/compare/v0.5.0...v0.5.1 + +### Changed + +- Update the `go.mod` file for Go 1.17 as described in the [Go 1.17 release + notes](https://golang.org/doc/go1.17#go-command) + ## [0.5.0] - 2020-01-03 +[0.5.0]: https://github.com/go-logfmt/logfmt/compare/v0.4.0...v0.5.0 + ### Changed + - Remove the dependency on github.com/kr/logfmt by [@ChrisHines] - Move fuzz code to github.com/go-logfmt/fuzzlogfmt by [@ChrisHines] ## [0.4.0] - 2018-11-21 +[0.4.0]: https://github.com/go-logfmt/logfmt/compare/v0.3.0...v0.4.0 + ### Added + - Go module support by [@ChrisHines] - CHANGELOG by [@ChrisHines] ### Changed + - Drop invalid runes from keys instead of returning ErrInvalidKey by [@ChrisHines] - On panic while printing, attempt to print panic value by [@bboreham] ## [0.3.0] - 2016-11-15 + +[0.3.0]: https://github.com/go-logfmt/logfmt/compare/v0.2.0...v0.3.0 + ### Added + - Pool buffers for quoted strings and byte slices by [@nussjustin] + ### Fixed + - Fuzz fix, quote invalid UTF-8 values by [@judwhite] ## [0.2.0] - 2016-05-08 + +[0.2.0]: https://github.com/go-logfmt/logfmt/compare/v0.1.0...v0.2.0 + ### Added + - Encoder.EncodeKeyvals by [@ChrisHines] ## [0.1.0] - 2016-03-28 + +[0.1.0]: https://github.com/go-logfmt/logfmt/commits/v0.1.0 + ### Added + - Encoder by [@ChrisHines] - Decoder by [@ChrisHines] - MarshalKeyvals by [@ChrisHines] -[0.5.0]: https://github.com/go-logfmt/logfmt/compare/v0.4.0...v0.5.0 -[0.4.0]: https://github.com/go-logfmt/logfmt/compare/v0.3.0...v0.4.0 -[0.3.0]: https://github.com/go-logfmt/logfmt/compare/v0.2.0...v0.3.0 -[0.2.0]: https://github.com/go-logfmt/logfmt/compare/v0.1.0...v0.2.0 -[0.1.0]: https://github.com/go-logfmt/logfmt/commits/v0.1.0 - [@ChrisHines]: https://github.com/ChrisHines [@bboreham]: https://github.com/bboreham [@judwhite]: https://github.com/judwhite [@nussjustin]: https://github.com/nussjustin +[@alexanderjophus]: https://github.com/alexanderjophus diff --git a/vendor/github.com/go-logfmt/logfmt/README.md b/vendor/github.com/go-logfmt/logfmt/README.md index 8e48fcd3ab..71c57944e2 100644 --- a/vendor/github.com/go-logfmt/logfmt/README.md +++ b/vendor/github.com/go-logfmt/logfmt/README.md @@ -1,20 +1,25 @@ +# logfmt + [](https://pkg.go.dev/github.com/go-logfmt/logfmt) [](https://goreportcard.com/report/go-logfmt/logfmt) [](https://github.com/go-logfmt/logfmt/actions/workflows/test.yml) -[](https://coveralls.io/github/go-logfmt/logfmt?branch=master) - -# logfmt +[](https://coveralls.io/github/go-logfmt/logfmt?branch=main) Package logfmt implements utilities to marshal and unmarshal data in the [logfmt -format](https://brandur.org/logfmt). It provides an API similar to -[encoding/json](http://golang.org/pkg/encoding/json/) and -[encoding/xml](http://golang.org/pkg/encoding/xml/). +format][fmt]. It provides an API similar to [encoding/json][json] and +[encoding/xml][xml]. + +[fmt]: https://brandur.org/logfmt +[json]: https://pkg.go.dev/encoding/json +[xml]: https://pkg.go.dev/encoding/xml The logfmt format was first documented by Brandur Leach in [this -article](https://brandur.org/logfmt). The format has not been formally -standardized. The most authoritative public specification to date has been the -documentation of a Go Language [package](http://godoc.org/github.com/kr/logfmt) -written by Blake Mizerany and Keith Rarick. +article][origin]. The format has not been formally standardized. The most +authoritative public specification to date has been the documentation of a Go +Language [package][parser] written by Blake Mizerany and Keith Rarick. + +[origin]: https://brandur.org/logfmt +[parser]: https://pkg.go.dev/github.com/kr/logfmt ## Goals @@ -30,4 +35,7 @@ standard as a goal. ## Versioning -Package logfmt publishes releases via [semver](http://semver.org/) compatible Git tags prefixed with a single 'v'. +This project publishes releases according to the Go language guidelines for +[developing and publishing modules][pub]. + +[pub]: https://go.dev/doc/modules/developing diff --git a/vendor/github.com/go-logfmt/logfmt/decode.go b/vendor/github.com/go-logfmt/logfmt/decode.go index 2013708e48..a1c22dcbda 100644 --- a/vendor/github.com/go-logfmt/logfmt/decode.go +++ b/vendor/github.com/go-logfmt/logfmt/decode.go @@ -29,6 +29,23 @@ func NewDecoder(r io.Reader) *Decoder { return dec } +// NewDecoderSize returns a new decoder that reads from r. +// +// The decoder introduces its own buffering and may read data from r beyond +// the logfmt records requested. +// The size argument specifies the size of the initial buffer that the +// Decoder will use to read records from r. +// If a log line is longer than the size argument, the Decoder will return +// a bufio.ErrTooLong error. +func NewDecoderSize(r io.Reader, size int) *Decoder { + scanner := bufio.NewScanner(r) + scanner.Buffer(make([]byte, 0, size), size) + dec := &Decoder{ + s: scanner, + } + return dec +} + // ScanRecord advances the Decoder to the next record, which can then be // parsed with the ScanKeyval method. It returns false when decoding stops, // either by reaching the end of the input or an error. After ScanRecord diff --git a/vendor/github.com/go-logr/logr/.golangci.yaml b/vendor/github.com/go-logr/logr/.golangci.yaml index 94ff801df1..0cffafa7bf 100644 --- a/vendor/github.com/go-logr/logr/.golangci.yaml +++ b/vendor/github.com/go-logr/logr/.golangci.yaml @@ -6,7 +6,6 @@ linters: disable-all: true enable: - asciicheck - - deadcode - errcheck - forcetypeassert - gocritic @@ -18,10 +17,8 @@ linters: - misspell - revive - staticcheck - - structcheck - typecheck - unused - - varcheck issues: exclude-use-default: false diff --git a/vendor/github.com/go-logr/logr/discard.go b/vendor/github.com/go-logr/logr/discard.go index 9d92a38f1d..99fe8be93c 100644 --- a/vendor/github.com/go-logr/logr/discard.go +++ b/vendor/github.com/go-logr/logr/discard.go @@ -20,35 +20,5 @@ package logr // used whenever the caller is not interested in the logs. Logger instances // produced by this function always compare as equal. func Discard() Logger { - return Logger{ - level: 0, - sink: discardLogSink{}, - } -} - -// discardLogSink is a LogSink that discards all messages. -type discardLogSink struct{} - -// Verify that it actually implements the interface -var _ LogSink = discardLogSink{} - -func (l discardLogSink) Init(RuntimeInfo) { -} - -func (l discardLogSink) Enabled(int) bool { - return false -} - -func (l discardLogSink) Info(int, string, ...interface{}) { -} - -func (l discardLogSink) Error(error, string, ...interface{}) { -} - -func (l discardLogSink) WithValues(...interface{}) LogSink { - return l -} - -func (l discardLogSink) WithName(string) LogSink { - return l + return New(nil) } diff --git a/vendor/github.com/go-logr/logr/funcr/funcr.go b/vendor/github.com/go-logr/logr/funcr/funcr.go index 7accdb0c40..e52f0cd01e 100644 --- a/vendor/github.com/go-logr/logr/funcr/funcr.go +++ b/vendor/github.com/go-logr/logr/funcr/funcr.go @@ -21,13 +21,13 @@ limitations under the License. // github.com/go-logr/logr.LogSink with output through an arbitrary // "write" function. See New and NewJSON for details. // -// Custom LogSinks +// # Custom LogSinks // // For users who need more control, a funcr.Formatter can be embedded inside // your own custom LogSink implementation. This is useful when the LogSink // needs to implement additional methods, for example. // -// Formatting +// # Formatting // // This will respect logr.Marshaler, fmt.Stringer, and error interfaces for // values which are being logged. When rendering a struct, funcr will use Go's @@ -37,6 +37,7 @@ package funcr import ( "bytes" "encoding" + "encoding/json" "fmt" "path/filepath" "reflect" @@ -217,7 +218,7 @@ func newFormatter(opts Options, outfmt outputFormat) Formatter { prefix: "", values: nil, depth: 0, - opts: opts, + opts: &opts, } return f } @@ -231,7 +232,7 @@ type Formatter struct { values []interface{} valuesStr string depth int - opts Options + opts *Options } // outputFormat indicates which outputFormat to use. @@ -447,6 +448,7 @@ func (f Formatter) prettyWithFlags(value interface{}, flags uint32, depth int) s if flags&flagRawStruct == 0 { buf.WriteByte('{') } + printComma := false // testing i>0 is not enough because of JSON omitted fields for i := 0; i < t.NumField(); i++ { fld := t.Field(i) if fld.PkgPath != "" { @@ -478,9 +480,10 @@ func (f Formatter) prettyWithFlags(value interface{}, flags uint32, depth int) s if omitempty && isEmpty(v.Field(i)) { continue } - if i > 0 { + if printComma { buf.WriteByte(',') } + printComma = true // if we got here, we are rendering a field if fld.Anonymous && fld.Type.Kind() == reflect.Struct && name == "" { buf.WriteString(f.prettyWithFlags(v.Field(i).Interface(), flags|flagRawStruct, depth+1)) continue @@ -500,6 +503,20 @@ func (f Formatter) prettyWithFlags(value interface{}, flags uint32, depth int) s } return buf.String() case reflect.Slice, reflect.Array: + // If this is outputing as JSON make sure this isn't really a json.RawMessage. + // If so just emit "as-is" and don't pretty it as that will just print + // it as [X,Y,Z,...] which isn't terribly useful vs the string form you really want. + if f.outputFormat == outputJSON { + if rm, ok := value.(json.RawMessage); ok { + // If it's empty make sure we emit an empty value as the array style would below. + if len(rm) > 0 { + buf.Write(rm) + } else { + buf.WriteString("null") + } + return buf.String() + } + } buf.WriteByte('[') for i := 0; i < v.Len(); i++ { if i > 0 { diff --git a/vendor/github.com/go-logr/logr/logr.go b/vendor/github.com/go-logr/logr/logr.go index c3b56b3d2c..e027aea3fd 100644 --- a/vendor/github.com/go-logr/logr/logr.go +++ b/vendor/github.com/go-logr/logr/logr.go @@ -21,7 +21,7 @@ limitations under the License. // to back that API. Packages in the Go ecosystem can depend on this package, // while callers can implement logging with whatever backend is appropriate. // -// Usage +// # Usage // // Logging is done using a Logger instance. Logger is a concrete type with // methods, which defers the actual logging to a LogSink interface. The main @@ -30,16 +30,20 @@ limitations under the License. // "structured logging". // // With Go's standard log package, we might write: -// log.Printf("setting target value %s", targetValue) +// +// log.Printf("setting target value %s", targetValue) // // With logr's structured logging, we'd write: -// logger.Info("setting target", "value", targetValue) +// +// logger.Info("setting target", "value", targetValue) // // Errors are much the same. Instead of: -// log.Printf("failed to open the pod bay door for user %s: %v", user, err) +// +// log.Printf("failed to open the pod bay door for user %s: %v", user, err) // // We'd write: -// logger.Error(err, "failed to open the pod bay door", "user", user) +// +// logger.Error(err, "failed to open the pod bay door", "user", user) // // Info() and Error() are very similar, but they are separate methods so that // LogSink implementations can choose to do things like attach additional @@ -47,7 +51,7 @@ limitations under the License. // always logged, regardless of the current verbosity. If there is no error // instance available, passing nil is valid. // -// Verbosity +// # Verbosity // // Often we want to log information only when the application in "verbose // mode". To write log lines that are more verbose, Logger has a V() method. @@ -58,20 +62,22 @@ limitations under the License. // Error messages do not have a verbosity level and are always logged. // // Where we might have written: -// if flVerbose >= 2 { -// log.Printf("an unusual thing happened") -// } +// +// if flVerbose >= 2 { +// log.Printf("an unusual thing happened") +// } // // We can write: -// logger.V(2).Info("an unusual thing happened") // -// Logger Names +// logger.V(2).Info("an unusual thing happened") +// +// # Logger Names // // Logger instances can have name strings so that all messages logged through // that instance have additional context. For example, you might want to add // a subsystem name: // -// logger.WithName("compactor").Info("started", "time", time.Now()) +// logger.WithName("compactor").Info("started", "time", time.Now()) // // The WithName() method returns a new Logger, which can be passed to // constructors or other functions for further use. Repeated use of WithName() @@ -82,25 +88,27 @@ limitations under the License. // joining operation (e.g. whitespace, commas, periods, slashes, brackets, // quotes, etc). // -// Saved Values +// # Saved Values // // Logger instances can store any number of key/value pairs, which will be // logged alongside all messages logged through that instance. For example, // you might want to create a Logger instance per managed object: // // With the standard log package, we might write: -// log.Printf("decided to set field foo to value %q for object %s/%s", -// targetValue, object.Namespace, object.Name) +// +// log.Printf("decided to set field foo to value %q for object %s/%s", +// targetValue, object.Namespace, object.Name) // // With logr we'd write: -// // Elsewhere: set up the logger to log the object name. -// obj.logger = mainLogger.WithValues( -// "name", obj.name, "namespace", obj.namespace) // -// // later on... -// obj.logger.Info("setting foo", "value", targetValue) +// // Elsewhere: set up the logger to log the object name. +// obj.logger = mainLogger.WithValues( +// "name", obj.name, "namespace", obj.namespace) +// +// // later on... +// obj.logger.Info("setting foo", "value", targetValue) // -// Best Practices +// # Best Practices // // Logger has very few hard rules, with the goal that LogSink implementations // might have a lot of freedom to differentiate. There are, however, some @@ -124,15 +132,15 @@ limitations under the License. // around. For cases where passing a logger is optional, a pointer to Logger // should be used. // -// Key Naming Conventions +// # Key Naming Conventions // // Keys are not strictly required to conform to any specification or regex, but // it is recommended that they: -// * be human-readable and meaningful (not auto-generated or simple ordinals) -// * be constant (not dependent on input data) -// * contain only printable characters -// * not contain whitespace or punctuation -// * use lower case for simple keys and lowerCamelCase for more complex ones +// - be human-readable and meaningful (not auto-generated or simple ordinals) +// - be constant (not dependent on input data) +// - contain only printable characters +// - not contain whitespace or punctuation +// - use lower case for simple keys and lowerCamelCase for more complex ones // // These guidelines help ensure that log data is processed properly regardless // of the log implementation. For example, log implementations will try to @@ -141,51 +149,54 @@ limitations under the License. // While users are generally free to use key names of their choice, it's // generally best to avoid using the following keys, as they're frequently used // by implementations: -// * "caller": the calling information (file/line) of a particular log line -// * "error": the underlying error value in the `Error` method -// * "level": the log level -// * "logger": the name of the associated logger -// * "msg": the log message -// * "stacktrace": the stack trace associated with a particular log line or -// error (often from the `Error` message) -// * "ts": the timestamp for a log line +// - "caller": the calling information (file/line) of a particular log line +// - "error": the underlying error value in the `Error` method +// - "level": the log level +// - "logger": the name of the associated logger +// - "msg": the log message +// - "stacktrace": the stack trace associated with a particular log line or +// error (often from the `Error` message) +// - "ts": the timestamp for a log line // // Implementations are encouraged to make use of these keys to represent the // above concepts, when necessary (for example, in a pure-JSON output form, it // would be necessary to represent at least message and timestamp as ordinary // named values). // -// Break Glass +// # Break Glass // // Implementations may choose to give callers access to the underlying // logging implementation. The recommended pattern for this is: -// // Underlier exposes access to the underlying logging implementation. -// // Since callers only have a logr.Logger, they have to know which -// // implementation is in use, so this interface is less of an abstraction -// // and more of way to test type conversion. -// type Underlier interface { -// GetUnderlying() <underlying-type> -// } +// +// // Underlier exposes access to the underlying logging implementation. +// // Since callers only have a logr.Logger, they have to know which +// // implementation is in use, so this interface is less of an abstraction +// // and more of way to test type conversion. +// type Underlier interface { +// GetUnderlying() <underlying-type> +// } // // Logger grants access to the sink to enable type assertions like this: -// func DoSomethingWithImpl(log logr.Logger) { -// if underlier, ok := log.GetSink()(impl.Underlier) { -// implLogger := underlier.GetUnderlying() -// ... -// } -// } +// +// func DoSomethingWithImpl(log logr.Logger) { +// if underlier, ok := log.GetSink().(impl.Underlier); ok { +// implLogger := underlier.GetUnderlying() +// ... +// } +// } // // Custom `With*` functions can be implemented by copying the complete // Logger struct and replacing the sink in the copy: -// // WithFooBar changes the foobar parameter in the log sink and returns a -// // new logger with that modified sink. It does nothing for loggers where -// // the sink doesn't support that parameter. -// func WithFoobar(log logr.Logger, foobar int) logr.Logger { -// if foobarLogSink, ok := log.GetSink()(FoobarSink); ok { -// log = log.WithSink(foobarLogSink.WithFooBar(foobar)) -// } -// return log -// } +// +// // WithFooBar changes the foobar parameter in the log sink and returns a +// // new logger with that modified sink. It does nothing for loggers where +// // the sink doesn't support that parameter. +// func WithFoobar(log logr.Logger, foobar int) logr.Logger { +// if foobarLogSink, ok := log.GetSink().(FoobarSink); ok { +// log = log.WithSink(foobarLogSink.WithFooBar(foobar)) +// } +// return log +// } // // Don't use New to construct a new Logger with a LogSink retrieved from an // existing Logger. Source code attribution might not work correctly and @@ -201,11 +212,14 @@ import ( ) // New returns a new Logger instance. This is primarily used by libraries -// implementing LogSink, rather than end users. +// implementing LogSink, rather than end users. Passing a nil sink will create +// a Logger which discards all log lines. func New(sink LogSink) Logger { logger := Logger{} logger.setSink(sink) - sink.Init(runtimeInfo) + if sink != nil { + sink.Init(runtimeInfo) + } return logger } @@ -244,7 +258,7 @@ type Logger struct { // Enabled tests whether this Logger is enabled. For example, commandline // flags might be used to set the logging verbosity and disable some info logs. func (l Logger) Enabled() bool { - return l.sink.Enabled(l.level) + return l.sink != nil && l.sink.Enabled(l.level) } // Info logs a non-error message with the given key/value pairs as context. @@ -254,6 +268,9 @@ func (l Logger) Enabled() bool { // information. The key/value pairs must alternate string keys and arbitrary // values. func (l Logger) Info(msg string, keysAndValues ...interface{}) { + if l.sink == nil { + return + } if l.Enabled() { if withHelper, ok := l.sink.(CallStackHelperLogSink); ok { withHelper.GetCallStackHelper()() @@ -273,6 +290,9 @@ func (l Logger) Info(msg string, keysAndValues ...interface{}) { // triggered this log line, if present. The err parameter is optional // and nil may be passed instead of an error instance. func (l Logger) Error(err error, msg string, keysAndValues ...interface{}) { + if l.sink == nil { + return + } if withHelper, ok := l.sink.(CallStackHelperLogSink); ok { withHelper.GetCallStackHelper()() } @@ -284,6 +304,9 @@ func (l Logger) Error(err error, msg string, keysAndValues ...interface{}) { // level means a log message is less important. Negative V-levels are treated // as 0. func (l Logger) V(level int) Logger { + if l.sink == nil { + return l + } if level < 0 { level = 0 } @@ -294,6 +317,9 @@ func (l Logger) V(level int) Logger { // WithValues returns a new Logger instance with additional key/value pairs. // See Info for documentation on how key/value pairs work. func (l Logger) WithValues(keysAndValues ...interface{}) Logger { + if l.sink == nil { + return l + } l.setSink(l.sink.WithValues(keysAndValues...)) return l } @@ -304,6 +330,9 @@ func (l Logger) WithValues(keysAndValues ...interface{}) Logger { // contain only letters, digits, and hyphens (see the package documentation for // more information). func (l Logger) WithName(name string) Logger { + if l.sink == nil { + return l + } l.setSink(l.sink.WithName(name)) return l } @@ -324,6 +353,9 @@ func (l Logger) WithName(name string) Logger { // WithCallDepth(1) because it works with implementions that support the // CallDepthLogSink and/or CallStackHelperLogSink interfaces. func (l Logger) WithCallDepth(depth int) Logger { + if l.sink == nil { + return l + } if withCallDepth, ok := l.sink.(CallDepthLogSink); ok { l.setSink(withCallDepth.WithCallDepth(depth)) } @@ -345,6 +377,9 @@ func (l Logger) WithCallDepth(depth int) Logger { // implementation does not support either of these, the original Logger will be // returned. func (l Logger) WithCallStackHelper() (func(), Logger) { + if l.sink == nil { + return func() {}, l + } var helper func() if withCallDepth, ok := l.sink.(CallDepthLogSink); ok { l.setSink(withCallDepth.WithCallDepth(1)) @@ -357,6 +392,11 @@ func (l Logger) WithCallStackHelper() (func(), Logger) { return helper, l } +// IsZero returns true if this logger is an uninitialized zero value +func (l Logger) IsZero() bool { + return l.sink == nil +} + // contextKey is how we find Loggers in a context.Context. type contextKey struct{} @@ -442,7 +482,7 @@ type LogSink interface { WithName(name string) LogSink } -// CallDepthLogSink represents a Logger that knows how to climb the call stack +// CallDepthLogSink represents a LogSink that knows how to climb the call stack // to identify the original call site and can offset the depth by a specified // number of frames. This is useful for users who have helper functions // between the "real" call site and the actual calls to Logger methods. @@ -467,7 +507,7 @@ type CallDepthLogSink interface { WithCallDepth(depth int) LogSink } -// CallStackHelperLogSink represents a Logger that knows how to climb +// CallStackHelperLogSink represents a LogSink that knows how to climb // the call stack to identify the original call site and can skip // intermediate helper functions if they mark themselves as // helper. Go's testing package uses that approach. diff --git a/vendor/github.com/go-logr/logr/testr/testr.go b/vendor/github.com/go-logr/logr/testr/testr.go index 6fa2783ca0..2772b49a93 100644 --- a/vendor/github.com/go-logr/logr/testr/testr.go +++ b/vendor/github.com/go-logr/logr/testr/testr.go @@ -27,11 +27,7 @@ import ( // New returns a logr.Logger that prints through a testing.T object. // Info logs are only enabled at V(0). func New(t *testing.T) logr.Logger { - l := &testlogger{ - Formatter: funcr.NewFormatter(funcr.Options{}), - t: t, - } - return logr.New(l) + return NewWithOptions(t, Options{}) } // Options carries parameters which influence the way logs are generated. @@ -50,13 +46,33 @@ type Options struct { // In contrast to the simpler New, output formatting can be configured. func NewWithOptions(t *testing.T, opts Options) logr.Logger { l := &testlogger{ + testloggerInterface: newLoggerInterfaceWithOptions(t, opts), + } + return logr.New(l) +} + +// TestingT is an interface wrapper around testing.T, testing.B and testing.F. +type TestingT interface { + Helper() + Log(args ...interface{}) +} + +// NewWithInterface returns a logr.Logger that prints through a +// TestingT object. +// In contrast to the simpler New, output formatting can be configured. +func NewWithInterface(t TestingT, opts Options) logr.Logger { + l := newLoggerInterfaceWithOptions(t, opts) + return logr.New(&l) +} + +func newLoggerInterfaceWithOptions(t TestingT, opts Options) testloggerInterface { + return testloggerInterface{ + t: t, Formatter: funcr.NewFormatter(funcr.Options{ LogTimestamp: opts.LogTimestamp, Verbosity: opts.Verbosity, }), - t: t, } - return logr.New(l) } // Underlier exposes access to the underlying testing.T instance. Since @@ -67,46 +83,77 @@ type Underlier interface { GetUnderlying() *testing.T } +// UnderlierInterface exposes access to the underlying TestingT instance. Since +// callers only have a logr.Logger, they have to know which +// implementation is in use, so this interface is less of an +// abstraction and more of a way to test type conversion. +type UnderlierInterface interface { + GetUnderlying() TestingT +} + +// Info logging implementation shared between testLogger and testLoggerInterface. +func logInfo(t TestingT, formatInfo func(int, string, []interface{}) (string, string), level int, msg string, kvList ...interface{}) { + prefix, args := formatInfo(level, msg, kvList) + t.Helper() + if prefix != "" { + args = prefix + ": " + args + } + t.Log(args) +} + +// Error logging implementation shared between testLogger and testLoggerInterface. +func logError(t TestingT, formatError func(error, string, []interface{}) (string, string), err error, msg string, kvList ...interface{}) { + prefix, args := formatError(err, msg, kvList) + t.Helper() + if prefix != "" { + args = prefix + ": " + args + } + t.Log(args) +} + +// This type exists to wrap and modify the method-set of testloggerInterface. +// In particular, it changes the GetUnderlying() method. type testlogger struct { + testloggerInterface +} + +func (l testlogger) GetUnderlying() *testing.T { + // This method is defined on testlogger, so the only type this could + // possibly be is testing.T, even though that's not guaranteed by the type + // system itself. + return l.t.(*testing.T) //nolint:forcetypeassert +} + +type testloggerInterface struct { funcr.Formatter - t *testing.T + t TestingT } -func (l testlogger) WithName(name string) logr.LogSink { +func (l testloggerInterface) WithName(name string) logr.LogSink { l.Formatter.AddName(name) return &l } -func (l testlogger) WithValues(kvList ...interface{}) logr.LogSink { +func (l testloggerInterface) WithValues(kvList ...interface{}) logr.LogSink { l.Formatter.AddValues(kvList) return &l } -func (l testlogger) GetCallStackHelper() func() { +func (l testloggerInterface) GetCallStackHelper() func() { return l.t.Helper } -func (l testlogger) Info(level int, msg string, kvList ...interface{}) { - prefix, args := l.FormatInfo(level, msg, kvList) +func (l testloggerInterface) Info(level int, msg string, kvList ...interface{}) { l.t.Helper() - if prefix != "" { - l.t.Logf("%s: %s", prefix, args) - } else { - l.t.Log(args) - } + logInfo(l.t, l.FormatInfo, level, msg, kvList...) } -func (l testlogger) Error(err error, msg string, kvList ...interface{}) { - prefix, args := l.FormatError(err, msg, kvList) +func (l testloggerInterface) Error(err error, msg string, kvList ...interface{}) { l.t.Helper() - if prefix != "" { - l.t.Logf("%s: %s", prefix, args) - } else { - l.t.Log(args) - } + logError(l.t, l.FormatError, err, msg, kvList...) } -func (l testlogger) GetUnderlying() *testing.T { +func (l testloggerInterface) GetUnderlying() TestingT { return l.t } @@ -114,3 +161,7 @@ func (l testlogger) GetUnderlying() *testing.T { var _ logr.LogSink = &testlogger{} var _ logr.CallStackHelperLogSink = &testlogger{} var _ Underlier = &testlogger{} + +var _ logr.LogSink = &testloggerInterface{} +var _ logr.CallStackHelperLogSink = &testloggerInterface{} +var _ UnderlierInterface = &testloggerInterface{} diff --git a/vendor/github.com/go-openapi/errors/api.go b/vendor/github.com/go-openapi/errors/api.go index 77f1f92c5e..c13f3435fa 100644 --- a/vendor/github.com/go-openapi/errors/api.go +++ b/vendor/github.com/go-openapi/errors/api.go @@ -112,7 +112,7 @@ func flattenComposite(errs *CompositeError) *CompositeError { for _, er := range errs.Errors { switch e := er.(type) { case *CompositeError: - if len(e.Errors) > 0 { + if e != nil && len(e.Errors) > 0 { flat := flattenComposite(e) if len(flat.Errors) > 0 { res = append(res, flat.Errors...) diff --git a/vendor/github.com/go-openapi/jsonpointer/.travis.yml b/vendor/github.com/go-openapi/jsonpointer/.travis.yml deleted file mode 100644 index 03a22fe06f..0000000000 --- a/vendor/github.com/go-openapi/jsonpointer/.travis.yml +++ /dev/null @@ -1,15 +0,0 @@ -after_success: -- bash <(curl -s https://codecov.io/bash) -go: -- 1.14.x -- 1.15.x -install: -- GO111MODULE=off go get -u gotest.tools/gotestsum -env: -- GO111MODULE=on -language: go -notifications: - slack: - secure: a5VgoiwB1G/AZqzmephPZIhEB9avMlsWSlVnM1dSAtYAwdrQHGTQxAmpOxYIoSPDhWNN5bfZmjd29++UlTwLcHSR+e0kJhH6IfDlsHj/HplNCJ9tyI0zYc7XchtdKgeMxMzBKCzgwFXGSbQGydXTliDNBo0HOzmY3cou/daMFTP60K+offcjS+3LRAYb1EroSRXZqrk1nuF/xDL3792DZUdPMiFR/L/Df6y74D6/QP4sTkTDFQitz4Wy/7jbsfj8dG6qK2zivgV6/l+w4OVjFkxVpPXogDWY10vVXNVynqxfJ7to2d1I9lNCHE2ilBCkWMIPdyJF7hjF8pKW+82yP4EzRh0vu8Xn0HT5MZpQxdRY/YMxNrWaG7SxsoEaO4q5uhgdzAqLYY3TRa7MjIK+7Ur+aqOeTXn6OKwVi0CjvZ6mIU3WUKSwiwkFZMbjRAkSb5CYwMEfGFO/z964xz83qGt6WAtBXNotqCQpTIiKtDHQeLOMfksHImCg6JLhQcWBVxamVgu0G3Pdh8Y6DyPnxraXY95+QDavbjqv7TeYT9T/FNnrkXaTTK0s4iWE5H4ACU0Qvz0wUYgfQrZv0/Hp7V17+rabUwnzYySHCy9SWX/7OV9Cfh31iMp9ZIffr76xmmThtOEqs8TrTtU6BWI3rWwvA9cXQipZTVtL0oswrGw= -script: -- gotestsum -f short-verbose -- -race -coverprofile=coverage.txt -covermode=atomic ./... diff --git a/vendor/github.com/go-openapi/jsonpointer/pointer.go b/vendor/github.com/go-openapi/jsonpointer/pointer.go index 7df9853def..de60dc7dd2 100644 --- a/vendor/github.com/go-openapi/jsonpointer/pointer.go +++ b/vendor/github.com/go-openapi/jsonpointer/pointer.go @@ -26,6 +26,7 @@ package jsonpointer import ( + "encoding/json" "errors" "fmt" "reflect" @@ -40,6 +41,7 @@ const ( pointerSeparator = `/` invalidStart = `JSON pointer must be empty or start with a "` + pointerSeparator + notFound = `Can't find the pointer in the document` ) var jsonPointableType = reflect.TypeOf(new(JSONPointable)).Elem() @@ -48,13 +50,13 @@ var jsonSetableType = reflect.TypeOf(new(JSONSetable)).Elem() // JSONPointable is an interface for structs to implement when they need to customize the // json pointer process type JSONPointable interface { - JSONLookup(string) (interface{}, error) + JSONLookup(string) (any, error) } // JSONSetable is an interface for structs to implement when they need to customize the // json pointer process type JSONSetable interface { - JSONSet(string, interface{}) error + JSONSet(string, any) error } // New creates a new json pointer for the given string @@ -81,9 +83,7 @@ func (p *Pointer) parse(jsonPointerString string) error { err = errors.New(invalidStart) } else { referenceTokens := strings.Split(jsonPointerString, pointerSeparator) - for _, referenceToken := range referenceTokens[1:] { - p.referenceTokens = append(p.referenceTokens, referenceToken) - } + p.referenceTokens = append(p.referenceTokens, referenceTokens[1:]...) } } @@ -91,26 +91,26 @@ func (p *Pointer) parse(jsonPointerString string) error { } // Get uses the pointer to retrieve a value from a JSON document -func (p *Pointer) Get(document interface{}) (interface{}, reflect.Kind, error) { +func (p *Pointer) Get(document any) (any, reflect.Kind, error) { return p.get(document, swag.DefaultJSONNameProvider) } // Set uses the pointer to set a value from a JSON document -func (p *Pointer) Set(document interface{}, value interface{}) (interface{}, error) { +func (p *Pointer) Set(document any, value any) (any, error) { return document, p.set(document, value, swag.DefaultJSONNameProvider) } // GetForToken gets a value for a json pointer token 1 level deep -func GetForToken(document interface{}, decodedToken string) (interface{}, reflect.Kind, error) { +func GetForToken(document any, decodedToken string) (any, reflect.Kind, error) { return getSingleImpl(document, decodedToken, swag.DefaultJSONNameProvider) } // SetForToken gets a value for a json pointer token 1 level deep -func SetForToken(document interface{}, decodedToken string, value interface{}) (interface{}, error) { +func SetForToken(document any, decodedToken string, value any) (any, error) { return document, setSingleImpl(document, value, decodedToken, swag.DefaultJSONNameProvider) } -func getSingleImpl(node interface{}, decodedToken string, nameProvider *swag.NameProvider) (interface{}, reflect.Kind, error) { +func getSingleImpl(node any, decodedToken string, nameProvider *swag.NameProvider) (any, reflect.Kind, error) { rValue := reflect.Indirect(reflect.ValueOf(node)) kind := rValue.Kind() @@ -159,7 +159,7 @@ func getSingleImpl(node interface{}, decodedToken string, nameProvider *swag.Nam } -func setSingleImpl(node, data interface{}, decodedToken string, nameProvider *swag.NameProvider) error { +func setSingleImpl(node, data any, decodedToken string, nameProvider *swag.NameProvider) error { rValue := reflect.Indirect(reflect.ValueOf(node)) if ns, ok := node.(JSONSetable); ok { // pointer impl @@ -210,7 +210,7 @@ func setSingleImpl(node, data interface{}, decodedToken string, nameProvider *sw } -func (p *Pointer) get(node interface{}, nameProvider *swag.NameProvider) (interface{}, reflect.Kind, error) { +func (p *Pointer) get(node any, nameProvider *swag.NameProvider) (any, reflect.Kind, error) { if nameProvider == nil { nameProvider = swag.DefaultJSONNameProvider @@ -241,7 +241,7 @@ func (p *Pointer) get(node interface{}, nameProvider *swag.NameProvider) (interf return node, kind, nil } -func (p *Pointer) set(node, data interface{}, nameProvider *swag.NameProvider) error { +func (p *Pointer) set(node, data any, nameProvider *swag.NameProvider) error { knd := reflect.ValueOf(node).Kind() if knd != reflect.Ptr && knd != reflect.Struct && knd != reflect.Map && knd != reflect.Slice && knd != reflect.Array { @@ -363,6 +363,127 @@ func (p *Pointer) String() string { return pointerString } +func (p *Pointer) Offset(document string) (int64, error) { + dec := json.NewDecoder(strings.NewReader(document)) + var offset int64 + for _, ttk := range p.DecodedTokens() { + tk, err := dec.Token() + if err != nil { + return 0, err + } + switch tk := tk.(type) { + case json.Delim: + switch tk { + case '{': + offset, err = offsetSingleObject(dec, ttk) + if err != nil { + return 0, err + } + case '[': + offset, err = offsetSingleArray(dec, ttk) + if err != nil { + return 0, err + } + default: + return 0, fmt.Errorf("invalid token %#v", tk) + } + default: + return 0, fmt.Errorf("invalid token %#v", tk) + } + } + return offset, nil +} + +func offsetSingleObject(dec *json.Decoder, decodedToken string) (int64, error) { + for dec.More() { + offset := dec.InputOffset() + tk, err := dec.Token() + if err != nil { + return 0, err + } + switch tk := tk.(type) { + case json.Delim: + switch tk { + case '{': + if err := drainSingle(dec); err != nil { + return 0, err + } + case '[': + if err := drainSingle(dec); err != nil { + return 0, err + } + } + case string: + if tk == decodedToken { + return offset, nil + } + default: + return 0, fmt.Errorf("invalid token %#v", tk) + } + } + return 0, fmt.Errorf("token reference %q not found", decodedToken) +} + +func offsetSingleArray(dec *json.Decoder, decodedToken string) (int64, error) { + idx, err := strconv.Atoi(decodedToken) + if err != nil { + return 0, fmt.Errorf("token reference %q is not a number: %v", decodedToken, err) + } + var i int + for i = 0; i < idx && dec.More(); i++ { + tk, err := dec.Token() + if err != nil { + return 0, err + } + switch tk := tk.(type) { + case json.Delim: + switch tk { + case '{': + if err := drainSingle(dec); err != nil { + return 0, err + } + case '[': + if err := drainSingle(dec); err != nil { + return 0, err + } + } + } + } + if !dec.More() { + return 0, fmt.Errorf("token reference %q not found", decodedToken) + } + return dec.InputOffset(), nil +} + +// drainSingle drains a single level of object or array. +// The decoder has to guarantee the begining delim (i.e. '{' or '[') has been consumed. +func drainSingle(dec *json.Decoder) error { + for dec.More() { + tk, err := dec.Token() + if err != nil { + return err + } + switch tk := tk.(type) { + case json.Delim: + switch tk { + case '{': + if err := drainSingle(dec); err != nil { + return err + } + case '[': + if err := drainSingle(dec); err != nil { + return err + } + } + } + } + // Consumes the ending delim + if _, err := dec.Token(); err != nil { + return err + } + return nil +} + // Specific JSON pointer encoding here // ~0 => ~ // ~1 => / diff --git a/vendor/github.com/go-openapi/jsonreference/.golangci.yml b/vendor/github.com/go-openapi/jsonreference/.golangci.yml index f9381aee54..013fc1943a 100644 --- a/vendor/github.com/go-openapi/jsonreference/.golangci.yml +++ b/vendor/github.com/go-openapi/jsonreference/.golangci.yml @@ -1,8 +1,6 @@ linters-settings: govet: check-shadowing: true - golint: - min-confidence: 0 gocyclo: min-complexity: 30 maligned: @@ -12,6 +10,8 @@ linters-settings: goconst: min-len: 2 min-occurrences: 4 + paralleltest: + ignore-missing: true linters: enable-all: true disable: @@ -39,3 +39,12 @@ linters: - nestif - godot - errorlint + - varcheck + - interfacer + - deadcode + - golint + - ifshort + - structcheck + - nosnakecase + - varnamelen + - exhaustruct diff --git a/vendor/github.com/go-openapi/jsonreference/.travis.yml b/vendor/github.com/go-openapi/jsonreference/.travis.yml deleted file mode 100644 index 05482f4b90..0000000000 --- a/vendor/github.com/go-openapi/jsonreference/.travis.yml +++ /dev/null @@ -1,24 +0,0 @@ -after_success: -- bash <(curl -s https://codecov.io/bash) -go: -- 1.14.x -- 1.x -install: -- go get gotest.tools/gotestsum -jobs: - include: - # include linting job, but only for latest go version and amd64 arch - - go: 1.x - arch: amd64 - install: - go get github.com/golangci/golangci-lint/cmd/golangci-lint - script: - - golangci-lint run --new-from-rev master -env: -- GO111MODULE=on -language: go -notifications: - slack: - secure: OpQG/36F7DSF00HLm9WZMhyqFCYYyYTsVDObW226cWiR8PWYiNfLZiSEvIzT1Gx4dDjhigKTIqcLhG34CkL5iNXDjm9Yyo2RYhQPlK8NErNqUEXuBqn4RqYHW48VGhEhOyDd4Ei0E2FN5ZbgpvHgtpkdZ6XDi64r3Ac89isP9aPHXQTuv2Jog6b4/OKKiUTftLcTIst0p4Cp3gqOJWf1wnoj+IadWiECNVQT6zb47IYjtyw6+uV8iUjTzdKcRB6Zc6b4Dq7JAg1Zd7Jfxkql3hlKp4PNlRf9Cy7y5iA3G7MLyg3FcPX5z2kmcyPt2jOTRMBWUJ5zIQpOxizAcN8WsT3WWBL5KbuYK6k0PzujrIDLqdxGpNmjkkMfDBT9cKmZpm2FdW+oZgPFJP+oKmAo4u4KJz/vjiPTXgQlN5bmrLuRMCp+AwC5wkIohTqWZVPE2TK6ZSnMYcg/W39s+RP/9mJoyryAvPSpBOLTI+biCgaUCTOAZxNTWpMFc3tPYntc41WWkdKcooZ9JA5DwfcaVFyTGQ3YXz+HvX6G1z/gW0Q/A4dBi9mj2iE1xm7tRTT+4VQ2AXFvSEI1HJpfPgYnwAtwOD1v3Qm2EUHk9sCdtEDR4wVGEPIVn44GnwFMnGKx9JWppMPYwFu3SVDdHt+E+LOlhZUply11Aa+IVrT2KUQ= -script: -- gotestsum -f short-verbose -- -race -coverprofile=coverage.txt -covermode=atomic ./... diff --git a/vendor/github.com/go-openapi/jsonreference/internal/normalize_url.go b/vendor/github.com/go-openapi/jsonreference/internal/normalize_url.go index 8956c30884..f0610cf1e5 100644 --- a/vendor/github.com/go-openapi/jsonreference/internal/normalize_url.go +++ b/vendor/github.com/go-openapi/jsonreference/internal/normalize_url.go @@ -7,8 +7,8 @@ import ( ) const ( - defaultHttpPort = ":80" - defaultHttpsPort = ":443" + defaultHTTPPort = ":80" + defaultHTTPSPort = ":443" ) // Regular expressions used by the normalizations @@ -18,18 +18,24 @@ var rxDupSlashes = regexp.MustCompile(`/{2,}`) // NormalizeURL will normalize the specified URL // This was added to replace a previous call to the no longer maintained purell library: // The call that was used looked like the following: -// url.Parse(purell.NormalizeURL(parsed, purell.FlagsSafe|purell.FlagRemoveDuplicateSlashes)) +// +// url.Parse(purell.NormalizeURL(parsed, purell.FlagsSafe|purell.FlagRemoveDuplicateSlashes)) // // To explain all that was included in the call above, purell.FlagsSafe was really just the following: -// - FlagLowercaseScheme -// - FlagLowercaseHost -// - FlagRemoveDefaultPort -// - FlagRemoveDuplicateSlashes (and this was mixed in with the |) +// - FlagLowercaseScheme +// - FlagLowercaseHost +// - FlagRemoveDefaultPort +// - FlagRemoveDuplicateSlashes (and this was mixed in with the |) +// +// This also normalizes the URL into its urlencoded form by removing RawPath and RawFragment. func NormalizeURL(u *url.URL) { lowercaseScheme(u) lowercaseHost(u) removeDefaultPort(u) removeDuplicateSlashes(u) + + u.RawPath = "" + u.RawFragment = "" } func lowercaseScheme(u *url.URL) { @@ -48,7 +54,7 @@ func removeDefaultPort(u *url.URL) { if len(u.Host) > 0 { scheme := strings.ToLower(u.Scheme) u.Host = rxPort.ReplaceAllStringFunc(u.Host, func(val string) string { - if (scheme == "http" && val == defaultHttpPort) || (scheme == "https" && val == defaultHttpsPort) { + if (scheme == "http" && val == defaultHTTPPort) || (scheme == "https" && val == defaultHTTPSPort) { return "" } return val diff --git a/vendor/github.com/go-openapi/spec/info.go b/vendor/github.com/go-openapi/spec/info.go index c458b49b21..582f0fd4c4 100644 --- a/vendor/github.com/go-openapi/spec/info.go +++ b/vendor/github.com/go-openapi/spec/info.go @@ -16,6 +16,7 @@ package spec import ( "encoding/json" + "strconv" "strings" "github.com/go-openapi/jsonpointer" @@ -40,6 +41,24 @@ func (e Extensions) GetString(key string) (string, bool) { return "", false } +// GetInt gets a int value from the extensions +func (e Extensions) GetInt(key string) (int, bool) { + realKey := strings.ToLower(key) + + if v, ok := e.GetString(realKey); ok { + if r, err := strconv.Atoi(v); err == nil { + return r, true + } + } + + if v, ok := e[realKey]; ok { + if r, rOk := v.(float64); rOk { + return int(r), true + } + } + return -1, false +} + // GetBool gets a string value from the extensions func (e Extensions) GetBool(key string) (bool, bool) { if v, ok := e[strings.ToLower(key)]; ok { diff --git a/vendor/github.com/go-openapi/spec/properties.go b/vendor/github.com/go-openapi/spec/properties.go index 2af13787ab..91d2435f01 100644 --- a/vendor/github.com/go-openapi/spec/properties.go +++ b/vendor/github.com/go-openapi/spec/properties.go @@ -42,8 +42,8 @@ func (items OrderSchemaItems) MarshalJSON() ([]byte, error) { func (items OrderSchemaItems) Len() int { return len(items) } func (items OrderSchemaItems) Swap(i, j int) { items[i], items[j] = items[j], items[i] } func (items OrderSchemaItems) Less(i, j int) (ret bool) { - ii, oki := items[i].Extensions.GetString("x-order") - ij, okj := items[j].Extensions.GetString("x-order") + ii, oki := items[i].Extensions.GetInt("x-order") + ij, okj := items[j].Extensions.GetInt("x-order") if oki { if okj { defer func() { @@ -56,7 +56,7 @@ func (items OrderSchemaItems) Less(i, j int) (ret bool) { ret = reflect.ValueOf(ii).String() < reflect.ValueOf(ij).String() } }() - return reflect.ValueOf(ii).Int() < reflect.ValueOf(ij).Int() + return ii < ij } return true } else if okj { diff --git a/vendor/github.com/go-openapi/spec/responses.go b/vendor/github.com/go-openapi/spec/responses.go index 4efb6f868b..16c3076fe8 100644 --- a/vendor/github.com/go-openapi/spec/responses.go +++ b/vendor/github.com/go-openapi/spec/responses.go @@ -19,6 +19,7 @@ import ( "fmt" "reflect" "strconv" + "strings" "github.com/go-openapi/swag" ) @@ -62,6 +63,7 @@ func (r *Responses) UnmarshalJSON(data []byte) error { if err := json.Unmarshal(data, &r.ResponsesProps); err != nil { return err } + if err := json.Unmarshal(data, &r.VendorExtensible); err != nil { return err } @@ -107,20 +109,31 @@ func (r ResponsesProps) MarshalJSON() ([]byte, error) { // UnmarshalJSON unmarshals responses from JSON func (r *ResponsesProps) UnmarshalJSON(data []byte) error { - var res map[string]Response + var res map[string]json.RawMessage if err := json.Unmarshal(data, &res); err != nil { - return nil + return err } + if v, ok := res["default"]; ok { - r.Default = &v + var defaultRes Response + if err := json.Unmarshal(v, &defaultRes); err != nil { + return err + } + r.Default = &defaultRes delete(res, "default") } for k, v := range res { - if nk, err := strconv.Atoi(k); err == nil { - if r.StatusCodeResponses == nil { - r.StatusCodeResponses = map[int]Response{} + if !strings.HasPrefix(k, "x-") { + var statusCodeResp Response + if err := json.Unmarshal(v, &statusCodeResp); err != nil { + return err + } + if nk, err := strconv.Atoi(k); err == nil { + if r.StatusCodeResponses == nil { + r.StatusCodeResponses = map[int]Response{} + } + r.StatusCodeResponses[nk] = statusCodeResp } - r.StatusCodeResponses[nk] = v } } return nil diff --git a/vendor/github.com/go-openapi/strfmt/.golangci.yml b/vendor/github.com/go-openapi/strfmt/.golangci.yml index d36b25665c..be4899cb12 100644 --- a/vendor/github.com/go-openapi/strfmt/.golangci.yml +++ b/vendor/github.com/go-openapi/strfmt/.golangci.yml @@ -14,31 +14,40 @@ linters-settings: min-occurrences: 4 linters: - enable-all: true - disable: - - maligned - - lll - - gochecknoinits - - gochecknoglobals - - godox - - gocognit - - whitespace - - wsl - - funlen - - wrapcheck - - testpackage - - nlreturn - - gofumpt - - goerr113 - - gci - - gomnd - - godot - - exhaustivestruct - - paralleltest - - varnamelen - - ireturn - - exhaustruct - #- thelper + enable: + - revive + - goimports + - gosec + - unparam + - unconvert + - predeclared + - prealloc + - misspell + + # disable: + # - maligned + # - lll + # - gochecknoinits + # - gochecknoglobals + # - godox + # - gocognit + # - whitespace + # - wsl + # - funlen + # - wrapcheck + # - testpackage + # - nlreturn + # - gofumpt + # - goerr113 + # - gci + # - gomnd + # - godot + # - exhaustivestruct + # - paralleltest + # - varnamelen + # - ireturn + # - exhaustruct + # #- thelper issues: exclude-rules: diff --git a/vendor/github.com/go-openapi/strfmt/bson.go b/vendor/github.com/go-openapi/strfmt/bson.go index 8740b15059..a8a3604a2c 100644 --- a/vendor/github.com/go-openapi/strfmt/bson.go +++ b/vendor/github.com/go-openapi/strfmt/bson.go @@ -142,7 +142,7 @@ func (id ObjectId) MarshalBSONValue() (bsontype.Type, []byte, error) { // BSON value representation of themselves. The BSON bytes and type can be // assumed to be valid. UnmarshalBSONValue must copy the BSON value bytes if it // wishes to retain the data after returning. -func (id *ObjectId) UnmarshalBSONValue(tpe bsontype.Type, data []byte) error { +func (id *ObjectId) UnmarshalBSONValue(_ bsontype.Type, data []byte) error { var oid bsonprim.ObjectID copy(oid[:], data) *id = ObjectId(oid) diff --git a/vendor/github.com/go-openapi/strfmt/date.go b/vendor/github.com/go-openapi/strfmt/date.go index f0b310964d..3c93381c7c 100644 --- a/vendor/github.com/go-openapi/strfmt/date.go +++ b/vendor/github.com/go-openapi/strfmt/date.go @@ -57,7 +57,7 @@ func (d *Date) UnmarshalText(text []byte) error { if len(text) == 0 { return nil } - dd, err := time.Parse(RFC3339FullDate, string(text)) + dd, err := time.ParseInLocation(RFC3339FullDate, string(text), DefaultTimeLocation) if err != nil { return err } @@ -107,7 +107,7 @@ func (d *Date) UnmarshalJSON(data []byte) error { if err := json.Unmarshal(data, &strdate); err != nil { return err } - tt, err := time.Parse(RFC3339FullDate, strdate) + tt, err := time.ParseInLocation(RFC3339FullDate, strdate, DefaultTimeLocation) if err != nil { return err } @@ -126,7 +126,7 @@ func (d *Date) UnmarshalBSON(data []byte) error { } if data, ok := m["data"].(string); ok { - rd, err := time.Parse(RFC3339FullDate, data) + rd, err := time.ParseInLocation(RFC3339FullDate, data, DefaultTimeLocation) if err != nil { return err } diff --git a/vendor/github.com/go-openapi/strfmt/format.go b/vendor/github.com/go-openapi/strfmt/format.go index 172055d22d..ad3b3c355b 100644 --- a/vendor/github.com/go-openapi/strfmt/format.go +++ b/vendor/github.com/go-openapi/strfmt/format.go @@ -109,7 +109,7 @@ func (f *defaultFormats) MapStructureHookFunc() mapstructure.DecodeHookFunc { // if to == tpe { switch v.Name { case "date": - d, err := time.Parse(RFC3339FullDate, data) + d, err := time.ParseInLocation(RFC3339FullDate, data, DefaultTimeLocation) if err != nil { return nil, err } diff --git a/vendor/github.com/go-openapi/strfmt/time.go b/vendor/github.com/go-openapi/strfmt/time.go index 023676e6c9..9bef4c3b33 100644 --- a/vendor/github.com/go-openapi/strfmt/time.go +++ b/vendor/github.com/go-openapi/strfmt/time.go @@ -29,6 +29,12 @@ import ( "go.mongodb.org/mongo-driver/bson/bsontype" ) +var ( + // UnixZero sets the zero unix timestamp we want to compare against. + // Unix 0 for an EST timezone is not equivalent to a UTC timezone. + UnixZero = time.Unix(0, 0).UTC() +) + func init() { dt := DateTime{} Default.Add("datetime", &dt, IsDateTime) @@ -86,6 +92,9 @@ var ( // NormalizeTimeForMarshal provides a normalization function on time befeore marshalling (e.g. time.UTC). // By default, the time value is not changed. NormalizeTimeForMarshal = func(t time.Time) time.Time { return t } + + // DefaultTimeLocation provides a location for a time when the time zone is not encoded in the string (ex: ISO8601 Local variants). + DefaultTimeLocation = time.UTC ) // ParseDateTime parses a string that represents an ISO8601 time or a unix epoch @@ -95,7 +104,7 @@ func ParseDateTime(data string) (DateTime, error) { } var lastError error for _, layout := range DateTimeFormats { - dd, err := time.Parse(layout, data) + dd, err := time.ParseInLocation(layout, data, DefaultTimeLocation) if err != nil { lastError = err continue @@ -123,6 +132,22 @@ func (t DateTime) String() string { return NormalizeTimeForMarshal(time.Time(t)).Format(MarshalFormat) } +// IsZero returns whether the date time is a zero value +func (t *DateTime) IsZero() bool { + if t == nil { + return true + } + return time.Time(*t).IsZero() +} + +// IsUnixZerom returns whether the date time is equivalent to time.Unix(0, 0).UTC(). +func (t *DateTime) IsUnixZero() bool { + if t == nil { + return true + } + return time.Time(*t).Equal(UnixZero) +} + // MarshalText implements the text marshaller interface func (t DateTime) MarshalText() ([]byte, error) { return []byte(t.String()), nil diff --git a/vendor/github.com/go-openapi/strfmt/ulid.go b/vendor/github.com/go-openapi/strfmt/ulid.go index 4bd2ccd8f6..e71aff7c36 100644 --- a/vendor/github.com/go-openapi/strfmt/ulid.go +++ b/vendor/github.com/go-openapi/strfmt/ulid.go @@ -15,9 +15,12 @@ import ( // ULID represents a ulid string format // ref: -// https://github.com/ulid/spec +// +// https://github.com/ulid/spec +// // impl: -// https://github.com/oklog/ulid +// +// https://github.com/oklog/ulid // // swagger:strfmt ulid type ULID struct { @@ -89,7 +92,9 @@ func NewULIDZero() ULID { } // NewULID generates new unique ULID value and a error if any -func NewULID() (u ULID, err error) { +func NewULID() (ULID, error) { + var u ULID + obj := ulidEntropyPool.Get() entropy, ok := obj.(io.Reader) if !ok { diff --git a/vendor/github.com/go-openapi/swag/util.go b/vendor/github.com/go-openapi/swag/util.go index f78ab684a0..d971fbe34b 100644 --- a/vendor/github.com/go-openapi/swag/util.go +++ b/vendor/github.com/go-openapi/swag/util.go @@ -341,12 +341,21 @@ type zeroable interface { // IsZero returns true when the value passed into the function is a zero value. // This allows for safer checking of interface values. func IsZero(data interface{}) bool { + v := reflect.ValueOf(data) + // check for nil data + switch v.Kind() { + case reflect.Interface, reflect.Map, reflect.Ptr, reflect.Slice: + if v.IsNil() { + return true + } + } + // check for things that have an IsZero method instead if vv, ok := data.(zeroable); ok { return vv.IsZero() } + // continue with slightly more complex reflection - v := reflect.ValueOf(data) switch v.Kind() { case reflect.String: return v.Len() == 0 @@ -358,14 +367,13 @@ func IsZero(data interface{}) bool { return v.Uint() == 0 case reflect.Float32, reflect.Float64: return v.Float() == 0 - case reflect.Interface, reflect.Map, reflect.Ptr, reflect.Slice: - return v.IsNil() case reflect.Struct, reflect.Array: return reflect.DeepEqual(data, reflect.Zero(v.Type()).Interface()) case reflect.Invalid: return true + default: + return false } - return false } // AddInitialisms add additional initialisms diff --git a/vendor/github.com/go-openapi/validate/values.go b/vendor/github.com/go-openapi/validate/values.go index c88d35d7f2..e7ad8c1033 100644 --- a/vendor/github.com/go-openapi/validate/values.go +++ b/vendor/github.com/go-openapi/validate/values.go @@ -248,7 +248,7 @@ func MinimumUint(path, in string, data, min uint64, exclusive bool) *errors.Vali // MultipleOf validates if the provided number is a multiple of the factor func MultipleOf(path, in string, data, factor float64) *errors.Validation { // multipleOf factor must be positive - if factor < 0 { + if factor <= 0 { return errors.MultipleOfMustBePositive(path, in, factor) } var mult float64 @@ -266,7 +266,7 @@ func MultipleOf(path, in string, data, factor float64) *errors.Validation { // MultipleOfInt validates if the provided integer is a multiple of the factor func MultipleOfInt(path, in string, data int64, factor int64) *errors.Validation { // multipleOf factor must be positive - if factor < 0 { + if factor <= 0 { return errors.MultipleOfMustBePositive(path, in, factor) } mult := data / factor @@ -278,6 +278,10 @@ func MultipleOfInt(path, in string, data int64, factor int64) *errors.Validation // MultipleOfUint validates if the provided unsigned integer is a multiple of the factor func MultipleOfUint(path, in string, data, factor uint64) *errors.Validation { + // multipleOf factor must be positive + if factor == 0 { + return errors.MultipleOfMustBePositive(path, in, factor) + } mult := data / factor if mult*factor != data { return errors.NotMultipleOf(path, in, factor, data) diff --git a/vendor/github.com/klauspost/cpuid/v2/.gitignore b/vendor/github.com/klauspost/cpuid/v2/.gitignore new file mode 100644 index 0000000000..daf913b1b3 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/.gitignore @@ -0,0 +1,24 @@ +# Compiled Object files, Static and Dynamic libs (Shared Objects) +*.o +*.a +*.so + +# Folders +_obj +_test + +# Architecture specific extensions/prefixes +*.[568vq] +[568vq].out + +*.cgo1.go +*.cgo2.c +_cgo_defun.c +_cgo_gotypes.go +_cgo_export.* + +_testmain.go + +*.exe +*.test +*.prof diff --git a/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml b/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml new file mode 100644 index 0000000000..944cc00075 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml @@ -0,0 +1,74 @@ +# This is an example goreleaser.yaml file with some sane defaults. +# Make sure to check the documentation at http://goreleaser.com + +builds: + - + id: "cpuid" + binary: cpuid + main: ./cmd/cpuid/main.go + env: + - CGO_ENABLED=0 + flags: + - -ldflags=-s -w + goos: + - aix + - linux + - freebsd + - netbsd + - windows + - darwin + goarch: + - 386 + - amd64 + - arm64 + goarm: + - 7 + +archives: + - + id: cpuid + name_template: "cpuid-{{ .Os }}_{{ .Arch }}_{{ .Version }}" + replacements: + aix: AIX + darwin: OSX + linux: Linux + windows: Windows + 386: i386 + amd64: x86_64 + freebsd: FreeBSD + netbsd: NetBSD + format_overrides: + - goos: windows + format: zip + files: + - LICENSE +checksum: + name_template: 'checksums.txt' +snapshot: + name_template: "{{ .Tag }}-next" +changelog: + sort: asc + filters: + exclude: + - '^doc:' + - '^docs:' + - '^test:' + - '^tests:' + - '^Update\sREADME.md' + +nfpms: + - + file_name_template: "cpuid_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}" + vendor: Klaus Post + homepage: https://github.com/klauspost/cpuid + maintainer: Klaus Post <klauspost@gmail.com> + description: CPUID Tool + license: BSD 3-Clause + formats: + - deb + - rpm + replacements: + darwin: Darwin + linux: Linux + freebsd: FreeBSD + amd64: x86_64 diff --git a/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt b/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt new file mode 100644 index 0000000000..2ef4714f71 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt @@ -0,0 +1,35 @@ +Developer Certificate of Origin +Version 1.1 + +Copyright (C) 2015- Klaus Post & Contributors. +Email: klauspost@gmail.com + +Everyone is permitted to copy and distribute verbatim copies of this +license document, but changing it is not allowed. + + +Developer's Certificate of Origin 1.1 + +By making a contribution to this project, I certify that: + +(a) The contribution was created in whole or in part by me and I + have the right to submit it under the open source license + indicated in the file; or + +(b) The contribution is based upon previous work that, to the best + of my knowledge, is covered under an appropriate open source + license and I have the right under that license to submit that + work with modifications, whether created in whole or in part + by me, under the same open source license (unless I am + permitted to submit under a different license), as indicated + in the file; or + +(c) The contribution was provided directly to me by some other + person who certified (a), (b) or (c) and I have not modified + it. + +(d) I understand and agree that this project and the contribution + are public and that a record of the contribution (including all + personal information I submit with it, including my sign-off) is + maintained indefinitely and may be redistributed consistent with + this project or the open source license(s) involved. diff --git a/vendor/github.com/klauspost/cpuid/v2/LICENSE b/vendor/github.com/klauspost/cpuid/v2/LICENSE new file mode 100644 index 0000000000..5cec7ee949 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/LICENSE @@ -0,0 +1,22 @@ +The MIT License (MIT) + +Copyright (c) 2015 Klaus Post + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. + diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md new file mode 100644 index 0000000000..accd7abaf9 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -0,0 +1,493 @@ +# cpuid +Package cpuid provides information about the CPU running the current program. + +CPU features are detected on startup, and kept for fast access through the life of the application. +Currently x86 / x64 (AMD64/i386) and ARM (ARM64) is supported, and no external C (cgo) code is used, which should make the library very easy to use. + +You can access the CPU information by accessing the shared CPU variable of the cpuid library. + +Package home: https://github.com/klauspost/cpuid + +[](https://pkg.go.dev/github.com/klauspost/cpuid/v2) +[![Build Status][3]][4] + +[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master +[4]: https://travis-ci.org/klauspost/cpuid + +## installing + +`go get -u github.com/klauspost/cpuid/v2` using modules. +Drop `v2` for others. + +Installing binary: + +`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest` + +Or download binaries from release page: https://github.com/klauspost/cpuid/releases + +### Homebrew + +For macOS/Linux users, you can install via [brew](https://brew.sh/) + +```sh +$ brew install cpuid +``` + +## example + +```Go +package main + +import ( + "fmt" + "strings" + + . "github.com/klauspost/cpuid/v2" +) + +func main() { + // Print basic CPU information: + fmt.Println("Name:", CPU.BrandName) + fmt.Println("PhysicalCores:", CPU.PhysicalCores) + fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore) + fmt.Println("LogicalCores:", CPU.LogicalCores) + fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID) + fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ",")) + fmt.Println("Cacheline bytes:", CPU.CacheLine) + fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes") + fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes") + fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes") + fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes") + fmt.Println("Frequency", CPU.Hz, "hz") + + // Test if we have these specific features: + if CPU.Supports(SSE, SSE2) { + fmt.Println("We have Streaming SIMD 2 Extensions") + } +} +``` + +Sample output: +``` +>go run main.go +Name: AMD Ryzen 9 3950X 16-Core Processor +PhysicalCores: 16 +ThreadsPerCore: 2 +LogicalCores: 32 +Family 23 Model: 113 Vendor ID: AMD +Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CMOV,CX16,F16C,FMA3,HTT,HYPERVISOR,LZCNT,MMX,MMXEXT,NX,POPCNT,RDRAND,RDSEED,RDTSCP,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3 +Cacheline bytes: 64 +L1 Data Cache: 32768 bytes +L1 Instruction Cache: 32768 bytes +L2 Cache: 524288 bytes +L3 Cache: 16777216 bytes +Frequency 0 hz +We have Streaming SIMD 2 Extensions +``` + +# usage + +The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features. +A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler. + +To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc. +This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported. + +Note that for some cpu/os combinations some features will not be detected. +`amd64` has rather good support and should work reliably on all platforms. + +Note that hypervisors may not pass through all CPU features through to the guest OS, +so even if your host supports a feature it may not be visible on guests. + +## arm64 feature detection + +Not all operating systems provide ARM features directly +and there is no safe way to do so for the rest. + +Currently `arm64/linux` and `arm64/freebsd` should be quite reliable. +`arm64/darwin` adds features expected from the M1 processor, but a lot remains undetected. + +A `DetectARM()` can be used if you are able to control your deployment, +it will detect CPU features, but may crash if the OS doesn't intercept the calls. +A `-cpu.arm` flag for detecting unsafe ARM features can be added. See below. + +Note that currently only features are detected on ARM, +no additional information is currently available. + +## flags + +It is possible to add flags that affects cpu detection. + +For this the `Flags()` command is provided. + +This must be called *before* `flag.Parse()` AND after the flags have been parsed `Detect()` must be called. + +This means that any detection used in `init()` functions will not contain these flags. + +Example: + +```Go +package main + +import ( + "flag" + "fmt" + "strings" + + "github.com/klauspost/cpuid/v2" +) + +func main() { + cpuid.Flags() + flag.Parse() + cpuid.Detect() + + // Test if we have these specific features: + if cpuid.CPU.Supports(cpuid.SSE, cpuid.SSE2) { + fmt.Println("We have Streaming SIMD 2 Extensions") + } +} +``` + +## commandline + +Download as binary from: https://github.com/klauspost/cpuid/releases + +Install from source: + +`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest` + +### Example + +``` +λ cpuid +Name: AMD Ryzen 9 3950X 16-Core Processor +Vendor String: AuthenticAMD +Vendor ID: AMD +PhysicalCores: 16 +Threads Per Core: 2 +Logical Cores: 32 +CPU Family 23 Model: 113 +Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE +Microarchitecture level: 3 +Cacheline bytes: 64 +L1 Instruction Cache: 32768 bytes +L1 Data Cache: 32768 bytes +L2 Cache: 524288 bytes +L3 Cache: 16777216 bytes + +``` +### JSON Output: + +``` +λ cpuid --json +{ + "BrandName": "AMD Ryzen 9 3950X 16-Core Processor", + "VendorID": 2, + "VendorString": "AuthenticAMD", + "PhysicalCores": 16, + "ThreadsPerCore": 2, + "LogicalCores": 32, + "Family": 23, + "Model": 113, + "CacheLine": 64, + "Hz": 0, + "BoostFreq": 0, + "Cache": { + "L1I": 32768, + "L1D": 32768, + "L2": 524288, + "L3": 16777216 + }, + "SGX": { + "Available": false, + "LaunchControl": false, + "SGX1Supported": false, + "SGX2Supported": false, + "MaxEnclaveSizeNot64": 0, + "MaxEnclaveSize64": 0, + "EPCSections": null + }, + "Features": [ + "ADX", + "AESNI", + "AVX", + "AVX2", + "BMI1", + "BMI2", + "CLMUL", + "CLZERO", + "CMOV", + "CMPXCHG8", + "CPBOOST", + "CX16", + "F16C", + "FMA3", + "FXSR", + "FXSROPT", + "HTT", + "HYPERVISOR", + "LAHF", + "LZCNT", + "MCAOVERFLOW", + "MMX", + "MMXEXT", + "MOVBE", + "NX", + "OSXSAVE", + "POPCNT", + "RDRAND", + "RDSEED", + "RDTSCP", + "SCE", + "SHA", + "SSE", + "SSE2", + "SSE3", + "SSE4", + "SSE42", + "SSE4A", + "SSSE3", + "SUCCOR", + "X87", + "XSAVE" + ], + "X64Level": 3 +} +``` + +### Check CPU microarch level + +``` +λ cpuid --check-level=3 +2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3. +Exit Code 0 + +λ cpuid --check-level=4 +2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3. +Exit Code 1 +``` + + +## Available flags + +### x86 & amd64 + +| Feature Flag | Description | +|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------| +| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) | +| AESNI | Advanced Encryption Standard New Instructions | +| AMD3DNOW | AMD 3DNOW | +| AMD3DNOWEXT | AMD 3DNowExt | +| AMXBF16 | Tile computational operations on BFLOAT16 numbers | +| AMXINT8 | Tile computational operations on 8-bit integers | +| AMXFP16 | Tile computational operations on FP16 numbers | +| AMXTILE | Tile architecture | +| AVX | AVX functions | +| AVX2 | AVX2 functions | +| AVX512BF16 | AVX-512 BFLOAT16 Instructions | +| AVX512BITALG | AVX-512 Bit Algorithms | +| AVX512BW | AVX-512 Byte and Word Instructions | +| AVX512CD | AVX-512 Conflict Detection Instructions | +| AVX512DQ | AVX-512 Doubleword and Quadword Instructions | +| AVX512ER | AVX-512 Exponential and Reciprocal Instructions | +| AVX512F | AVX-512 Foundation | +| AVX512FP16 | AVX-512 FP16 Instructions | +| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions | +| AVX512PF | AVX-512 Prefetch Instructions | +| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions | +| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 | +| AVX512VL | AVX-512 Vector Length Extensions | +| AVX512VNNI | AVX-512 Vector Neural Network Instructions | +| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q | +| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword | +| AVXIFMA | AVX-IFMA instructions | +| AVXNECONVERT | AVX-NE-CONVERT instructions | +| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one | +| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions | +| AVXVNNIINT8 | AVX-VNNI-INT8 instructions | +| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 | +| BMI1 | Bit Manipulation Instruction Set 1 | +| BMI2 | Bit Manipulation Instruction Set 2 | +| CETIBT | Intel CET Indirect Branch Tracking | +| CETSS | Intel CET Shadow Stack | +| CLDEMOTE | Cache Line Demote | +| CLMUL | Carry-less Multiplication | +| CLZERO | CLZERO instruction supported | +| CMOV | i686 CMOV | +| CMPCCXADD | CMPCCXADD instructions | +| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB | +| CMPXCHG8 | CMPXCHG8 instruction | +| CPBOOST | Core Performance Boost | +| CPPC | AMD: Collaborative Processor Performance Control | +| CX16 | CMPXCHG16B Instruction | +| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ | +| ENQCMD | Enqueue Command | +| ERMS | Enhanced REP MOVSB/STOSB | +| F16C | Half-precision floating-point conversion | +| FLUSH_L1D | Flush L1D cache | +| FMA3 | Intel FMA 3. Does not imply AVX. | +| FMA4 | Bulldozer FMA4 functions | +| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide | +| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide | +| FSRM | Fast Short Rep Mov | +| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 | +| FXSROPT | FXSAVE/FXRSTOR optimizations | +| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. | +| HLE | Hardware Lock Elision | +| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR | +| HTT | Hyperthreading (enabled) | +| HWA | Hardware assert supported. Indicates support for MSRC001_10 | +| HYBRID_CPU | This part has CPUs of more than one type. | +| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors | +| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) | +| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR | +| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) | +| IBRS | AMD: Indirect Branch Restricted Speculation | +| IBRS_PREFERRED | AMD: IBRS is preferred over software solution | +| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection | +| IBS | Instruction Based Sampling (AMD) | +| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) | +| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) | +| IBSFFV | Instruction Based Sampling Feature (AMD) | +| IBSOPCNT | Instruction Based Sampling Feature (AMD) | +| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) | +| IBSOPSAM | Instruction Based Sampling Feature (AMD) | +| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) | +| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) | +| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported | +| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported | +| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse | +| IBS_PREVENTHOST | Disallowing IBS use by the host supported | +| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 | +| IDPRED_CTRL | IPRED_DIS | +| INT_WBINVD | WBINVD/WBNOINVD are interruptible. | +| INVLPGB | NVLPGB and TLBSYNC instruction supported | +| LAHF | LAHF/SAHF in long mode | +| LAM | If set, CPU supports Linear Address Masking | +| LBRVIRT | LBR virtualization | +| LZCNT | LZCNT instruction | +| MCAOVERFLOW | MCA overflow recovery support. | +| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. | +| MCOMMIT | MCOMMIT instruction supported | +| MD_CLEAR | VERW clears CPU buffers | +| MMX | standard MMX | +| MMXEXT | SSE integer functions or AMD MMX ext | +| MOVBE | MOVBE instruction (big-endian) | +| MOVDIR64B | Move 64 Bytes as Direct Store | +| MOVDIRI | Move Doubleword as Direct Store | +| MOVSB_ZL | Fast Zero-Length MOVSB | +| MPX | Intel MPX (Memory Protection Extensions) | +| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | +| MSRIRC | Instruction Retired Counter MSR available | +| MSRLIST | Read/Write List of Model Specific Registers | +| MSR_PAGEFLUSH | Page Flush MSR available | +| NRIPS | Indicates support for NRIP save on VMEXIT | +| NX | NX (No-Execute) bit | +| OSXSAVE | XSAVE enabled by OS | +| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption | +| POPCNT | POPCNT instruction | +| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled | +| PREFETCHI | PREFETCHIT0/1 instructions | +| PSFD | Predictive Store Forward Disable | +| RDPRU | RDPRU instruction supported | +| RDRAND | RDRAND instruction is available | +| RDSEED | RDSEED instruction is available | +| RDTSCP | RDTSCP Instruction | +| RRSBA_CTRL | Restricted RSB Alternate | +| RTM | Restricted Transactional Memory | +| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. | +| SERIALIZE | Serialize Instruction Execution | +| SEV | AMD Secure Encrypted Virtualization supported | +| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host | +| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported | +| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests | +| SEV_ES | AMD SEV Encrypted State supported | +| SEV_RESTRICTED | AMD SEV Restricted Injection supported | +| SEV_SNP | AMD SEV Secure Nested Paging supported | +| SGX | Software Guard Extensions | +| SGXLC | Software Guard Extensions Launch Control | +| SHA | Intel SHA Extensions | +| SME | AMD Secure Memory Encryption supported | +| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced | +| SPEC_CTRL_SSBD | Speculative Store Bypass Disable | +| SRBDS_CTRL | SRBDS mitigation MSR available | +| SSE | SSE functions | +| SSE2 | P4 SSE functions | +| SSE3 | Prescott SSE3 functions | +| SSE4 | Penryn SSE4.1 functions | +| SSE42 | Nehalem SSE4.2 functions | +| SSE4A | AMD Barcelona microarchitecture SSE4a instructions | +| SSSE3 | Conroe SSSE3 functions | +| STIBP | Single Thread Indirect Branch Predictors | +| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On | +| STOSB_SHORT | Fast short STOSB | +| SUCCOR | Software uncorrectable error containment and recovery capability. | +| SVM | AMD Secure Virtual Machine | +| SVMDA | Indicates support for the SVM decode assists. | +| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control | +| SVML | AMD SVM lock. Indicates support for SVM-Lock. | +| SVMNP | AMD SVM nested paging | +| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter | +| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold | +| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. | +| SYSEE | SYSENTER and SYSEXIT instructions | +| TBM | AMD Trailing Bit Manipulation | +| TDX_GUEST | Intel Trust Domain Extensions Guest | +| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations | +| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. | +| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. | +| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 | +| TSXLDTRK | Intel TSX Suspend Load Address Tracking | +| VAES | Vector AES. AVX(512) versions requires additional checks. | +| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. | +| VMPL | AMD VM Permission Levels supported | +| VMSA_REGPROT | AMD VMSA Register Protection supported | +| VMX | Virtual Machine Extensions | +| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. | +| VTE | AMD Virtual Transparent Encryption supported | +| WAITPKG | TPAUSE, UMONITOR, UMWAIT | +| WBNOINVD | Write Back and Do Not Invalidate Cache | +| WRMSRNS | Non-Serializing Write to Model Specific Register | +| X87 | FPU | +| XGETBV1 | Supports XGETBV with ECX = 1 | +| XOP | Bulldozer XOP functions | +| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV | +| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. | +| XSAVEOPT | XSAVEOPT available | +| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS | + +# ARM features: + +| Feature Flag | Description | +|--------------|------------------------------------------------------------------| +| AESARM | AES instructions | +| ARMCPUID | Some CPU ID registers readable at user-level | +| ASIMD | Advanced SIMD | +| ASIMDDP | SIMD Dot Product | +| ASIMDHP | Advanced SIMD half-precision floating point | +| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) | +| ATOMICS | Large System Extensions (LSE) | +| CRC32 | CRC32/CRC32C instructions | +| DCPOP | Data cache clean to Point of Persistence (DC CVAP) | +| EVTSTRM | Generic timer | +| FCMA | Floatin point complex number addition and multiplication | +| FP | Single-precision and double-precision floating point | +| FPHP | Half-precision floating point | +| GPA | Generic Pointer Authentication | +| JSCVT | Javascript-style double->int convert (FJCVTZS) | +| LRCPC | Weaker release consistency (LDAPR, etc) | +| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) | +| SHA1 | SHA-1 instructions (SHA1C, etc) | +| SHA2 | SHA-2 instructions (SHA256H, etc) | +| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) | +| SHA512 | SHA512 instructions | +| SM3 | SM3 instructions | +| SM4 | SM4 instructions | +| SVE | Scalable Vector Extension | + +# license + +This code is published under an MIT license. See LICENSE file for more information. diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go new file mode 100644 index 0000000000..d015c744e8 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -0,0 +1,1427 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +// Package cpuid provides information about the CPU running the current program. +// +// CPU features are detected on startup, and kept for fast access through the life of the application. +// Currently x86 / x64 (AMD64) as well as arm64 is supported. +// +// You can access the CPU information by accessing the shared CPU variable of the cpuid library. +// +// Package home: https://github.com/klauspost/cpuid +package cpuid + +import ( + "flag" + "fmt" + "math" + "math/bits" + "os" + "runtime" + "strings" +) + +// AMD refererence: https://www.amd.com/system/files/TechDocs/25481.pdf +// and Processor Programming Reference (PPR) + +// Vendor is a representation of a CPU vendor. +type Vendor int + +const ( + VendorUnknown Vendor = iota + Intel + AMD + VIA + Transmeta + NSC + KVM // Kernel-based Virtual Machine + MSVM // Microsoft Hyper-V or Windows Virtual PC + VMware + XenHVM + Bhyve + Hygon + SiS + RDC + + Ampere + ARM + Broadcom + Cavium + DEC + Fujitsu + Infineon + Motorola + NVIDIA + AMCC + Qualcomm + Marvell + + lastVendor +) + +//go:generate stringer -type=FeatureID,Vendor + +// FeatureID is the ID of a specific cpu feature. +type FeatureID int + +const ( + // Keep index -1 as unknown + UNKNOWN = -1 + + // Add features + ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) + AESNI // Advanced Encryption Standard New Instructions + AMD3DNOW // AMD 3DNOW + AMD3DNOWEXT // AMD 3DNowExt + AMXBF16 // Tile computational operations on BFLOAT16 numbers + AMXFP16 // Tile computational operations on FP16 numbers + AMXINT8 // Tile computational operations on 8-bit integers + AMXTILE // Tile architecture + AVX // AVX functions + AVX2 // AVX2 functions + AVX512BF16 // AVX-512 BFLOAT16 Instructions + AVX512BITALG // AVX-512 Bit Algorithms + AVX512BW // AVX-512 Byte and Word Instructions + AVX512CD // AVX-512 Conflict Detection Instructions + AVX512DQ // AVX-512 Doubleword and Quadword Instructions + AVX512ER // AVX-512 Exponential and Reciprocal Instructions + AVX512F // AVX-512 Foundation + AVX512FP16 // AVX-512 FP16 Instructions + AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions + AVX512PF // AVX-512 Prefetch Instructions + AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions + AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 + AVX512VL // AVX-512 Vector Length Extensions + AVX512VNNI // AVX-512 Vector Neural Network Instructions + AVX512VP2INTERSECT // AVX-512 Intersect for D/Q + AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword + AVXIFMA // AVX-IFMA instructions + AVXNECONVERT // AVX-NE-CONVERT instructions + AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one + AVXVNNI // AVX (VEX encoded) VNNI neural network instructions + AVXVNNIINT8 // AVX-VNNI-INT8 instructions + BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 + BMI1 // Bit Manipulation Instruction Set 1 + BMI2 // Bit Manipulation Instruction Set 2 + CETIBT // Intel CET Indirect Branch Tracking + CETSS // Intel CET Shadow Stack + CLDEMOTE // Cache Line Demote + CLMUL // Carry-less Multiplication + CLZERO // CLZERO instruction supported + CMOV // i686 CMOV + CMPCCXADD // CMPCCXADD instructions + CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB + CMPXCHG8 // CMPXCHG8 instruction + CPBOOST // Core Performance Boost + CPPC // AMD: Collaborative Processor Performance Control + CX16 // CMPXCHG16B Instruction + EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ + ENQCMD // Enqueue Command + ERMS // Enhanced REP MOVSB/STOSB + F16C // Half-precision floating-point conversion + FLUSH_L1D // Flush L1D cache + FMA3 // Intel FMA 3. Does not imply AVX. + FMA4 // Bulldozer FMA4 functions + FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide + FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide + FSRM // Fast Short Rep Mov + FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 + FXSROPT // FXSAVE/FXRSTOR optimizations + GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. + HLE // Hardware Lock Elision + HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR + HTT // Hyperthreading (enabled) + HWA // Hardware assert supported. Indicates support for MSRC001_10 + HYBRID_CPU // This part has CPUs of more than one type. + HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors + IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) + IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR + IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) + IBRS // AMD: Indirect Branch Restricted Speculation + IBRS_PREFERRED // AMD: IBRS is preferred over software solution + IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection + IBS // Instruction Based Sampling (AMD) + IBSBRNTRGT // Instruction Based Sampling Feature (AMD) + IBSFETCHSAM // Instruction Based Sampling Feature (AMD) + IBSFFV // Instruction Based Sampling Feature (AMD) + IBSOPCNT // Instruction Based Sampling Feature (AMD) + IBSOPCNTEXT // Instruction Based Sampling Feature (AMD) + IBSOPSAM // Instruction Based Sampling Feature (AMD) + IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) + IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) + IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported + IBS_OPDATA4 // AMD: IBS op data 4 MSR supported + IBS_OPFUSE // AMD: Indicates support for IbsOpFuse + IBS_PREVENTHOST // Disallowing IBS use by the host supported + IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 + IDPRED_CTRL // IPRED_DIS + INT_WBINVD // WBINVD/WBNOINVD are interruptible. + INVLPGB // NVLPGB and TLBSYNC instruction supported + LAHF // LAHF/SAHF in long mode + LAM // If set, CPU supports Linear Address Masking + LBRVIRT // LBR virtualization + LZCNT // LZCNT instruction + MCAOVERFLOW // MCA overflow recovery support. + MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. + MCOMMIT // MCOMMIT instruction supported + MD_CLEAR // VERW clears CPU buffers + MMX // standard MMX + MMXEXT // SSE integer functions or AMD MMX ext + MOVBE // MOVBE instruction (big-endian) + MOVDIR64B // Move 64 Bytes as Direct Store + MOVDIRI // Move Doubleword as Direct Store + MOVSB_ZL // Fast Zero-Length MOVSB + MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD + MPX // Intel MPX (Memory Protection Extensions) + MSRIRC // Instruction Retired Counter MSR available + MSRLIST // Read/Write List of Model Specific Registers + MSR_PAGEFLUSH // Page Flush MSR available + NRIPS // Indicates support for NRIP save on VMEXIT + NX // NX (No-Execute) bit + OSXSAVE // XSAVE enabled by OS + PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption + POPCNT // POPCNT instruction + PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled + PREFETCHI // PREFETCHIT0/1 instructions + PSFD // Predictive Store Forward Disable + RDPRU // RDPRU instruction supported + RDRAND // RDRAND instruction is available + RDSEED // RDSEED instruction is available + RDTSCP // RDTSCP Instruction + RRSBA_CTRL // Restricted RSB Alternate + RTM // Restricted Transactional Memory + RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. + SERIALIZE // Serialize Instruction Execution + SEV // AMD Secure Encrypted Virtualization supported + SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host + SEV_ALTERNATIVE // AMD SEV Alternate Injection supported + SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests + SEV_ES // AMD SEV Encrypted State supported + SEV_RESTRICTED // AMD SEV Restricted Injection supported + SEV_SNP // AMD SEV Secure Nested Paging supported + SGX // Software Guard Extensions + SGXLC // Software Guard Extensions Launch Control + SHA // Intel SHA Extensions + SME // AMD Secure Memory Encryption supported + SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced + SPEC_CTRL_SSBD // Speculative Store Bypass Disable + SRBDS_CTRL // SRBDS mitigation MSR available + SSE // SSE functions + SSE2 // P4 SSE functions + SSE3 // Prescott SSE3 functions + SSE4 // Penryn SSE4.1 functions + SSE42 // Nehalem SSE4.2 functions + SSE4A // AMD Barcelona microarchitecture SSE4a instructions + SSSE3 // Conroe SSSE3 functions + STIBP // Single Thread Indirect Branch Predictors + STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On + STOSB_SHORT // Fast short STOSB + SUCCOR // Software uncorrectable error containment and recovery capability. + SVM // AMD Secure Virtual Machine + SVMDA // Indicates support for the SVM decode assists. + SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control + SVML // AMD SVM lock. Indicates support for SVM-Lock. + SVMNP // AMD SVM nested paging + SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter + SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold + SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. + SYSEE // SYSENTER and SYSEXIT instructions + TBM // AMD Trailing Bit Manipulation + TDX_GUEST // Intel Trust Domain Extensions Guest + TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations + TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. + TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 + TSXLDTRK // Intel TSX Suspend Load Address Tracking + VAES // Vector AES. AVX(512) versions requires additional checks. + VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. + VMPL // AMD VM Permission Levels supported + VMSA_REGPROT // AMD VMSA Register Protection supported + VMX // Virtual Machine Extensions + VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. + VTE // AMD Virtual Transparent Encryption supported + WAITPKG // TPAUSE, UMONITOR, UMWAIT + WBNOINVD // Write Back and Do Not Invalidate Cache + WRMSRNS // Non-Serializing Write to Model Specific Register + X87 // FPU + XGETBV1 // Supports XGETBV with ECX = 1 + XOP // Bulldozer XOP functions + XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV + XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. + XSAVEOPT // XSAVEOPT available + XSAVES // Supports XSAVES/XRSTORS and IA32_XSS + + // ARM features: + AESARM // AES instructions + ARMCPUID // Some CPU ID registers readable at user-level + ASIMD // Advanced SIMD + ASIMDDP // SIMD Dot Product + ASIMDHP // Advanced SIMD half-precision floating point + ASIMDRDM // Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) + ATOMICS // Large System Extensions (LSE) + CRC32 // CRC32/CRC32C instructions + DCPOP // Data cache clean to Point of Persistence (DC CVAP) + EVTSTRM // Generic timer + FCMA // Floatin point complex number addition and multiplication + FP // Single-precision and double-precision floating point + FPHP // Half-precision floating point + GPA // Generic Pointer Authentication + JSCVT // Javascript-style double->int convert (FJCVTZS) + LRCPC // Weaker release consistency (LDAPR, etc) + PMULL // Polynomial Multiply instructions (PMULL/PMULL2) + SHA1 // SHA-1 instructions (SHA1C, etc) + SHA2 // SHA-2 instructions (SHA256H, etc) + SHA3 // SHA-3 instructions (EOR3, RAXI, XAR, BCAX) + SHA512 // SHA512 instructions + SM3 // SM3 instructions + SM4 // SM4 instructions + SVE // Scalable Vector Extension + // Keep it last. It automatically defines the size of []flagSet + lastID + + firstID FeatureID = UNKNOWN + 1 +) + +// CPUInfo contains information about the detected system CPU. +type CPUInfo struct { + BrandName string // Brand name reported by the CPU + VendorID Vendor // Comparable CPU vendor ID + VendorString string // Raw vendor string. + featureSet flagSet // Features of the CPU + PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. + ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. + LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. + Family int // CPU family number + Model int // CPU model number + Stepping int // CPU stepping info + CacheLine int // Cache line size in bytes. Will be 0 if undetectable. + Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. + BoostFreq int64 // Max clock speed, if known, 0 otherwise + Cache struct { + L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected + L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected + L2 int // L2 Cache (per core or shared). Will be -1 if undetected + L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected + } + SGX SGXSupport + maxFunc uint32 + maxExFunc uint32 +} + +var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) +var cpuidex func(op, op2 uint32) (eax, ebx, ecx, edx uint32) +var xgetbv func(index uint32) (eax, edx uint32) +var rdtscpAsm func() (eax, ebx, ecx, edx uint32) +var darwinHasAVX512 = func() bool { return false } + +// CPU contains information about the CPU as detected on startup, +// or when Detect last was called. +// +// Use this as the primary entry point to you data. +var CPU CPUInfo + +func init() { + initCPU() + Detect() +} + +// Detect will re-detect current CPU info. +// This will replace the content of the exported CPU variable. +// +// Unless you expect the CPU to change while you are running your program +// you should not need to call this function. +// If you call this, you must ensure that no other goroutine is accessing the +// exported CPU variable. +func Detect() { + // Set defaults + CPU.ThreadsPerCore = 1 + CPU.Cache.L1I = -1 + CPU.Cache.L1D = -1 + CPU.Cache.L2 = -1 + CPU.Cache.L3 = -1 + safe := true + if detectArmFlag != nil { + safe = !*detectArmFlag + } + addInfo(&CPU, safe) + if displayFeats != nil && *displayFeats { + fmt.Println("cpu features:", strings.Join(CPU.FeatureSet(), ",")) + // Exit with non-zero so tests will print value. + os.Exit(1) + } + if disableFlag != nil { + s := strings.Split(*disableFlag, ",") + for _, feat := range s { + feat := ParseFeature(strings.TrimSpace(feat)) + if feat != UNKNOWN { + CPU.featureSet.unset(feat) + } + } + } +} + +// DetectARM will detect ARM64 features. +// This is NOT done automatically since it can potentially crash +// if the OS does not handle the command. +// If in the future this can be done safely this function may not +// do anything. +func DetectARM() { + addInfo(&CPU, false) +} + +var detectArmFlag *bool +var displayFeats *bool +var disableFlag *string + +// Flags will enable flags. +// This must be called *before* flag.Parse AND +// Detect must be called after the flags have been parsed. +// Note that this means that any detection used in init() functions +// will not contain these flags. +func Flags() { + disableFlag = flag.String("cpu.disable", "", "disable cpu features; comma separated list") + displayFeats = flag.Bool("cpu.features", false, "lists cpu features and exits") + detectArmFlag = flag.Bool("cpu.arm", false, "allow ARM features to be detected; can potentially crash") +} + +// Supports returns whether the CPU supports all of the requested features. +func (c CPUInfo) Supports(ids ...FeatureID) bool { + for _, id := range ids { + if !c.featureSet.inSet(id) { + return false + } + } + return true +} + +// Has allows for checking a single feature. +// Should be inlined by the compiler. +func (c *CPUInfo) Has(id FeatureID) bool { + return c.featureSet.inSet(id) +} + +// AnyOf returns whether the CPU supports one or more of the requested features. +func (c CPUInfo) AnyOf(ids ...FeatureID) bool { + for _, id := range ids { + if c.featureSet.inSet(id) { + return true + } + } + return false +} + +// Features contains several features combined for a fast check using +// CpuInfo.HasAll +type Features *flagSet + +// CombineFeatures allows to combine several features for a close to constant time lookup. +func CombineFeatures(ids ...FeatureID) Features { + var v flagSet + for _, id := range ids { + v.set(id) + } + return &v +} + +func (c *CPUInfo) HasAll(f Features) bool { + return c.featureSet.hasSetP(f) +} + +// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels +var oneOfLevel = CombineFeatures(SYSEE, SYSCALL) +var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2) +var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3) +var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE) +var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL) + +// X64Level returns the microarchitecture level detected on the CPU. +// If features are lacking or non x64 mode, 0 is returned. +// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels +func (c CPUInfo) X64Level() int { + if !c.featureSet.hasOneOf(oneOfLevel) { + return 0 + } + if c.featureSet.hasSetP(level4Features) { + return 4 + } + if c.featureSet.hasSetP(level3Features) { + return 3 + } + if c.featureSet.hasSetP(level2Features) { + return 2 + } + if c.featureSet.hasSetP(level1Features) { + return 1 + } + return 0 +} + +// Disable will disable one or several features. +func (c *CPUInfo) Disable(ids ...FeatureID) bool { + for _, id := range ids { + c.featureSet.unset(id) + } + return true +} + +// Enable will disable one or several features even if they were undetected. +// This is of course not recommended for obvious reasons. +func (c *CPUInfo) Enable(ids ...FeatureID) bool { + for _, id := range ids { + c.featureSet.set(id) + } + return true +} + +// IsVendor returns true if vendor is recognized as Intel +func (c CPUInfo) IsVendor(v Vendor) bool { + return c.VendorID == v +} + +// FeatureSet returns all available features as strings. +func (c CPUInfo) FeatureSet() []string { + s := make([]string, 0, c.featureSet.nEnabled()) + s = append(s, c.featureSet.Strings()...) + return s +} + +// RTCounter returns the 64-bit time-stamp counter +// Uses the RDTSCP instruction. The value 0 is returned +// if the CPU does not support the instruction. +func (c CPUInfo) RTCounter() uint64 { + if !c.Supports(RDTSCP) { + return 0 + } + a, _, _, d := rdtscpAsm() + return uint64(a) | (uint64(d) << 32) +} + +// Ia32TscAux returns the IA32_TSC_AUX part of the RDTSCP. +// This variable is OS dependent, but on Linux contains information +// about the current cpu/core the code is running on. +// If the RDTSCP instruction isn't supported on the CPU, the value 0 is returned. +func (c CPUInfo) Ia32TscAux() uint32 { + if !c.Supports(RDTSCP) { + return 0 + } + _, _, ecx, _ := rdtscpAsm() + return ecx +} + +// LogicalCPU will return the Logical CPU the code is currently executing on. +// This is likely to change when the OS re-schedules the running thread +// to another CPU. +// If the current core cannot be detected, -1 will be returned. +func (c CPUInfo) LogicalCPU() int { + if c.maxFunc < 1 { + return -1 + } + _, ebx, _, _ := cpuid(1) + return int(ebx >> 24) +} + +// frequencies tries to compute the clock speed of the CPU. If leaf 15 is +// supported, use it, otherwise parse the brand string. Yes, really. +func (c *CPUInfo) frequencies() { + c.Hz, c.BoostFreq = 0, 0 + mfi := maxFunctionID() + if mfi >= 0x15 { + eax, ebx, ecx, _ := cpuid(0x15) + if eax != 0 && ebx != 0 && ecx != 0 { + c.Hz = (int64(ecx) * int64(ebx)) / int64(eax) + } + } + if mfi >= 0x16 { + a, b, _, _ := cpuid(0x16) + // Base... + if a&0xffff > 0 { + c.Hz = int64(a&0xffff) * 1_000_000 + } + // Boost... + if b&0xffff > 0 { + c.BoostFreq = int64(b&0xffff) * 1_000_000 + } + } + if c.Hz > 0 { + return + } + + // computeHz determines the official rated speed of a CPU from its brand + // string. This insanity is *actually the official documented way to do + // this according to Intel*, prior to leaf 0x15 existing. The official + // documentation only shows this working for exactly `x.xx` or `xxxx` + // cases, e.g., `2.50GHz` or `1300MHz`; this parser will accept other + // sizes. + model := c.BrandName + hz := strings.LastIndex(model, "Hz") + if hz < 3 { + return + } + var multiplier int64 + switch model[hz-1] { + case 'M': + multiplier = 1000 * 1000 + case 'G': + multiplier = 1000 * 1000 * 1000 + case 'T': + multiplier = 1000 * 1000 * 1000 * 1000 + } + if multiplier == 0 { + return + } + freq := int64(0) + divisor := int64(0) + decimalShift := int64(1) + var i int + for i = hz - 2; i >= 0 && model[i] != ' '; i-- { + if model[i] >= '0' && model[i] <= '9' { + freq += int64(model[i]-'0') * decimalShift + decimalShift *= 10 + } else if model[i] == '.' { + if divisor != 0 { + return + } + divisor = decimalShift + } else { + return + } + } + // we didn't find a space + if i < 0 { + return + } + if divisor != 0 { + c.Hz = (freq * multiplier) / divisor + return + } + c.Hz = freq * multiplier +} + +// VM Will return true if the cpu id indicates we are in +// a virtual machine. +func (c CPUInfo) VM() bool { + return CPU.featureSet.inSet(HYPERVISOR) +} + +// flags contains detected cpu features and characteristics +type flags uint64 + +// log2(bits_in_uint64) +const flagBitsLog2 = 6 +const flagBits = 1 << flagBitsLog2 +const flagMask = flagBits - 1 + +// flagSet contains detected cpu features and characteristics in an array of flags +type flagSet [(lastID + flagMask) / flagBits]flags + +func (s *flagSet) inSet(feat FeatureID) bool { + return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0 +} + +func (s *flagSet) set(feat FeatureID) { + s[feat>>flagBitsLog2] |= 1 << (feat & flagMask) +} + +// setIf will set a feature if boolean is true. +func (s *flagSet) setIf(cond bool, features ...FeatureID) { + if cond { + for _, offset := range features { + s[offset>>flagBitsLog2] |= 1 << (offset & flagMask) + } + } +} + +func (s *flagSet) unset(offset FeatureID) { + bit := flags(1 << (offset & flagMask)) + s[offset>>flagBitsLog2] = s[offset>>flagBitsLog2] & ^bit +} + +// or with another flagset. +func (s *flagSet) or(other flagSet) { + for i, v := range other[:] { + s[i] |= v + } +} + +// hasSet returns whether all features are present. +func (s *flagSet) hasSet(other flagSet) bool { + for i, v := range other[:] { + if s[i]&v != v { + return false + } + } + return true +} + +// hasSet returns whether all features are present. +func (s *flagSet) hasSetP(other *flagSet) bool { + for i, v := range other[:] { + if s[i]&v != v { + return false + } + } + return true +} + +// hasOneOf returns whether one or more features are present. +func (s *flagSet) hasOneOf(other *flagSet) bool { + for i, v := range other[:] { + if s[i]&v != 0 { + return true + } + } + return false +} + +// nEnabled will return the number of enabled flags. +func (s *flagSet) nEnabled() (n int) { + for _, v := range s[:] { + n += bits.OnesCount64(uint64(v)) + } + return n +} + +func flagSetWith(feat ...FeatureID) flagSet { + var res flagSet + for _, f := range feat { + res.set(f) + } + return res +} + +// ParseFeature will parse the string and return the ID of the matching feature. +// Will return UNKNOWN if not found. +func ParseFeature(s string) FeatureID { + s = strings.ToUpper(s) + for i := firstID; i < lastID; i++ { + if i.String() == s { + return i + } + } + return UNKNOWN +} + +// Strings returns an array of the detected features for FlagsSet. +func (s flagSet) Strings() []string { + if len(s) == 0 { + return []string{""} + } + r := make([]string, 0) + for i := firstID; i < lastID; i++ { + if s.inSet(i) { + r = append(r, i.String()) + } + } + return r +} + +func maxExtendedFunction() uint32 { + eax, _, _, _ := cpuid(0x80000000) + return eax +} + +func maxFunctionID() uint32 { + a, _, _, _ := cpuid(0) + return a +} + +func brandName() string { + if maxExtendedFunction() >= 0x80000004 { + v := make([]uint32, 0, 48) + for i := uint32(0); i < 3; i++ { + a, b, c, d := cpuid(0x80000002 + i) + v = append(v, a, b, c, d) + } + return strings.Trim(string(valAsString(v...)), " ") + } + return "unknown" +} + +func threadsPerCore() int { + mfi := maxFunctionID() + vend, _ := vendorID() + + if mfi < 0x4 || (vend != Intel && vend != AMD) { + return 1 + } + + if mfi < 0xb { + if vend != Intel { + return 1 + } + _, b, _, d := cpuid(1) + if (d & (1 << 28)) != 0 { + // v will contain logical core count + v := (b >> 16) & 255 + if v > 1 { + a4, _, _, _ := cpuid(4) + // physical cores + v2 := (a4 >> 26) + 1 + if v2 > 0 { + return int(v) / int(v2) + } + } + } + return 1 + } + _, b, _, _ := cpuidex(0xb, 0) + if b&0xffff == 0 { + if vend == AMD { + // Workaround for AMD returning 0, assume 2 if >= Zen 2 + // It will be more correct than not. + fam, _, _ := familyModel() + _, _, _, d := cpuid(1) + if (d&(1<<28)) != 0 && fam >= 23 { + return 2 + } + } + return 1 + } + return int(b & 0xffff) +} + +func logicalCores() int { + mfi := maxFunctionID() + v, _ := vendorID() + switch v { + case Intel: + // Use this on old Intel processors + if mfi < 0xb { + if mfi < 1 { + return 0 + } + // CPUID.1:EBX[23:16] represents the maximum number of addressable IDs (initial APIC ID) + // that can be assigned to logical processors in a physical package. + // The value may not be the same as the number of logical processors that are present in the hardware of a physical package. + _, ebx, _, _ := cpuid(1) + logical := (ebx >> 16) & 0xff + return int(logical) + } + _, b, _, _ := cpuidex(0xb, 1) + return int(b & 0xffff) + case AMD, Hygon: + _, b, _, _ := cpuid(1) + return int((b >> 16) & 0xff) + default: + return 0 + } +} + +func familyModel() (family, model, stepping int) { + if maxFunctionID() < 0x1 { + return 0, 0, 0 + } + eax, _, _, _ := cpuid(1) + // If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0]. + family = int((eax >> 8) & 0xf) + extFam := family == 0x6 // Intel is 0x6, needs extended model. + if family == 0xf { + // Add ExtFamily + family += int((eax >> 20) & 0xff) + extFam = true + } + // If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0]. + model = int((eax >> 4) & 0xf) + if extFam { + // Add ExtModel + model += int((eax >> 12) & 0xf0) + } + stepping = int(eax & 0xf) + return family, model, stepping +} + +func physicalCores() int { + v, _ := vendorID() + switch v { + case Intel: + return logicalCores() / threadsPerCore() + case AMD, Hygon: + lc := logicalCores() + tpc := threadsPerCore() + if lc > 0 && tpc > 0 { + return lc / tpc + } + + // The following is inaccurate on AMD EPYC 7742 64-Core Processor + if maxExtendedFunction() >= 0x80000008 { + _, _, c, _ := cpuid(0x80000008) + if c&0xff > 0 { + return int(c&0xff) + 1 + } + } + } + return 0 +} + +// Except from http://en.wikipedia.org/wiki/CPUID#EAX.3D0:_Get_vendor_ID +var vendorMapping = map[string]Vendor{ + "AMDisbetter!": AMD, + "AuthenticAMD": AMD, + "CentaurHauls": VIA, + "GenuineIntel": Intel, + "TransmetaCPU": Transmeta, + "GenuineTMx86": Transmeta, + "Geode by NSC": NSC, + "VIA VIA VIA ": VIA, + "KVMKVMKVMKVM": KVM, + "Microsoft Hv": MSVM, + "VMwareVMware": VMware, + "XenVMMXenVMM": XenHVM, + "bhyve bhyve ": Bhyve, + "HygonGenuine": Hygon, + "Vortex86 SoC": SiS, + "SiS SiS SiS ": SiS, + "RiseRiseRise": SiS, + "Genuine RDC": RDC, +} + +func vendorID() (Vendor, string) { + _, b, c, d := cpuid(0) + v := string(valAsString(b, d, c)) + vend, ok := vendorMapping[v] + if !ok { + return VendorUnknown, v + } + return vend, v +} + +func cacheLine() int { + if maxFunctionID() < 0x1 { + return 0 + } + + _, ebx, _, _ := cpuid(1) + cache := (ebx & 0xff00) >> 5 // cflush size + if cache == 0 && maxExtendedFunction() >= 0x80000006 { + _, _, ecx, _ := cpuid(0x80000006) + cache = ecx & 0xff // cacheline size + } + // TODO: Read from Cache and TLB Information + return int(cache) +} + +func (c *CPUInfo) cacheSize() { + c.Cache.L1D = -1 + c.Cache.L1I = -1 + c.Cache.L2 = -1 + c.Cache.L3 = -1 + vendor, _ := vendorID() + switch vendor { + case Intel: + if maxFunctionID() < 4 { + return + } + c.Cache.L1I, c.Cache.L1D, c.Cache.L2, c.Cache.L3 = 0, 0, 0, 0 + for i := uint32(0); ; i++ { + eax, ebx, ecx, _ := cpuidex(4, i) + cacheType := eax & 15 + if cacheType == 0 { + break + } + cacheLevel := (eax >> 5) & 7 + coherency := int(ebx&0xfff) + 1 + partitions := int((ebx>>12)&0x3ff) + 1 + associativity := int((ebx>>22)&0x3ff) + 1 + sets := int(ecx) + 1 + size := associativity * partitions * coherency * sets + switch cacheLevel { + case 1: + if cacheType == 1 { + // 1 = Data Cache + c.Cache.L1D = size + } else if cacheType == 2 { + // 2 = Instruction Cache + c.Cache.L1I = size + } else { + if c.Cache.L1D < 0 { + c.Cache.L1I = size + } + if c.Cache.L1I < 0 { + c.Cache.L1I = size + } + } + case 2: + c.Cache.L2 = size + case 3: + c.Cache.L3 = size + } + } + case AMD, Hygon: + // Untested. + if maxExtendedFunction() < 0x80000005 { + return + } + _, _, ecx, edx := cpuid(0x80000005) + c.Cache.L1D = int(((ecx >> 24) & 0xFF) * 1024) + c.Cache.L1I = int(((edx >> 24) & 0xFF) * 1024) + + if maxExtendedFunction() < 0x80000006 { + return + } + _, _, ecx, _ = cpuid(0x80000006) + c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024) + + // CPUID Fn8000_001D_EAX_x[N:0] Cache Properties + if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) { + return + } + + // Xen Hypervisor is buggy and returns the same entry no matter ECX value. + // Hack: When we encounter the same entry 100 times we break. + nSame := 0 + var last uint32 + for i := uint32(0); i < math.MaxUint32; i++ { + eax, ebx, ecx, _ := cpuidex(0x8000001D, i) + + level := (eax >> 5) & 7 + cacheNumSets := ecx + 1 + cacheLineSize := 1 + (ebx & 2047) + cachePhysPartitions := 1 + ((ebx >> 12) & 511) + cacheNumWays := 1 + ((ebx >> 22) & 511) + + typ := eax & 15 + size := int(cacheNumSets * cacheLineSize * cachePhysPartitions * cacheNumWays) + if typ == 0 { + return + } + + // Check for the same value repeated. + comb := eax ^ ebx ^ ecx + if comb == last { + nSame++ + if nSame == 100 { + return + } + } + last = comb + + switch level { + case 1: + switch typ { + case 1: + // Data cache + c.Cache.L1D = size + case 2: + // Inst cache + c.Cache.L1I = size + default: + if c.Cache.L1D < 0 { + c.Cache.L1I = size + } + if c.Cache.L1I < 0 { + c.Cache.L1I = size + } + } + case 2: + c.Cache.L2 = size + case 3: + c.Cache.L3 = size + } + } + } +} + +type SGXEPCSection struct { + BaseAddress uint64 + EPCSize uint64 +} + +type SGXSupport struct { + Available bool + LaunchControl bool + SGX1Supported bool + SGX2Supported bool + MaxEnclaveSizeNot64 int64 + MaxEnclaveSize64 int64 + EPCSections []SGXEPCSection +} + +func hasSGX(available, lc bool) (rval SGXSupport) { + rval.Available = available + + if !available { + return + } + + rval.LaunchControl = lc + + a, _, _, d := cpuidex(0x12, 0) + rval.SGX1Supported = a&0x01 != 0 + rval.SGX2Supported = a&0x02 != 0 + rval.MaxEnclaveSizeNot64 = 1 << (d & 0xFF) // pow 2 + rval.MaxEnclaveSize64 = 1 << ((d >> 8) & 0xFF) // pow 2 + rval.EPCSections = make([]SGXEPCSection, 0) + + for subleaf := uint32(2); subleaf < 2+8; subleaf++ { + eax, ebx, ecx, edx := cpuidex(0x12, subleaf) + leafType := eax & 0xf + + if leafType == 0 { + // Invalid subleaf, stop iterating + break + } else if leafType == 1 { + // EPC Section subleaf + baseAddress := uint64(eax&0xfffff000) + (uint64(ebx&0x000fffff) << 32) + size := uint64(ecx&0xfffff000) + (uint64(edx&0x000fffff) << 32) + + section := SGXEPCSection{BaseAddress: baseAddress, EPCSize: size} + rval.EPCSections = append(rval.EPCSections, section) + } + } + + return +} + +func support() flagSet { + var fs flagSet + mfi := maxFunctionID() + vend, _ := vendorID() + if mfi < 0x1 { + return fs + } + family, model, _ := familyModel() + + _, _, c, d := cpuid(1) + fs.setIf((d&(1<<0)) != 0, X87) + fs.setIf((d&(1<<8)) != 0, CMPXCHG8) + fs.setIf((d&(1<<11)) != 0, SYSEE) + fs.setIf((d&(1<<15)) != 0, CMOV) + fs.setIf((d&(1<<23)) != 0, MMX) + fs.setIf((d&(1<<24)) != 0, FXSR) + fs.setIf((d&(1<<25)) != 0, FXSROPT) + fs.setIf((d&(1<<25)) != 0, SSE) + fs.setIf((d&(1<<26)) != 0, SSE2) + fs.setIf((c&1) != 0, SSE3) + fs.setIf((c&(1<<5)) != 0, VMX) + fs.setIf((c&(1<<9)) != 0, SSSE3) + fs.setIf((c&(1<<19)) != 0, SSE4) + fs.setIf((c&(1<<20)) != 0, SSE42) + fs.setIf((c&(1<<25)) != 0, AESNI) + fs.setIf((c&(1<<1)) != 0, CLMUL) + fs.setIf(c&(1<<22) != 0, MOVBE) + fs.setIf(c&(1<<23) != 0, POPCNT) + fs.setIf(c&(1<<30) != 0, RDRAND) + + // This bit has been reserved by Intel & AMD for use by hypervisors, + // and indicates the presence of a hypervisor. + fs.setIf(c&(1<<31) != 0, HYPERVISOR) + fs.setIf(c&(1<<29) != 0, F16C) + fs.setIf(c&(1<<13) != 0, CX16) + + if vend == Intel && (d&(1<<28)) != 0 && mfi >= 4 { + fs.setIf(threadsPerCore() > 1, HTT) + } + if vend == AMD && (d&(1<<28)) != 0 && mfi >= 4 { + fs.setIf(threadsPerCore() > 1, HTT) + } + fs.setIf(c&1<<26 != 0, XSAVE) + fs.setIf(c&1<<27 != 0, OSXSAVE) + // Check XGETBV/XSAVE (26), OXSAVE (27) and AVX (28) bits + const avxCheck = 1<<26 | 1<<27 | 1<<28 + if c&avxCheck == avxCheck { + // Check for OS support + eax, _ := xgetbv(0) + if (eax & 0x6) == 0x6 { + fs.set(AVX) + switch vend { + case Intel: + // Older than Haswell. + fs.setIf(family == 6 && model < 60, AVXSLOW) + case AMD: + // Older than Zen 2 + fs.setIf(family < 23 || (family == 23 && model < 49), AVXSLOW) + } + } + } + // FMA3 can be used with SSE registers, so no OS support is strictly needed. + // fma3 and OSXSAVE needed. + const fma3Check = 1<<12 | 1<<27 + fs.setIf(c&fma3Check == fma3Check, FMA3) + + // Check AVX2, AVX2 requires OS support, but BMI1/2 don't. + if mfi >= 7 { + _, ebx, ecx, edx := cpuidex(7, 0) + if fs.inSet(AVX) && (ebx&0x00000020) != 0 { + fs.set(AVX2) + } + // CPUID.(EAX=7, ECX=0).EBX + if (ebx & 0x00000008) != 0 { + fs.set(BMI1) + fs.setIf((ebx&0x00000100) != 0, BMI2) + } + fs.setIf(ebx&(1<<2) != 0, SGX) + fs.setIf(ebx&(1<<4) != 0, HLE) + fs.setIf(ebx&(1<<9) != 0, ERMS) + fs.setIf(ebx&(1<<11) != 0, RTM) + fs.setIf(ebx&(1<<14) != 0, MPX) + fs.setIf(ebx&(1<<18) != 0, RDSEED) + fs.setIf(ebx&(1<<19) != 0, ADX) + fs.setIf(ebx&(1<<29) != 0, SHA) + + // CPUID.(EAX=7, ECX=0).ECX + fs.setIf(ecx&(1<<5) != 0, WAITPKG) + fs.setIf(ecx&(1<<7) != 0, CETSS) + fs.setIf(ecx&(1<<8) != 0, GFNI) + fs.setIf(ecx&(1<<9) != 0, VAES) + fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) + fs.setIf(ecx&(1<<13) != 0, TME) + fs.setIf(ecx&(1<<25) != 0, CLDEMOTE) + fs.setIf(ecx&(1<<27) != 0, MOVDIRI) + fs.setIf(ecx&(1<<28) != 0, MOVDIR64B) + fs.setIf(ecx&(1<<29) != 0, ENQCMD) + fs.setIf(ecx&(1<<30) != 0, SGXLC) + + // CPUID.(EAX=7, ECX=0).EDX + fs.setIf(edx&(1<<4) != 0, FSRM) + fs.setIf(edx&(1<<9) != 0, SRBDS_CTRL) + fs.setIf(edx&(1<<10) != 0, MD_CLEAR) + fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT) + fs.setIf(edx&(1<<14) != 0, SERIALIZE) + fs.setIf(edx&(1<<15) != 0, HYBRID_CPU) + fs.setIf(edx&(1<<16) != 0, TSXLDTRK) + fs.setIf(edx&(1<<18) != 0, PCONFIG) + fs.setIf(edx&(1<<20) != 0, CETIBT) + fs.setIf(edx&(1<<26) != 0, IBPB) + fs.setIf(edx&(1<<27) != 0, STIBP) + fs.setIf(edx&(1<<28) != 0, FLUSH_L1D) + fs.setIf(edx&(1<<29) != 0, IA32_ARCH_CAP) + fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP) + fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD) + + // CPUID.(EAX=7, ECX=1).EAX + eax1, _, _, edx1 := cpuidex(7, 1) + fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI) + fs.setIf(eax1&(1<<7) != 0, CMPCCXADD) + fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL) + fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT) + fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT) + fs.setIf(eax1&(1<<22) != 0, HRESET) + fs.setIf(eax1&(1<<23) != 0, AVXIFMA) + fs.setIf(eax1&(1<<26) != 0, LAM) + + // CPUID.(EAX=7, ECX=1).EDX + fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) + fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) + fs.setIf(edx1&(1<<14) != 0, PREFETCHI) + + // Only detect AVX-512 features if XGETBV is supported + if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { + // Check for OS support + eax, _ := xgetbv(0) + + // Verify that XCR0[7:5] = ‘111b’ (OPMASK state, upper 256-bit of ZMM0-ZMM15 and + // ZMM16-ZMM31 state are enabled by OS) + /// and that XCR0[2:1] = ‘11b’ (XMM state and YMM state are enabled by OS). + hasAVX512 := (eax>>5)&7 == 7 && (eax>>1)&3 == 3 + if runtime.GOOS == "darwin" { + hasAVX512 = fs.inSet(AVX) && darwinHasAVX512() + } + if hasAVX512 { + fs.setIf(ebx&(1<<16) != 0, AVX512F) + fs.setIf(ebx&(1<<17) != 0, AVX512DQ) + fs.setIf(ebx&(1<<21) != 0, AVX512IFMA) + fs.setIf(ebx&(1<<26) != 0, AVX512PF) + fs.setIf(ebx&(1<<27) != 0, AVX512ER) + fs.setIf(ebx&(1<<28) != 0, AVX512CD) + fs.setIf(ebx&(1<<30) != 0, AVX512BW) + fs.setIf(ebx&(1<<31) != 0, AVX512VL) + // ecx + fs.setIf(ecx&(1<<1) != 0, AVX512VBMI) + fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2) + fs.setIf(ecx&(1<<11) != 0, AVX512VNNI) + fs.setIf(ecx&(1<<12) != 0, AVX512BITALG) + fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ) + // edx + fs.setIf(edx&(1<<8) != 0, AVX512VP2INTERSECT) + fs.setIf(edx&(1<<22) != 0, AMXBF16) + fs.setIf(edx&(1<<23) != 0, AVX512FP16) + fs.setIf(edx&(1<<24) != 0, AMXTILE) + fs.setIf(edx&(1<<25) != 0, AMXINT8) + // eax1 = CPUID.(EAX=7, ECX=1).EAX + fs.setIf(eax1&(1<<5) != 0, AVX512BF16) + fs.setIf(eax1&(1<<19) != 0, WRMSRNS) + fs.setIf(eax1&(1<<21) != 0, AMXFP16) + fs.setIf(eax1&(1<<27) != 0, MSRLIST) + } + } + + // CPUID.(EAX=7, ECX=2) + _, _, _, edx = cpuidex(7, 2) + fs.setIf(edx&(1<<0) != 0, PSFD) + fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL) + fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL) + fs.setIf(edx&(1<<4) != 0, BHI_CTRL) + fs.setIf(edx&(1<<5) != 0, MCDT_NO) + + } + + // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) + // EAX + // Bit 00: XSAVEOPT is available. + // Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set. + // Bit 02: Supports XGETBV with ECX = 1 if set. + // Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set. + // Bits 31 - 04: Reserved. + // EBX + // Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS. + // ECX + // Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1. + // EDX? + // Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved. + if mfi >= 0xd { + if fs.inSet(XSAVE) { + eax, _, _, _ := cpuidex(0xd, 1) + fs.setIf(eax&(1<<0) != 0, XSAVEOPT) + fs.setIf(eax&(1<<1) != 0, XSAVEC) + fs.setIf(eax&(1<<2) != 0, XGETBV1) + fs.setIf(eax&(1<<3) != 0, XSAVES) + } + } + if maxExtendedFunction() >= 0x80000001 { + _, _, c, d := cpuid(0x80000001) + if (c & (1 << 5)) != 0 { + fs.set(LZCNT) + fs.set(POPCNT) + } + // ECX + fs.setIf((c&(1<<0)) != 0, LAHF) + fs.setIf((c&(1<<2)) != 0, SVM) + fs.setIf((c&(1<<6)) != 0, SSE4A) + fs.setIf((c&(1<<10)) != 0, IBS) + fs.setIf((c&(1<<22)) != 0, TOPEXT) + + // EDX + fs.setIf(d&(1<<11) != 0, SYSCALL) + fs.setIf(d&(1<<20) != 0, NX) + fs.setIf(d&(1<<22) != 0, MMXEXT) + fs.setIf(d&(1<<23) != 0, MMX) + fs.setIf(d&(1<<24) != 0, FXSR) + fs.setIf(d&(1<<25) != 0, FXSROPT) + fs.setIf(d&(1<<27) != 0, RDTSCP) + fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT) + fs.setIf(d&(1<<31) != 0, AMD3DNOW) + + /* XOP and FMA4 use the AVX instruction coding scheme, so they can't be + * used unless the OS has AVX support. */ + if fs.inSet(AVX) { + fs.setIf((c&(1<<11)) != 0, XOP) + fs.setIf((c&(1<<16)) != 0, FMA4) + } + + } + if maxExtendedFunction() >= 0x80000007 { + _, b, _, d := cpuid(0x80000007) + fs.setIf((b&(1<<0)) != 0, MCAOVERFLOW) + fs.setIf((b&(1<<1)) != 0, SUCCOR) + fs.setIf((b&(1<<2)) != 0, HWA) + fs.setIf((d&(1<<9)) != 0, CPBOOST) + } + + if maxExtendedFunction() >= 0x80000008 { + _, b, _, _ := cpuid(0x80000008) + fs.setIf(b&(1<<28) != 0, PSFD) + fs.setIf(b&(1<<27) != 0, CPPC) + fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD) + fs.setIf(b&(1<<23) != 0, PPIN) + fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED) + fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS) + fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP) + fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED) + fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON) + fs.setIf(b&(1<<15) != 0, STIBP) + fs.setIf(b&(1<<14) != 0, IBRS) + fs.setIf((b&(1<<13)) != 0, INT_WBINVD) + fs.setIf(b&(1<<12) != 0, IBPB) + fs.setIf((b&(1<<9)) != 0, WBNOINVD) + fs.setIf((b&(1<<8)) != 0, MCOMMIT) + fs.setIf((b&(1<<4)) != 0, RDPRU) + fs.setIf((b&(1<<3)) != 0, INVLPGB) + fs.setIf((b&(1<<1)) != 0, MSRIRC) + fs.setIf((b&(1<<0)) != 0, CLZERO) + } + + if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A { + _, _, _, edx := cpuid(0x8000000A) + fs.setIf((edx>>0)&1 == 1, SVMNP) + fs.setIf((edx>>1)&1 == 1, LBRVIRT) + fs.setIf((edx>>2)&1 == 1, SVML) + fs.setIf((edx>>3)&1 == 1, NRIPS) + fs.setIf((edx>>4)&1 == 1, TSCRATEMSR) + fs.setIf((edx>>5)&1 == 1, VMCBCLEAN) + fs.setIf((edx>>6)&1 == 1, SVMFBASID) + fs.setIf((edx>>7)&1 == 1, SVMDA) + fs.setIf((edx>>10)&1 == 1, SVMPF) + fs.setIf((edx>>12)&1 == 1, SVMPFT) + } + + if maxExtendedFunction() >= 0x8000001a { + eax, _, _, _ := cpuid(0x8000001a) + fs.setIf((eax>>0)&1 == 1, FP128) + fs.setIf((eax>>1)&1 == 1, MOVU) + fs.setIf((eax>>2)&1 == 1, FP256) + } + + if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) { + eax, _, _, _ := cpuid(0x8000001b) + fs.setIf((eax>>0)&1 == 1, IBSFFV) + fs.setIf((eax>>1)&1 == 1, IBSFETCHSAM) + fs.setIf((eax>>2)&1 == 1, IBSOPSAM) + fs.setIf((eax>>3)&1 == 1, IBSRDWROPCNT) + fs.setIf((eax>>4)&1 == 1, IBSOPCNT) + fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT) + fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT) + fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK) + fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE) + fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX) + fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1. + fs.setIf((eax>>11)&1 == 1, IBS_ZEN4) + } + + if maxExtendedFunction() >= 0x8000001f && vend == AMD { + a, _, _, _ := cpuid(0x8000001f) + fs.setIf((a>>0)&1 == 1, SME) + fs.setIf((a>>1)&1 == 1, SEV) + fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH) + fs.setIf((a>>3)&1 == 1, SEV_ES) + fs.setIf((a>>4)&1 == 1, SEV_SNP) + fs.setIf((a>>5)&1 == 1, VMPL) + fs.setIf((a>>10)&1 == 1, SME_COHERENT) + fs.setIf((a>>11)&1 == 1, SEV_64BIT) + fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED) + fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE) + fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP) + fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST) + fs.setIf((a>>16)&1 == 1, VTE) + fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) + } + + if mfi >= 0x21 { + // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21). + _, ebx, ecx, edx := cpuid(0x21) + identity := string(valAsString(ebx, edx, ecx)) + fs.setIf(identity == "IntelTDX ", TDX_GUEST) + } + + return fs +} + +func valAsString(values ...uint32) []byte { + r := make([]byte, 4*len(values)) + for i, v := range values { + dst := r[i*4:] + dst[0] = byte(v & 0xff) + dst[1] = byte((v >> 8) & 0xff) + dst[2] = byte((v >> 16) & 0xff) + dst[3] = byte((v >> 24) & 0xff) + switch { + case dst[0] == 0: + return r[:i*4] + case dst[1] == 0: + return r[:i*4+1] + case dst[2] == 0: + return r[:i*4+2] + case dst[3] == 0: + return r[:i*4+3] + } + } + return r +} diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s new file mode 100644 index 0000000000..8587c3a1fc --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s @@ -0,0 +1,47 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//+build 386,!gccgo,!noasm,!appengine + +// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32) +TEXT ·asmCpuid(SB), 7, $0 + XORL CX, CX + MOVL op+0(FP), AX + CPUID + MOVL AX, eax+4(FP) + MOVL BX, ebx+8(FP) + MOVL CX, ecx+12(FP) + MOVL DX, edx+16(FP) + RET + +// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) +TEXT ·asmCpuidex(SB), 7, $0 + MOVL op+0(FP), AX + MOVL op2+4(FP), CX + CPUID + MOVL AX, eax+8(FP) + MOVL BX, ebx+12(FP) + MOVL CX, ecx+16(FP) + MOVL DX, edx+20(FP) + RET + +// func xgetbv(index uint32) (eax, edx uint32) +TEXT ·asmXgetbv(SB), 7, $0 + MOVL index+0(FP), CX + BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV + MOVL AX, eax+4(FP) + MOVL DX, edx+8(FP) + RET + +// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32) +TEXT ·asmRdtscpAsm(SB), 7, $0 + BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP + MOVL AX, eax+0(FP) + MOVL BX, ebx+4(FP) + MOVL CX, ecx+8(FP) + MOVL DX, edx+12(FP) + RET + +// func asmDarwinHasAVX512() bool +TEXT ·asmDarwinHasAVX512(SB), 7, $0 + MOVL $0, eax+0(FP) + RET diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s new file mode 100644 index 0000000000..bc11f89421 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s @@ -0,0 +1,72 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//+build amd64,!gccgo,!noasm,!appengine + +// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32) +TEXT ·asmCpuid(SB), 7, $0 + XORQ CX, CX + MOVL op+0(FP), AX + CPUID + MOVL AX, eax+8(FP) + MOVL BX, ebx+12(FP) + MOVL CX, ecx+16(FP) + MOVL DX, edx+20(FP) + RET + +// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) +TEXT ·asmCpuidex(SB), 7, $0 + MOVL op+0(FP), AX + MOVL op2+4(FP), CX + CPUID + MOVL AX, eax+8(FP) + MOVL BX, ebx+12(FP) + MOVL CX, ecx+16(FP) + MOVL DX, edx+20(FP) + RET + +// func asmXgetbv(index uint32) (eax, edx uint32) +TEXT ·asmXgetbv(SB), 7, $0 + MOVL index+0(FP), CX + BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV + MOVL AX, eax+8(FP) + MOVL DX, edx+12(FP) + RET + +// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32) +TEXT ·asmRdtscpAsm(SB), 7, $0 + BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP + MOVL AX, eax+0(FP) + MOVL BX, ebx+4(FP) + MOVL CX, ecx+8(FP) + MOVL DX, edx+12(FP) + RET + +// From https://go-review.googlesource.com/c/sys/+/285572/ +// func asmDarwinHasAVX512() bool +TEXT ·asmDarwinHasAVX512(SB), 7, $0-1 + MOVB $0, ret+0(FP) // default to false + +#ifdef GOOS_darwin // return if not darwin +#ifdef GOARCH_amd64 // return if not amd64 +// These values from: +// https://github.com/apple/darwin-xnu/blob/xnu-4570.1.46/osfmk/i386/cpu_capabilities.h +#define commpage64_base_address 0x00007fffffe00000 +#define commpage64_cpu_capabilities64 (commpage64_base_address+0x010) +#define commpage64_version (commpage64_base_address+0x01E) +#define hasAVX512F 0x0000004000000000 + MOVQ $commpage64_version, BX + MOVW (BX), AX + CMPW AX, $13 // versions < 13 do not support AVX512 + JL no_avx512 + MOVQ $commpage64_cpu_capabilities64, BX + MOVQ (BX), AX + MOVQ $hasAVX512F, CX + ANDQ CX, AX + JZ no_avx512 + MOVB $1, ret+0(FP) + +no_avx512: +#endif +#endif + RET + diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s new file mode 100644 index 0000000000..b31d6aec43 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s @@ -0,0 +1,26 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//+build arm64,!gccgo,!noasm,!appengine + +// See https://www.kernel.org/doc/Documentation/arm64/cpu-feature-registers.txt + +// func getMidr +TEXT ·getMidr(SB), 7, $0 + WORD $0xd5380000 // mrs x0, midr_el1 /* Main ID Register */ + MOVD R0, midr+0(FP) + RET + +// func getProcFeatures +TEXT ·getProcFeatures(SB), 7, $0 + WORD $0xd5380400 // mrs x0, id_aa64pfr0_el1 /* Processor Feature Register 0 */ + MOVD R0, procFeatures+0(FP) + RET + +// func getInstAttributes +TEXT ·getInstAttributes(SB), 7, $0 + WORD $0xd5380600 // mrs x0, id_aa64isar0_el1 /* Instruction Set Attribute Register 0 */ + WORD $0xd5380621 // mrs x1, id_aa64isar1_el1 /* Instruction Set Attribute Register 1 */ + MOVD R0, instAttrReg0+0(FP) + MOVD R1, instAttrReg1+8(FP) + RET + diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go new file mode 100644 index 0000000000..9a53504a04 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go @@ -0,0 +1,247 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//go:build arm64 && !gccgo && !noasm && !appengine +// +build arm64,!gccgo,!noasm,!appengine + +package cpuid + +import "runtime" + +func getMidr() (midr uint64) +func getProcFeatures() (procFeatures uint64) +func getInstAttributes() (instAttrReg0, instAttrReg1 uint64) + +func initCPU() { + cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } + cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } + xgetbv = func(uint32) (a, b uint32) { return 0, 0 } + rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } +} + +func addInfo(c *CPUInfo, safe bool) { + // Seems to be safe to assume on ARM64 + c.CacheLine = 64 + detectOS(c) + + // ARM64 disabled since it may crash if interrupt is not intercepted by OS. + if safe && !c.Supports(ARMCPUID) && runtime.GOOS != "freebsd" { + return + } + midr := getMidr() + + // MIDR_EL1 - Main ID Register + // https://developer.arm.com/docs/ddi0595/h/aarch64-system-registers/midr_el1 + // x--------------------------------------------------x + // | Name | bits | visible | + // |--------------------------------------------------| + // | Implementer | [31-24] | y | + // |--------------------------------------------------| + // | Variant | [23-20] | y | + // |--------------------------------------------------| + // | Architecture | [19-16] | y | + // |--------------------------------------------------| + // | PartNum | [15-4] | y | + // |--------------------------------------------------| + // | Revision | [3-0] | y | + // x--------------------------------------------------x + + switch (midr >> 24) & 0xff { + case 0xC0: + c.VendorString = "Ampere Computing" + c.VendorID = Ampere + case 0x41: + c.VendorString = "Arm Limited" + c.VendorID = ARM + case 0x42: + c.VendorString = "Broadcom Corporation" + c.VendorID = Broadcom + case 0x43: + c.VendorString = "Cavium Inc" + c.VendorID = Cavium + case 0x44: + c.VendorString = "Digital Equipment Corporation" + c.VendorID = DEC + case 0x46: + c.VendorString = "Fujitsu Ltd" + c.VendorID = Fujitsu + case 0x49: + c.VendorString = "Infineon Technologies AG" + c.VendorID = Infineon + case 0x4D: + c.VendorString = "Motorola or Freescale Semiconductor Inc" + c.VendorID = Motorola + case 0x4E: + c.VendorString = "NVIDIA Corporation" + c.VendorID = NVIDIA + case 0x50: + c.VendorString = "Applied Micro Circuits Corporation" + c.VendorID = AMCC + case 0x51: + c.VendorString = "Qualcomm Inc" + c.VendorID = Qualcomm + case 0x56: + c.VendorString = "Marvell International Ltd" + c.VendorID = Marvell + case 0x69: + c.VendorString = "Intel Corporation" + c.VendorID = Intel + } + + // Lower 4 bits: Architecture + // Architecture Meaning + // 0b0001 Armv4. + // 0b0010 Armv4T. + // 0b0011 Armv5 (obsolete). + // 0b0100 Armv5T. + // 0b0101 Armv5TE. + // 0b0110 Armv5TEJ. + // 0b0111 Armv6. + // 0b1111 Architectural features are individually identified in the ID_* registers, see 'ID registers'. + // Upper 4 bit: Variant + // An IMPLEMENTATION DEFINED variant number. + // Typically, this field is used to distinguish between different product variants, or major revisions of a product. + c.Family = int(midr>>16) & 0xff + + // PartNum, bits [15:4] + // An IMPLEMENTATION DEFINED primary part number for the device. + // On processors implemented by Arm, if the top four bits of the primary + // part number are 0x0 or 0x7, the variant and architecture are encoded differently. + // Revision, bits [3:0] + // An IMPLEMENTATION DEFINED revision number for the device. + c.Model = int(midr) & 0xffff + + procFeatures := getProcFeatures() + + // ID_AA64PFR0_EL1 - Processor Feature Register 0 + // x--------------------------------------------------x + // | Name | bits | visible | + // |--------------------------------------------------| + // | DIT | [51-48] | y | + // |--------------------------------------------------| + // | SVE | [35-32] | y | + // |--------------------------------------------------| + // | GIC | [27-24] | n | + // |--------------------------------------------------| + // | AdvSIMD | [23-20] | y | + // |--------------------------------------------------| + // | FP | [19-16] | y | + // |--------------------------------------------------| + // | EL3 | [15-12] | n | + // |--------------------------------------------------| + // | EL2 | [11-8] | n | + // |--------------------------------------------------| + // | EL1 | [7-4] | n | + // |--------------------------------------------------| + // | EL0 | [3-0] | n | + // x--------------------------------------------------x + + var f flagSet + // if procFeatures&(0xf<<48) != 0 { + // fmt.Println("DIT") + // } + f.setIf(procFeatures&(0xf<<32) != 0, SVE) + if procFeatures&(0xf<<20) != 15<<20 { + f.set(ASIMD) + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64pfr0_el1 + // 0b0001 --> As for 0b0000, and also includes support for half-precision floating-point arithmetic. + f.setIf(procFeatures&(0xf<<20) == 1<<20, FPHP, ASIMDHP) + } + f.setIf(procFeatures&(0xf<<16) != 0, FP) + + instAttrReg0, instAttrReg1 := getInstAttributes() + + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 + // + // ID_AA64ISAR0_EL1 - Instruction Set Attribute Register 0 + // x--------------------------------------------------x + // | Name | bits | visible | + // |--------------------------------------------------| + // | TS | [55-52] | y | + // |--------------------------------------------------| + // | FHM | [51-48] | y | + // |--------------------------------------------------| + // | DP | [47-44] | y | + // |--------------------------------------------------| + // | SM4 | [43-40] | y | + // |--------------------------------------------------| + // | SM3 | [39-36] | y | + // |--------------------------------------------------| + // | SHA3 | [35-32] | y | + // |--------------------------------------------------| + // | RDM | [31-28] | y | + // |--------------------------------------------------| + // | ATOMICS | [23-20] | y | + // |--------------------------------------------------| + // | CRC32 | [19-16] | y | + // |--------------------------------------------------| + // | SHA2 | [15-12] | y | + // |--------------------------------------------------| + // | SHA1 | [11-8] | y | + // |--------------------------------------------------| + // | AES | [7-4] | y | + // x--------------------------------------------------x + + // if instAttrReg0&(0xf<<52) != 0 { + // fmt.Println("TS") + // } + // if instAttrReg0&(0xf<<48) != 0 { + // fmt.Println("FHM") + // } + f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP) + f.setIf(instAttrReg0&(0xf<<40) != 0, SM4) + f.setIf(instAttrReg0&(0xf<<36) != 0, SM3) + f.setIf(instAttrReg0&(0xf<<32) != 0, SHA3) + f.setIf(instAttrReg0&(0xf<<28) != 0, ASIMDRDM) + f.setIf(instAttrReg0&(0xf<<20) != 0, ATOMICS) + f.setIf(instAttrReg0&(0xf<<16) != 0, CRC32) + f.setIf(instAttrReg0&(0xf<<12) != 0, SHA2) + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 + // 0b0010 --> As 0b0001, plus SHA512H, SHA512H2, SHA512SU0, and SHA512SU1 instructions implemented. + f.setIf(instAttrReg0&(0xf<<12) == 2<<12, SHA512) + f.setIf(instAttrReg0&(0xf<<8) != 0, SHA1) + f.setIf(instAttrReg0&(0xf<<4) != 0, AESARM) + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 + // 0b0010 --> As for 0b0001, plus PMULL/PMULL2 instructions operating on 64-bit data quantities. + f.setIf(instAttrReg0&(0xf<<4) == 2<<4, PMULL) + + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar1_el1 + // + // ID_AA64ISAR1_EL1 - Instruction set attribute register 1 + // x--------------------------------------------------x + // | Name | bits | visible | + // |--------------------------------------------------| + // | GPI | [31-28] | y | + // |--------------------------------------------------| + // | GPA | [27-24] | y | + // |--------------------------------------------------| + // | LRCPC | [23-20] | y | + // |--------------------------------------------------| + // | FCMA | [19-16] | y | + // |--------------------------------------------------| + // | JSCVT | [15-12] | y | + // |--------------------------------------------------| + // | API | [11-8] | y | + // |--------------------------------------------------| + // | APA | [7-4] | y | + // |--------------------------------------------------| + // | DPB | [3-0] | y | + // x--------------------------------------------------x + + // if instAttrReg1&(0xf<<28) != 0 { + // fmt.Println("GPI") + // } + f.setIf(instAttrReg1&(0xf<<28) != 24, GPA) + f.setIf(instAttrReg1&(0xf<<20) != 0, LRCPC) + f.setIf(instAttrReg1&(0xf<<16) != 0, FCMA) + f.setIf(instAttrReg1&(0xf<<12) != 0, JSCVT) + // if instAttrReg1&(0xf<<8) != 0 { + // fmt.Println("API") + // } + // if instAttrReg1&(0xf<<4) != 0 { + // fmt.Println("APA") + // } + f.setIf(instAttrReg1&(0xf<<0) != 0, DCPOP) + + // Store + c.featureSet.or(f) +} diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go new file mode 100644 index 0000000000..9636c2bc17 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go @@ -0,0 +1,15 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine +// +build !amd64,!386,!arm64 gccgo noasm appengine + +package cpuid + +func initCPU() { + cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } + cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } + xgetbv = func(uint32) (a, b uint32) { return 0, 0 } + rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } +} + +func addInfo(info *CPUInfo, safe bool) {} diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go new file mode 100644 index 0000000000..c946824ec0 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -0,0 +1,36 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine) +// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine + +package cpuid + +func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32) +func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) +func asmXgetbv(index uint32) (eax, edx uint32) +func asmRdtscpAsm() (eax, ebx, ecx, edx uint32) +func asmDarwinHasAVX512() bool + +func initCPU() { + cpuid = asmCpuid + cpuidex = asmCpuidex + xgetbv = asmXgetbv + rdtscpAsm = asmRdtscpAsm + darwinHasAVX512 = asmDarwinHasAVX512 +} + +func addInfo(c *CPUInfo, safe bool) { + c.maxFunc = maxFunctionID() + c.maxExFunc = maxExtendedFunction() + c.BrandName = brandName() + c.CacheLine = cacheLine() + c.Family, c.Model, c.Stepping = familyModel() + c.featureSet = support() + c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC)) + c.ThreadsPerCore = threadsPerCore() + c.LogicalCores = logicalCores() + c.PhysicalCores = physicalCores() + c.VendorID, c.VendorString = vendorID() + c.cacheSize() + c.frequencies() +} diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go new file mode 100644 index 0000000000..024c706af5 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -0,0 +1,272 @@ +// Code generated by "stringer -type=FeatureID,Vendor"; DO NOT EDIT. + +package cpuid + +import "strconv" + +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[ADX-1] + _ = x[AESNI-2] + _ = x[AMD3DNOW-3] + _ = x[AMD3DNOWEXT-4] + _ = x[AMXBF16-5] + _ = x[AMXFP16-6] + _ = x[AMXINT8-7] + _ = x[AMXTILE-8] + _ = x[AVX-9] + _ = x[AVX2-10] + _ = x[AVX512BF16-11] + _ = x[AVX512BITALG-12] + _ = x[AVX512BW-13] + _ = x[AVX512CD-14] + _ = x[AVX512DQ-15] + _ = x[AVX512ER-16] + _ = x[AVX512F-17] + _ = x[AVX512FP16-18] + _ = x[AVX512IFMA-19] + _ = x[AVX512PF-20] + _ = x[AVX512VBMI-21] + _ = x[AVX512VBMI2-22] + _ = x[AVX512VL-23] + _ = x[AVX512VNNI-24] + _ = x[AVX512VP2INTERSECT-25] + _ = x[AVX512VPOPCNTDQ-26] + _ = x[AVXIFMA-27] + _ = x[AVXNECONVERT-28] + _ = x[AVXSLOW-29] + _ = x[AVXVNNI-30] + _ = x[AVXVNNIINT8-31] + _ = x[BHI_CTRL-32] + _ = x[BMI1-33] + _ = x[BMI2-34] + _ = x[CETIBT-35] + _ = x[CETSS-36] + _ = x[CLDEMOTE-37] + _ = x[CLMUL-38] + _ = x[CLZERO-39] + _ = x[CMOV-40] + _ = x[CMPCCXADD-41] + _ = x[CMPSB_SCADBS_SHORT-42] + _ = x[CMPXCHG8-43] + _ = x[CPBOOST-44] + _ = x[CPPC-45] + _ = x[CX16-46] + _ = x[EFER_LMSLE_UNS-47] + _ = x[ENQCMD-48] + _ = x[ERMS-49] + _ = x[F16C-50] + _ = x[FLUSH_L1D-51] + _ = x[FMA3-52] + _ = x[FMA4-53] + _ = x[FP128-54] + _ = x[FP256-55] + _ = x[FSRM-56] + _ = x[FXSR-57] + _ = x[FXSROPT-58] + _ = x[GFNI-59] + _ = x[HLE-60] + _ = x[HRESET-61] + _ = x[HTT-62] + _ = x[HWA-63] + _ = x[HYBRID_CPU-64] + _ = x[HYPERVISOR-65] + _ = x[IA32_ARCH_CAP-66] + _ = x[IA32_CORE_CAP-67] + _ = x[IBPB-68] + _ = x[IBRS-69] + _ = x[IBRS_PREFERRED-70] + _ = x[IBRS_PROVIDES_SMP-71] + _ = x[IBS-72] + _ = x[IBSBRNTRGT-73] + _ = x[IBSFETCHSAM-74] + _ = x[IBSFFV-75] + _ = x[IBSOPCNT-76] + _ = x[IBSOPCNTEXT-77] + _ = x[IBSOPSAM-78] + _ = x[IBSRDWROPCNT-79] + _ = x[IBSRIPINVALIDCHK-80] + _ = x[IBS_FETCH_CTLX-81] + _ = x[IBS_OPDATA4-82] + _ = x[IBS_OPFUSE-83] + _ = x[IBS_PREVENTHOST-84] + _ = x[IBS_ZEN4-85] + _ = x[IDPRED_CTRL-86] + _ = x[INT_WBINVD-87] + _ = x[INVLPGB-88] + _ = x[LAHF-89] + _ = x[LAM-90] + _ = x[LBRVIRT-91] + _ = x[LZCNT-92] + _ = x[MCAOVERFLOW-93] + _ = x[MCDT_NO-94] + _ = x[MCOMMIT-95] + _ = x[MD_CLEAR-96] + _ = x[MMX-97] + _ = x[MMXEXT-98] + _ = x[MOVBE-99] + _ = x[MOVDIR64B-100] + _ = x[MOVDIRI-101] + _ = x[MOVSB_ZL-102] + _ = x[MOVU-103] + _ = x[MPX-104] + _ = x[MSRIRC-105] + _ = x[MSRLIST-106] + _ = x[MSR_PAGEFLUSH-107] + _ = x[NRIPS-108] + _ = x[NX-109] + _ = x[OSXSAVE-110] + _ = x[PCONFIG-111] + _ = x[POPCNT-112] + _ = x[PPIN-113] + _ = x[PREFETCHI-114] + _ = x[PSFD-115] + _ = x[RDPRU-116] + _ = x[RDRAND-117] + _ = x[RDSEED-118] + _ = x[RDTSCP-119] + _ = x[RRSBA_CTRL-120] + _ = x[RTM-121] + _ = x[RTM_ALWAYS_ABORT-122] + _ = x[SERIALIZE-123] + _ = x[SEV-124] + _ = x[SEV_64BIT-125] + _ = x[SEV_ALTERNATIVE-126] + _ = x[SEV_DEBUGSWAP-127] + _ = x[SEV_ES-128] + _ = x[SEV_RESTRICTED-129] + _ = x[SEV_SNP-130] + _ = x[SGX-131] + _ = x[SGXLC-132] + _ = x[SHA-133] + _ = x[SME-134] + _ = x[SME_COHERENT-135] + _ = x[SPEC_CTRL_SSBD-136] + _ = x[SRBDS_CTRL-137] + _ = x[SSE-138] + _ = x[SSE2-139] + _ = x[SSE3-140] + _ = x[SSE4-141] + _ = x[SSE42-142] + _ = x[SSE4A-143] + _ = x[SSSE3-144] + _ = x[STIBP-145] + _ = x[STIBP_ALWAYSON-146] + _ = x[STOSB_SHORT-147] + _ = x[SUCCOR-148] + _ = x[SVM-149] + _ = x[SVMDA-150] + _ = x[SVMFBASID-151] + _ = x[SVML-152] + _ = x[SVMNP-153] + _ = x[SVMPF-154] + _ = x[SVMPFT-155] + _ = x[SYSCALL-156] + _ = x[SYSEE-157] + _ = x[TBM-158] + _ = x[TDX_GUEST-159] + _ = x[TLB_FLUSH_NESTED-160] + _ = x[TME-161] + _ = x[TOPEXT-162] + _ = x[TSCRATEMSR-163] + _ = x[TSXLDTRK-164] + _ = x[VAES-165] + _ = x[VMCBCLEAN-166] + _ = x[VMPL-167] + _ = x[VMSA_REGPROT-168] + _ = x[VMX-169] + _ = x[VPCLMULQDQ-170] + _ = x[VTE-171] + _ = x[WAITPKG-172] + _ = x[WBNOINVD-173] + _ = x[WRMSRNS-174] + _ = x[X87-175] + _ = x[XGETBV1-176] + _ = x[XOP-177] + _ = x[XSAVE-178] + _ = x[XSAVEC-179] + _ = x[XSAVEOPT-180] + _ = x[XSAVES-181] + _ = x[AESARM-182] + _ = x[ARMCPUID-183] + _ = x[ASIMD-184] + _ = x[ASIMDDP-185] + _ = x[ASIMDHP-186] + _ = x[ASIMDRDM-187] + _ = x[ATOMICS-188] + _ = x[CRC32-189] + _ = x[DCPOP-190] + _ = x[EVTSTRM-191] + _ = x[FCMA-192] + _ = x[FP-193] + _ = x[FPHP-194] + _ = x[GPA-195] + _ = x[JSCVT-196] + _ = x[LRCPC-197] + _ = x[PMULL-198] + _ = x[SHA1-199] + _ = x[SHA2-200] + _ = x[SHA3-201] + _ = x[SHA512-202] + _ = x[SM3-203] + _ = x[SM4-204] + _ = x[SVE-205] + _ = x[lastID-206] + _ = x[firstID-0] +} + +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" + +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465} + +func (i FeatureID) String() string { + if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { + return "FeatureID(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _FeatureID_name[_FeatureID_index[i]:_FeatureID_index[i+1]] +} +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[VendorUnknown-0] + _ = x[Intel-1] + _ = x[AMD-2] + _ = x[VIA-3] + _ = x[Transmeta-4] + _ = x[NSC-5] + _ = x[KVM-6] + _ = x[MSVM-7] + _ = x[VMware-8] + _ = x[XenHVM-9] + _ = x[Bhyve-10] + _ = x[Hygon-11] + _ = x[SiS-12] + _ = x[RDC-13] + _ = x[Ampere-14] + _ = x[ARM-15] + _ = x[Broadcom-16] + _ = x[Cavium-17] + _ = x[DEC-18] + _ = x[Fujitsu-19] + _ = x[Infineon-20] + _ = x[Motorola-21] + _ = x[NVIDIA-22] + _ = x[AMCC-23] + _ = x[Qualcomm-24] + _ = x[Marvell-25] + _ = x[lastVendor-26] +} + +const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvelllastVendor" + +var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 155} + +func (i Vendor) String() string { + if i < 0 || i >= Vendor(len(_Vendor_index)-1) { + return "Vendor(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _Vendor_name[_Vendor_index[i]:_Vendor_index[i+1]] +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go new file mode 100644 index 0000000000..84b1acd215 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go @@ -0,0 +1,121 @@ +// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. + +package cpuid + +import ( + "runtime" + "strings" + + "golang.org/x/sys/unix" +) + +func detectOS(c *CPUInfo) bool { + if runtime.GOOS != "ios" { + tryToFillCPUInfoFomSysctl(c) + } + // There are no hw.optional sysctl values for the below features on Mac OS 11.0 + // to detect their supported state dynamically. Assume the CPU features that + // Apple Silicon M1 supports to be available as a minimal set of features + // to all Go programs running on darwin/arm64. + // TODO: Add more if we know them. + c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2) + + return true +} + +func sysctlGetBool(name string) bool { + value, err := unix.SysctlUint32(name) + if err != nil { + return false + } + return value != 0 +} + +func sysctlGetString(name string) string { + value, err := unix.Sysctl(name) + if err != nil { + return "" + } + return value +} + +func sysctlGetInt(unknown int, names ...string) int { + for _, name := range names { + value, err := unix.SysctlUint32(name) + if err != nil { + continue + } + if value != 0 { + return int(value) + } + } + return unknown +} + +func sysctlGetInt64(unknown int, names ...string) int { + for _, name := range names { + value64, err := unix.SysctlUint64(name) + if err != nil { + continue + } + if int(value64) != unknown { + return int(value64) + } + } + return unknown +} + +func setFeature(c *CPUInfo, name string, feature FeatureID) { + c.featureSet.setIf(sysctlGetBool(name), feature) +} +func tryToFillCPUInfoFomSysctl(c *CPUInfo) { + c.BrandName = sysctlGetString("machdep.cpu.brand_string") + + if len(c.BrandName) != 0 { + c.VendorString = strings.Fields(c.BrandName)[0] + } + + c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu") + c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") / + sysctlGetInt(1, "hw.physicalcpu") + c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count") + c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily") + c.Model = sysctlGetInt(0, "machdep.cpu.model") + c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize") + c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize") + c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize") + c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize") + c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize") + + // from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile + setFeature(c, "hw.optional.arm.FEAT_AES", AESARM) + setFeature(c, "hw.optional.AdvSIMD", ASIMD) + setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP) + setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM) + setFeature(c, "hw.optional.FEAT_CRC32", CRC32) + setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP) + // setFeature(c, "", EVTSTRM) + setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA) + setFeature(c, "hw.optional.arm.FEAT_FP", FP) + setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP) + setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA) + setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT) + setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC) + setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL) + setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1) + setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2) + setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3) + setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512) + // setFeature(c, "", SM3) + // setFeature(c, "", SM4) + setFeature(c, "hw.optional.arm.FEAT_SVE", SVE) + + // from empirical observation + setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP) + setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS) + setFeature(c, "hw.optional.floatingpoint", FP) + setFeature(c, "hw.optional.armv8_2_sha3", SHA3) + setFeature(c, "hw.optional.armv8_2_sha512", SHA512) + setFeature(c, "hw.optional.armv8_3_compnum", FCMA) + setFeature(c, "hw.optional.armv8_crc32", CRC32) +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go new file mode 100644 index 0000000000..ee278b9e4b --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go @@ -0,0 +1,130 @@ +// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. + +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file located +// here https://github.com/golang/sys/blob/master/LICENSE + +package cpuid + +import ( + "encoding/binary" + "io/ioutil" + "runtime" +) + +// HWCAP bits. +const ( + hwcap_FP = 1 << 0 + hwcap_ASIMD = 1 << 1 + hwcap_EVTSTRM = 1 << 2 + hwcap_AES = 1 << 3 + hwcap_PMULL = 1 << 4 + hwcap_SHA1 = 1 << 5 + hwcap_SHA2 = 1 << 6 + hwcap_CRC32 = 1 << 7 + hwcap_ATOMICS = 1 << 8 + hwcap_FPHP = 1 << 9 + hwcap_ASIMDHP = 1 << 10 + hwcap_CPUID = 1 << 11 + hwcap_ASIMDRDM = 1 << 12 + hwcap_JSCVT = 1 << 13 + hwcap_FCMA = 1 << 14 + hwcap_LRCPC = 1 << 15 + hwcap_DCPOP = 1 << 16 + hwcap_SHA3 = 1 << 17 + hwcap_SM3 = 1 << 18 + hwcap_SM4 = 1 << 19 + hwcap_ASIMDDP = 1 << 20 + hwcap_SHA512 = 1 << 21 + hwcap_SVE = 1 << 22 + hwcap_ASIMDFHM = 1 << 23 +) + +func detectOS(c *CPUInfo) bool { + // For now assuming no hyperthreading is reasonable. + c.LogicalCores = runtime.NumCPU() + c.PhysicalCores = c.LogicalCores + c.ThreadsPerCore = 1 + if hwcap == 0 { + // We did not get values from the runtime. + // Try reading /proc/self/auxv + + // From https://github.com/golang/sys + const ( + _AT_HWCAP = 16 + _AT_HWCAP2 = 26 + + uintSize = int(32 << (^uint(0) >> 63)) + ) + + buf, err := ioutil.ReadFile("/proc/self/auxv") + if err != nil { + // e.g. on android /proc/self/auxv is not accessible, so silently + // ignore the error and leave Initialized = false. On some + // architectures (e.g. arm64) doinit() implements a fallback + // readout and will set Initialized = true again. + return false + } + bo := binary.LittleEndian + for len(buf) >= 2*(uintSize/8) { + var tag, val uint + switch uintSize { + case 32: + tag = uint(bo.Uint32(buf[0:])) + val = uint(bo.Uint32(buf[4:])) + buf = buf[8:] + case 64: + tag = uint(bo.Uint64(buf[0:])) + val = uint(bo.Uint64(buf[8:])) + buf = buf[16:] + } + switch tag { + case _AT_HWCAP: + hwcap = val + case _AT_HWCAP2: + // Not used + } + } + if hwcap == 0 { + return false + } + } + + // HWCap was populated by the runtime from the auxiliary vector. + // Use HWCap information since reading aarch64 system registers + // is not supported in user space on older linux kernels. + c.featureSet.setIf(isSet(hwcap, hwcap_AES), AESARM) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMD), ASIMD) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDDP), ASIMDDP) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDHP), ASIMDHP) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDRDM), ASIMDRDM) + c.featureSet.setIf(isSet(hwcap, hwcap_CPUID), ARMCPUID) + c.featureSet.setIf(isSet(hwcap, hwcap_CRC32), CRC32) + c.featureSet.setIf(isSet(hwcap, hwcap_DCPOP), DCPOP) + c.featureSet.setIf(isSet(hwcap, hwcap_EVTSTRM), EVTSTRM) + c.featureSet.setIf(isSet(hwcap, hwcap_FCMA), FCMA) + c.featureSet.setIf(isSet(hwcap, hwcap_FP), FP) + c.featureSet.setIf(isSet(hwcap, hwcap_FPHP), FPHP) + c.featureSet.setIf(isSet(hwcap, hwcap_JSCVT), JSCVT) + c.featureSet.setIf(isSet(hwcap, hwcap_LRCPC), LRCPC) + c.featureSet.setIf(isSet(hwcap, hwcap_PMULL), PMULL) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA1), SHA1) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA2), SHA2) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA3), SHA3) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA512), SHA512) + c.featureSet.setIf(isSet(hwcap, hwcap_SM3), SM3) + c.featureSet.setIf(isSet(hwcap, hwcap_SM4), SM4) + c.featureSet.setIf(isSet(hwcap, hwcap_SVE), SVE) + + // The Samsung S9+ kernel reports support for atomics, but not all cores + // actually support them, resulting in SIGILL. See issue #28431. + // TODO(elias.naur): Only disable the optimization on bad chipsets on android. + c.featureSet.setIf(isSet(hwcap, hwcap_ATOMICS) && runtime.GOOS != "android", ATOMICS) + + return true +} + +func isSet(hwc uint, value uint) bool { + return hwc&value != 0 +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go new file mode 100644 index 0000000000..8733ba3436 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go @@ -0,0 +1,16 @@ +// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. + +//go:build arm64 && !linux && !darwin +// +build arm64,!linux,!darwin + +package cpuid + +import "runtime" + +func detectOS(c *CPUInfo) bool { + c.PhysicalCores = runtime.NumCPU() + // For now assuming 1 thread per core... + c.ThreadsPerCore = 1 + c.LogicalCores = c.PhysicalCores + return false +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go new file mode 100644 index 0000000000..f8f201b5f7 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go @@ -0,0 +1,8 @@ +// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file. + +//go:build nounsafe +// +build nounsafe + +package cpuid + +var hwcap uint diff --git a/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go new file mode 100644 index 0000000000..92af622eb8 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go @@ -0,0 +1,11 @@ +// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file. + +//go:build !nounsafe +// +build !nounsafe + +package cpuid + +import _ "unsafe" // needed for go:linkname + +//go:linkname hwcap internal/cpu.HWCap +var hwcap uint diff --git a/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh b/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh new file mode 100644 index 0000000000..471d986d24 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh @@ -0,0 +1,15 @@ +#!/bin/sh + +set -e + +go tool dist list | while IFS=/ read os arch; do + echo "Checking $os/$arch..." + echo " normal" + GOARCH=$arch GOOS=$os go build -o /dev/null . + echo " noasm" + GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null . + echo " appengine" + GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null . + echo " noasm,appengine" + GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null . +done diff --git a/vendor/github.com/minio/sha256-simd/.gitignore b/vendor/github.com/minio/sha256-simd/.gitignore new file mode 100644 index 0000000000..c56069fe26 --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/.gitignore @@ -0,0 +1 @@ +*.test \ No newline at end of file diff --git a/vendor/github.com/minio/sha256-simd/LICENSE b/vendor/github.com/minio/sha256-simd/LICENSE new file mode 100644 index 0000000000..d645695673 --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/LICENSE @@ -0,0 +1,202 @@ + + Apache License + Version 2.0, January 2004 + http://www.apache.org/licenses/ + + TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION + + 1. Definitions. + + "License" shall mean the terms and conditions for use, reproduction, + and distribution as defined by Sections 1 through 9 of this document. + + "Licensor" shall mean the copyright owner or entity authorized by + the copyright owner that is granting the License. + + "Legal Entity" shall mean the union of the acting entity and all + other entities that control, are controlled by, or are under common + control with that entity. For the purposes of this definition, + "control" means (i) the power, direct or indirect, to cause the + direction or management of such entity, whether by contract or + otherwise, or (ii) ownership of fifty percent (50%) or more of the + outstanding shares, or (iii) beneficial ownership of such entity. + + "You" (or "Your") shall mean an individual or Legal Entity + exercising permissions granted by this License. + + "Source" form shall mean the preferred form for making modifications, + including but not limited to software source code, documentation + source, and configuration files. + + "Object" form shall mean any form resulting from mechanical + transformation or translation of a Source form, including but + not limited to compiled object code, generated documentation, + and conversions to other media types. + + "Work" shall mean the work of authorship, whether in Source or + Object form, made available under the License, as indicated by a + copyright notice that is included in or attached to the work + (an example is provided in the Appendix below). + + "Derivative Works" shall mean any work, whether in Source or Object + form, that is based on (or derived from) the Work and for which the + editorial revisions, annotations, elaborations, or other modifications + represent, as a whole, an original work of authorship. For the purposes + of this License, Derivative Works shall not include works that remain + separable from, or merely link (or bind by name) to the interfaces of, + the Work and Derivative Works thereof. + + "Contribution" shall mean any work of authorship, including + the original version of the Work and any modifications or additions + to that Work or Derivative Works thereof, that is intentionally + submitted to Licensor for inclusion in the Work by the copyright owner + or by an individual or Legal Entity authorized to submit on behalf of + the copyright owner. For the purposes of this definition, "submitted" + means any form of electronic, verbal, or written communication sent + to the Licensor or its representatives, including but not limited to + communication on electronic mailing lists, source code control systems, + and issue tracking systems that are managed by, or on behalf of, the + Licensor for the purpose of discussing and improving the Work, but + excluding communication that is conspicuously marked or otherwise + designated in writing by the copyright owner as "Not a Contribution." + + "Contributor" shall mean Licensor and any individual or Legal Entity + on behalf of whom a Contribution has been received by Licensor and + subsequently incorporated within the Work. + + 2. Grant of Copyright License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + copyright license to reproduce, prepare Derivative Works of, + publicly display, publicly perform, sublicense, and distribute the + Work and such Derivative Works in Source or Object form. + + 3. Grant of Patent License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + (except as stated in this section) patent license to make, have made, + use, offer to sell, sell, import, and otherwise transfer the Work, + where such license applies only to those patent claims licensable + by such Contributor that are necessarily infringed by their + Contribution(s) alone or by combination of their Contribution(s) + with the Work to which such Contribution(s) was submitted. If You + institute patent litigation against any entity (including a + cross-claim or counterclaim in a lawsuit) alleging that the Work + or a Contribution incorporated within the Work constitutes direct + or contributory patent infringement, then any patent licenses + granted to You under this License for that Work shall terminate + as of the date such litigation is filed. + + 4. Redistribution. You may reproduce and distribute copies of the + Work or Derivative Works thereof in any medium, with or without + modifications, and in Source or Object form, provided that You + meet the following conditions: + + (a) You must give any other recipients of the Work or + Derivative Works a copy of this License; and + + (b) You must cause any modified files to carry prominent notices + stating that You changed the files; and + + (c) You must retain, in the Source form of any Derivative Works + that You distribute, all copyright, patent, trademark, and + attribution notices from the Source form of the Work, + excluding those notices that do not pertain to any part of + the Derivative Works; and + + (d) If the Work includes a "NOTICE" text file as part of its + distribution, then any Derivative Works that You distribute must + include a readable copy of the attribution notices contained + within such NOTICE file, excluding those notices that do not + pertain to any part of the Derivative Works, in at least one + of the following places: within a NOTICE text file distributed + as part of the Derivative Works; within the Source form or + documentation, if provided along with the Derivative Works; or, + within a display generated by the Derivative Works, if and + wherever such third-party notices normally appear. The contents + of the NOTICE file are for informational purposes only and + do not modify the License. You may add Your own attribution + notices within Derivative Works that You distribute, alongside + or as an addendum to the NOTICE text from the Work, provided + that such additional attribution notices cannot be construed + as modifying the License. + + You may add Your own copyright statement to Your modifications and + may provide additional or different license terms and conditions + for use, reproduction, or distribution of Your modifications, or + for any such Derivative Works as a whole, provided Your use, + reproduction, and distribution of the Work otherwise complies with + the conditions stated in this License. + + 5. Submission of Contributions. Unless You explicitly state otherwise, + any Contribution intentionally submitted for inclusion in the Work + by You to the Licensor shall be under the terms and conditions of + this License, without any additional terms or conditions. + Notwithstanding the above, nothing herein shall supersede or modify + the terms of any separate license agreement you may have executed + with Licensor regarding such Contributions. + + 6. Trademarks. This License does not grant permission to use the trade + names, trademarks, service marks, or product names of the Licensor, + except as required for reasonable and customary use in describing the + origin of the Work and reproducing the content of the NOTICE file. + + 7. Disclaimer of Warranty. Unless required by applicable law or + agreed to in writing, Licensor provides the Work (and each + Contributor provides its Contributions) on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or + implied, including, without limitation, any warranties or conditions + of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A + PARTICULAR PURPOSE. You are solely responsible for determining the + appropriateness of using or redistributing the Work and assume any + risks associated with Your exercise of permissions under this License. + + 8. Limitation of Liability. In no event and under no legal theory, + whether in tort (including negligence), contract, or otherwise, + unless required by applicable law (such as deliberate and grossly + negligent acts) or agreed to in writing, shall any Contributor be + liable to You for damages, including any direct, indirect, special, + incidental, or consequential damages of any character arising as a + result of this License or out of the use or inability to use the + Work (including but not limited to damages for loss of goodwill, + work stoppage, computer failure or malfunction, or any and all + other commercial damages or losses), even if such Contributor + has been advised of the possibility of such damages. + + 9. Accepting Warranty or Additional Liability. While redistributing + the Work or Derivative Works thereof, You may choose to offer, + and charge a fee for, acceptance of support, warranty, indemnity, + or other liability obligations and/or rights consistent with this + License. However, in accepting such obligations, You may act only + on Your own behalf and on Your sole responsibility, not on behalf + of any other Contributor, and only if You agree to indemnify, + defend, and hold each Contributor harmless for any liability + incurred by, or claims asserted against, such Contributor by reason + of your accepting any such warranty or additional liability. + + END OF TERMS AND CONDITIONS + + APPENDIX: How to apply the Apache License to your work. + + To apply the Apache License to your work, attach the following + boilerplate notice, with the fields enclosed by brackets "[]" + replaced with your own identifying information. (Don't include + the brackets!) The text should be enclosed in the appropriate + comment syntax for the file format. We also recommend that a + file or class name and description of purpose be included on the + same "printed page" as the copyright notice for easier + identification within third-party archives. + + Copyright [yyyy] [name of copyright owner] + + Licensed under the Apache License, Version 2.0 (the "License"); + you may not use this file except in compliance with the License. + You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + + Unless required by applicable law or agreed to in writing, software + distributed under the License is distributed on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + See the License for the specific language governing permissions and + limitations under the License. diff --git a/vendor/github.com/minio/sha256-simd/README.md b/vendor/github.com/minio/sha256-simd/README.md new file mode 100644 index 0000000000..6117488d72 --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/README.md @@ -0,0 +1,137 @@ +# sha256-simd + +Accelerate SHA256 computations in pure Go using AVX512, SHA Extensions for x86 and ARM64 for ARM. +On AVX512 it provides an up to 8x improvement (over 3 GB/s per core). +SHA Extensions give a performance boost of close to 4x over native. + +## Introduction + +This package is designed as a replacement for `crypto/sha256`. +For ARM CPUs with the Cryptography Extensions, advantage is taken of the SHA2 instructions resulting in a massive performance improvement. + +This package uses Golang assembly. +The AVX512 version is based on the Intel's "multi-buffer crypto library for IPSec" whereas the other Intel implementations are described in "Fast SHA-256 Implementations on Intel Architecture Processors" by J. Guilford et al. + +## Support for Intel SHA Extensions + +Support for the Intel SHA Extensions has been added by Kristofer Peterson (@svenski123), originally developed for spacemeshos [here](https://github.com/spacemeshos/POET/issues/23). On CPUs that support it (known thus far Intel Celeron J3455 and AMD Ryzen) it gives a significant boost in performance (with thanks to @AudriusButkevicius for reporting the results; full results [here](https://github.com/minio/sha256-simd/pull/37#issuecomment-451607827)). + +``` +$ benchcmp avx2.txt sha-ext.txt +benchmark AVX2 MB/s SHA Ext MB/s speedup +BenchmarkHash5M 514.40 1975.17 3.84x +``` + +Thanks to Kristofer Peterson, we also added additional performance changes such as optimized padding, +endian conversions which sped up all implementations i.e. Intel SHA alone while doubled performance for small sizes, +the other changes increased everything roughly 50%. + +## Support for AVX512 + +We have added support for AVX512 which results in an up to 8x performance improvement over AVX2 (3.0 GHz Xeon Platinum 8124M CPU): + +``` +$ benchcmp avx2.txt avx512.txt +benchmark AVX2 MB/s AVX512 MB/s speedup +BenchmarkHash5M 448.62 3498.20 7.80x +``` + +The original code was developed by Intel as part of the [multi-buffer crypto library](https://github.com/intel/intel-ipsec-mb) for IPSec or more specifically this [AVX512](https://github.com/intel/intel-ipsec-mb/blob/master/avx512/sha256_x16_avx512.asm) implementation. The key idea behind it is to process a total of 16 checksums in parallel by “transposing” 16 (independent) messages of 64 bytes between a total of 16 ZMM registers (each 64 bytes wide). + +Transposing the input messages means that in order to take full advantage of the speedup you need to have a (server) workload where multiple threads are doing SHA256 calculations in parallel. Unfortunately for this algorithm it is not possible for two message blocks processed in parallel to be dependent on one another — because then the (interim) result of the first part of the message has to be an input into the processing of the second part of the message. + +Whereas the original Intel C implementation requires some sort of explicit scheduling of messages to be processed in parallel, for Golang it makes sense to take advantage of channels in order to group messages together and use channels as well for sending back the results (thereby effectively decoupling the calculations). We have implemented a fairly simple scheduling mechanism that seems to work well in practice. + +Due to this different way of scheduling, we decided to use an explicit method to instantiate the AVX512 version. Essentially one or more AVX512 processing servers ([`Avx512Server`](https://github.com/minio/sha256-simd/blob/master/sha256blockAvx512_amd64.go#L294)) have to be created whereby each server can hash over 3 GB/s on a single core. An `hash.Hash` object ([`Avx512Digest`](https://github.com/minio/sha256-simd/blob/master/sha256blockAvx512_amd64.go#L45)) is then instantiated using one of these servers and used in the regular fashion: + +```go +import "github.com/minio/sha256-simd" + +func main() { + server := sha256.NewAvx512Server() + h512 := sha256.NewAvx512(server) + h512.Write(fileBlock) + digest := h512.Sum([]byte{}) +} +``` + +Note that, because of the scheduling overhead, for small messages (< 1 MB) you will be better off using the regular SHA256 hashing (but those are typically not performance critical anyway). Some other tips to get the best performance: +* Have many go routines doing SHA256 calculations in parallel. +* Try to Write() messages in multiples of 64 bytes. +* Try to keep the overall length of messages to a roughly similar size ie. 5 MB (this way all 16 ‘lanes’ in the AVX512 computations are contributing as much as possible). + +More detailed information can be found in this [blog](https://blog.minio.io/accelerate-sha256-up-to-8x-over-3-gb-s-per-core-with-avx512-a0b1d64f78f) post including scaling across cores. + +## Drop-In Replacement + +The following code snippet shows how you can use `github.com/minio/sha256-simd`. +This will automatically select the fastest method for the architecture on which it will be executed. + +```go +import "github.com/minio/sha256-simd" + +func main() { + ... + shaWriter := sha256.New() + io.Copy(shaWriter, file) + ... +} +``` + +## Performance + +Below is the speed in MB/s for a single core (ranked fast to slow) for blocks larger than 1 MB. + +| Processor | SIMD | Speed (MB/s) | +| --------------------------------- | ------- | ------------:| +| 3.0 GHz Intel Xeon Platinum 8124M | AVX512 | 3498 | +| 3.7 GHz AMD Ryzen 7 2700X | SHA Ext | 1979 | +| 1.2 GHz ARM Cortex-A53 | ARM64 | 638 | + +## asm2plan9s + +In order to be able to work more easily with AVX512/AVX2 instructions, a separate tool was developed to convert SIMD instructions into the corresponding BYTE sequence as accepted by Go assembly. See [asm2plan9s](https://github.com/minio/asm2plan9s) for more information. + +## Why and benefits + +One of the most performance sensitive parts of the [Minio](https://github.com/minio/minio) object storage server is related to SHA256 hash sums calculations. For instance during multi part uploads each part that is uploaded needs to be verified for data integrity by the server. + +Other applications that can benefit from enhanced SHA256 performance are deduplication in storage systems, intrusion detection, version control systems, integrity checking, etc. + +## ARM SHA Extensions + +The 64-bit ARMv8 core has introduced new instructions for SHA1 and SHA2 acceleration as part of the [Cryptography Extensions](http://infocenter.arm.com/help/index.jsp?topic=/com.arm.doc.ddi0501f/CHDFJBCJ.html). Below you can see a small excerpt highlighting one of the rounds as is done for the SHA256 calculation process (for full code see [sha256block_arm64.s](https://github.com/minio/sha256-simd/blob/master/sha256block_arm64.s)). + + ``` + sha256h q2, q3, v9.4s + sha256h2 q3, q4, v9.4s + sha256su0 v5.4s, v6.4s + rev32 v8.16b, v8.16b + add v9.4s, v7.4s, v18.4s + mov v4.16b, v2.16b + sha256h q2, q3, v10.4s + sha256h2 q3, q4, v10.4s + sha256su0 v6.4s, v7.4s + sha256su1 v5.4s, v7.4s, v8.4s + ``` + +### Detailed benchmarks + +Benchmarks generated on a 1.2 Ghz Quad-Core ARM Cortex A53 equipped [Pine64](https://www.pine64.com/). + +``` +minio@minio-arm:$ benchcmp golang.txt arm64.txt +benchmark golang arm64 speedup +BenchmarkHash8Bytes-4 0.68 MB/s 5.70 MB/s 8.38x +BenchmarkHash1K-4 5.65 MB/s 326.30 MB/s 57.75x +BenchmarkHash8K-4 6.00 MB/s 570.63 MB/s 95.11x +BenchmarkHash1M-4 6.05 MB/s 638.23 MB/s 105.49x +``` + +## License + +Released under the Apache License v2.0. You can find the complete text in the file LICENSE. + +## Contributing + +Contributions are welcome, please send PRs for any enhancements. diff --git a/vendor/github.com/minio/sha256-simd/cpuid_other.go b/vendor/github.com/minio/sha256-simd/cpuid_other.go new file mode 100644 index 0000000000..97af6a1956 --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/cpuid_other.go @@ -0,0 +1,50 @@ +// Minio Cloud Storage, (C) 2021 Minio, Inc. +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. +// + +package sha256 + +import ( + "bytes" + "io/ioutil" + "runtime" + + "github.com/klauspost/cpuid/v2" +) + +var ( + hasIntelSha = runtime.GOARCH == "amd64" && cpuid.CPU.Supports(cpuid.SHA, cpuid.SSSE3, cpuid.SSE4) + hasAvx512 = cpuid.CPU.Supports(cpuid.AVX512F, cpuid.AVX512DQ, cpuid.AVX512BW, cpuid.AVX512VL) +) + +func hasArmSha2() bool { + if cpuid.CPU.Has(cpuid.SHA2) { + return true + } + if runtime.GOARCH != "arm64" || runtime.GOOS != "linux" { + return false + } + + // Fall back to hacky cpuinfo parsing... + const procCPUInfo = "/proc/cpuinfo" + + // Feature to check for. + const sha256Feature = "sha2" + + cpuInfo, err := ioutil.ReadFile(procCPUInfo) + if err != nil { + return false + } + return bytes.Contains(cpuInfo, []byte(sha256Feature)) +} diff --git a/vendor/github.com/minio/sha256-simd/sha256.go b/vendor/github.com/minio/sha256-simd/sha256.go new file mode 100644 index 0000000000..f146bbdb55 --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/sha256.go @@ -0,0 +1,468 @@ +/* + * Minio Cloud Storage, (C) 2016 Minio, Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package sha256 + +import ( + "crypto/sha256" + "encoding/binary" + "errors" + "hash" +) + +// Size - The size of a SHA256 checksum in bytes. +const Size = 32 + +// BlockSize - The blocksize of SHA256 in bytes. +const BlockSize = 64 + +const ( + chunk = BlockSize + init0 = 0x6A09E667 + init1 = 0xBB67AE85 + init2 = 0x3C6EF372 + init3 = 0xA54FF53A + init4 = 0x510E527F + init5 = 0x9B05688C + init6 = 0x1F83D9AB + init7 = 0x5BE0CD19 +) + +// digest represents the partial evaluation of a checksum. +type digest struct { + h [8]uint32 + x [chunk]byte + nx int + len uint64 +} + +// Reset digest back to default +func (d *digest) Reset() { + d.h[0] = init0 + d.h[1] = init1 + d.h[2] = init2 + d.h[3] = init3 + d.h[4] = init4 + d.h[5] = init5 + d.h[6] = init6 + d.h[7] = init7 + d.nx = 0 + d.len = 0 +} + +type blockfuncType int + +const ( + blockfuncStdlib blockfuncType = iota + blockfuncIntelSha + blockfuncArmSha2 + blockfuncForceGeneric = -1 +) + +var blockfunc blockfuncType + +func init() { + switch { + case hasIntelSha: + blockfunc = blockfuncIntelSha + case hasArmSha2(): + blockfunc = blockfuncArmSha2 + } +} + +// New returns a new hash.Hash computing the SHA256 checksum. +func New() hash.Hash { + if blockfunc == blockfuncStdlib { + // Fallback to the standard golang implementation + // if no features were found. + return sha256.New() + } + + d := new(digest) + d.Reset() + return d +} + +// Sum256 - single caller sha256 helper +func Sum256(data []byte) (result [Size]byte) { + var d digest + d.Reset() + d.Write(data) + result = d.checkSum() + return +} + +// Return size of checksum +func (d *digest) Size() int { return Size } + +// Return blocksize of checksum +func (d *digest) BlockSize() int { return BlockSize } + +// Write to digest +func (d *digest) Write(p []byte) (nn int, err error) { + nn = len(p) + d.len += uint64(nn) + if d.nx > 0 { + n := copy(d.x[d.nx:], p) + d.nx += n + if d.nx == chunk { + block(d, d.x[:]) + d.nx = 0 + } + p = p[n:] + } + if len(p) >= chunk { + n := len(p) &^ (chunk - 1) + block(d, p[:n]) + p = p[n:] + } + if len(p) > 0 { + d.nx = copy(d.x[:], p) + } + return +} + +// Return sha256 sum in bytes +func (d *digest) Sum(in []byte) []byte { + // Make a copy of d0 so that caller can keep writing and summing. + d0 := *d + hash := d0.checkSum() + return append(in, hash[:]...) +} + +// Intermediate checksum function +func (d *digest) checkSum() (digest [Size]byte) { + n := d.nx + + var k [64]byte + copy(k[:], d.x[:n]) + + k[n] = 0x80 + + if n >= 56 { + block(d, k[:]) + + // clear block buffer - go compiles this to optimal 1x xorps + 4x movups + // unfortunately expressing this more succinctly results in much worse code + k[0] = 0 + k[1] = 0 + k[2] = 0 + k[3] = 0 + k[4] = 0 + k[5] = 0 + k[6] = 0 + k[7] = 0 + k[8] = 0 + k[9] = 0 + k[10] = 0 + k[11] = 0 + k[12] = 0 + k[13] = 0 + k[14] = 0 + k[15] = 0 + k[16] = 0 + k[17] = 0 + k[18] = 0 + k[19] = 0 + k[20] = 0 + k[21] = 0 + k[22] = 0 + k[23] = 0 + k[24] = 0 + k[25] = 0 + k[26] = 0 + k[27] = 0 + k[28] = 0 + k[29] = 0 + k[30] = 0 + k[31] = 0 + k[32] = 0 + k[33] = 0 + k[34] = 0 + k[35] = 0 + k[36] = 0 + k[37] = 0 + k[38] = 0 + k[39] = 0 + k[40] = 0 + k[41] = 0 + k[42] = 0 + k[43] = 0 + k[44] = 0 + k[45] = 0 + k[46] = 0 + k[47] = 0 + k[48] = 0 + k[49] = 0 + k[50] = 0 + k[51] = 0 + k[52] = 0 + k[53] = 0 + k[54] = 0 + k[55] = 0 + k[56] = 0 + k[57] = 0 + k[58] = 0 + k[59] = 0 + k[60] = 0 + k[61] = 0 + k[62] = 0 + k[63] = 0 + } + binary.BigEndian.PutUint64(k[56:64], uint64(d.len)<<3) + block(d, k[:]) + + { + const i = 0 + binary.BigEndian.PutUint32(digest[i*4:i*4+4], d.h[i]) + } + { + const i = 1 + binary.BigEndian.PutUint32(digest[i*4:i*4+4], d.h[i]) + } + { + const i = 2 + binary.BigEndian.PutUint32(digest[i*4:i*4+4], d.h[i]) + } + { + const i = 3 + binary.BigEndian.PutUint32(digest[i*4:i*4+4], d.h[i]) + } + { + const i = 4 + binary.BigEndian.PutUint32(digest[i*4:i*4+4], d.h[i]) + } + { + const i = 5 + binary.BigEndian.PutUint32(digest[i*4:i*4+4], d.h[i]) + } + { + const i = 6 + binary.BigEndian.PutUint32(digest[i*4:i*4+4], d.h[i]) + } + { + const i = 7 + binary.BigEndian.PutUint32(digest[i*4:i*4+4], d.h[i]) + } + + return +} + +func block(dig *digest, p []byte) { + if blockfunc == blockfuncIntelSha { + blockIntelShaGo(dig, p) + } else if blockfunc == blockfuncArmSha2 { + blockArmSha2Go(dig, p) + } else { + blockGeneric(dig, p) + } +} + +func blockGeneric(dig *digest, p []byte) { + var w [64]uint32 + h0, h1, h2, h3, h4, h5, h6, h7 := dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4], dig.h[5], dig.h[6], dig.h[7] + for len(p) >= chunk { + // Can interlace the computation of w with the + // rounds below if needed for speed. + for i := 0; i < 16; i++ { + j := i * 4 + w[i] = uint32(p[j])<<24 | uint32(p[j+1])<<16 | uint32(p[j+2])<<8 | uint32(p[j+3]) + } + for i := 16; i < 64; i++ { + v1 := w[i-2] + t1 := (v1>>17 | v1<<(32-17)) ^ (v1>>19 | v1<<(32-19)) ^ (v1 >> 10) + v2 := w[i-15] + t2 := (v2>>7 | v2<<(32-7)) ^ (v2>>18 | v2<<(32-18)) ^ (v2 >> 3) + w[i] = t1 + w[i-7] + t2 + w[i-16] + } + + a, b, c, d, e, f, g, h := h0, h1, h2, h3, h4, h5, h6, h7 + + for i := 0; i < 64; i++ { + t1 := h + ((e>>6 | e<<(32-6)) ^ (e>>11 | e<<(32-11)) ^ (e>>25 | e<<(32-25))) + ((e & f) ^ (^e & g)) + _K[i] + w[i] + + t2 := ((a>>2 | a<<(32-2)) ^ (a>>13 | a<<(32-13)) ^ (a>>22 | a<<(32-22))) + ((a & b) ^ (a & c) ^ (b & c)) + + h = g + g = f + f = e + e = d + t1 + d = c + c = b + b = a + a = t1 + t2 + } + + h0 += a + h1 += b + h2 += c + h3 += d + h4 += e + h5 += f + h6 += g + h7 += h + + p = p[chunk:] + } + + dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4], dig.h[5], dig.h[6], dig.h[7] = h0, h1, h2, h3, h4, h5, h6, h7 +} + +var _K = []uint32{ + 0x428a2f98, + 0x71374491, + 0xb5c0fbcf, + 0xe9b5dba5, + 0x3956c25b, + 0x59f111f1, + 0x923f82a4, + 0xab1c5ed5, + 0xd807aa98, + 0x12835b01, + 0x243185be, + 0x550c7dc3, + 0x72be5d74, + 0x80deb1fe, + 0x9bdc06a7, + 0xc19bf174, + 0xe49b69c1, + 0xefbe4786, + 0x0fc19dc6, + 0x240ca1cc, + 0x2de92c6f, + 0x4a7484aa, + 0x5cb0a9dc, + 0x76f988da, + 0x983e5152, + 0xa831c66d, + 0xb00327c8, + 0xbf597fc7, + 0xc6e00bf3, + 0xd5a79147, + 0x06ca6351, + 0x14292967, + 0x27b70a85, + 0x2e1b2138, + 0x4d2c6dfc, + 0x53380d13, + 0x650a7354, + 0x766a0abb, + 0x81c2c92e, + 0x92722c85, + 0xa2bfe8a1, + 0xa81a664b, + 0xc24b8b70, + 0xc76c51a3, + 0xd192e819, + 0xd6990624, + 0xf40e3585, + 0x106aa070, + 0x19a4c116, + 0x1e376c08, + 0x2748774c, + 0x34b0bcb5, + 0x391c0cb3, + 0x4ed8aa4a, + 0x5b9cca4f, + 0x682e6ff3, + 0x748f82ee, + 0x78a5636f, + 0x84c87814, + 0x8cc70208, + 0x90befffa, + 0xa4506ceb, + 0xbef9a3f7, + 0xc67178f2, +} + +const ( + magic256 = "sha\x03" + marshaledSize = len(magic256) + 8*4 + chunk + 8 +) + +func (d *digest) MarshalBinary() ([]byte, error) { + b := make([]byte, 0, marshaledSize) + b = append(b, magic256...) + b = appendUint32(b, d.h[0]) + b = appendUint32(b, d.h[1]) + b = appendUint32(b, d.h[2]) + b = appendUint32(b, d.h[3]) + b = appendUint32(b, d.h[4]) + b = appendUint32(b, d.h[5]) + b = appendUint32(b, d.h[6]) + b = appendUint32(b, d.h[7]) + b = append(b, d.x[:d.nx]...) + b = b[:len(b)+len(d.x)-d.nx] // already zero + b = appendUint64(b, d.len) + return b, nil +} + +func (d *digest) UnmarshalBinary(b []byte) error { + if len(b) < len(magic256) || string(b[:len(magic256)]) != magic256 { + return errors.New("crypto/sha256: invalid hash state identifier") + } + if len(b) != marshaledSize { + return errors.New("crypto/sha256: invalid hash state size") + } + b = b[len(magic256):] + b, d.h[0] = consumeUint32(b) + b, d.h[1] = consumeUint32(b) + b, d.h[2] = consumeUint32(b) + b, d.h[3] = consumeUint32(b) + b, d.h[4] = consumeUint32(b) + b, d.h[5] = consumeUint32(b) + b, d.h[6] = consumeUint32(b) + b, d.h[7] = consumeUint32(b) + b = b[copy(d.x[:], b):] + b, d.len = consumeUint64(b) + d.nx = int(d.len % chunk) + return nil +} + +func appendUint32(b []byte, v uint32) []byte { + return append(b, + byte(v>>24), + byte(v>>16), + byte(v>>8), + byte(v), + ) +} + +func appendUint64(b []byte, v uint64) []byte { + return append(b, + byte(v>>56), + byte(v>>48), + byte(v>>40), + byte(v>>32), + byte(v>>24), + byte(v>>16), + byte(v>>8), + byte(v), + ) +} + +func consumeUint64(b []byte) ([]byte, uint64) { + _ = b[7] + x := uint64(b[7]) | uint64(b[6])<<8 | uint64(b[5])<<16 | uint64(b[4])<<24 | + uint64(b[3])<<32 | uint64(b[2])<<40 | uint64(b[1])<<48 | uint64(b[0])<<56 + return b[8:], x +} + +func consumeUint32(b []byte) ([]byte, uint32) { + _ = b[3] + x := uint32(b[3]) | uint32(b[2])<<8 | uint32(b[1])<<16 | uint32(b[0])<<24 + return b[4:], x +} diff --git a/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.asm b/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.asm new file mode 100644 index 0000000000..c959b1aa26 --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.asm @@ -0,0 +1,686 @@ + +// 16x Parallel implementation of SHA256 for AVX512 + +// +// Minio Cloud Storage, (C) 2017 Minio, Inc. +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +// +// This code is based on the Intel Multi-Buffer Crypto for IPSec library +// and more specifically the following implementation: +// https://github.com/intel/intel-ipsec-mb/blob/master/avx512/sha256_x16_avx512.asm +// +// For Golang it has been converted into Plan 9 assembly with the help of +// github.com/minio/asm2plan9s to assemble the AVX512 instructions +// + +// Copyright (c) 2017, Intel Corporation +// +// Redistribution and use in source and binary forms, with or without +// modification, are permitted provided that the following conditions are met: +// +// * Redistributions of source code must retain the above copyright notice, +// this list of conditions and the following disclaimer. +// * Redistributions in binary form must reproduce the above copyright +// notice, this list of conditions and the following disclaimer in the +// documentation and/or other materials provided with the distribution. +// * Neither the name of Intel Corporation nor the names of its contributors +// may be used to endorse or promote products derived from this software +// without specific prior written permission. +// +// THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" +// AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE +// IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE +// DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE +// FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL +// DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR +// SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER +// CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, +// OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +// OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +#define SHA256_DIGEST_ROW_SIZE 64 + +// arg1 +#define STATE rdi +#define STATE_P9 DI +// arg2 +#define INP_SIZE rsi +#define INP_SIZE_P9 SI + +#define IDX rcx +#define TBL rdx +#define TBL_P9 DX + +#define INPUT rax +#define INPUT_P9 AX + +#define inp0 r9 +#define SCRATCH_P9 R12 +#define SCRATCH r12 +#define maskp r13 +#define MASKP_P9 R13 +#define mask r14 +#define MASK_P9 R14 + +#define A zmm0 +#define B zmm1 +#define C zmm2 +#define D zmm3 +#define E zmm4 +#define F zmm5 +#define G zmm6 +#define H zmm7 +#define T1 zmm8 +#define TMP0 zmm9 +#define TMP1 zmm10 +#define TMP2 zmm11 +#define TMP3 zmm12 +#define TMP4 zmm13 +#define TMP5 zmm14 +#define TMP6 zmm15 + +#define W0 zmm16 +#define W1 zmm17 +#define W2 zmm18 +#define W3 zmm19 +#define W4 zmm20 +#define W5 zmm21 +#define W6 zmm22 +#define W7 zmm23 +#define W8 zmm24 +#define W9 zmm25 +#define W10 zmm26 +#define W11 zmm27 +#define W12 zmm28 +#define W13 zmm29 +#define W14 zmm30 +#define W15 zmm31 + + +#define TRANSPOSE16(_r0, _r1, _r2, _r3, _r4, _r5, _r6, _r7, _r8, _r9, _r10, _r11, _r12, _r13, _r14, _r15, _t0, _t1) \ + \ + \ // input r0 = {a15 a14 a13 a12 a11 a10 a9 a8 a7 a6 a5 a4 a3 a2 a1 a0} + \ // r1 = {b15 b14 b13 b12 b11 b10 b9 b8 b7 b6 b5 b4 b3 b2 b1 b0} + \ // r2 = {c15 c14 c13 c12 c11 c10 c9 c8 c7 c6 c5 c4 c3 c2 c1 c0} + \ // r3 = {d15 d14 d13 d12 d11 d10 d9 d8 d7 d6 d5 d4 d3 d2 d1 d0} + \ // r4 = {e15 e14 e13 e12 e11 e10 e9 e8 e7 e6 e5 e4 e3 e2 e1 e0} + \ // r5 = {f15 f14 f13 f12 f11 f10 f9 f8 f7 f6 f5 f4 f3 f2 f1 f0} + \ // r6 = {g15 g14 g13 g12 g11 g10 g9 g8 g7 g6 g5 g4 g3 g2 g1 g0} + \ // r7 = {h15 h14 h13 h12 h11 h10 h9 h8 h7 h6 h5 h4 h3 h2 h1 h0} + \ // r8 = {i15 i14 i13 i12 i11 i10 i9 i8 i7 i6 i5 i4 i3 i2 i1 i0} + \ // r9 = {j15 j14 j13 j12 j11 j10 j9 j8 j7 j6 j5 j4 j3 j2 j1 j0} + \ // r10 = {k15 k14 k13 k12 k11 k10 k9 k8 k7 k6 k5 k4 k3 k2 k1 k0} + \ // r11 = {l15 l14 l13 l12 l11 l10 l9 l8 l7 l6 l5 l4 l3 l2 l1 l0} + \ // r12 = {m15 m14 m13 m12 m11 m10 m9 m8 m7 m6 m5 m4 m3 m2 m1 m0} + \ // r13 = {n15 n14 n13 n12 n11 n10 n9 n8 n7 n6 n5 n4 n3 n2 n1 n0} + \ // r14 = {o15 o14 o13 o12 o11 o10 o9 o8 o7 o6 o5 o4 o3 o2 o1 o0} + \ // r15 = {p15 p14 p13 p12 p11 p10 p9 p8 p7 p6 p5 p4 p3 p2 p1 p0} + \ + \ // output r0 = { p0 o0 n0 m0 l0 k0 j0 i0 h0 g0 f0 e0 d0 c0 b0 a0} + \ // r1 = { p1 o1 n1 m1 l1 k1 j1 i1 h1 g1 f1 e1 d1 c1 b1 a1} + \ // r2 = { p2 o2 n2 m2 l2 k2 j2 i2 h2 g2 f2 e2 d2 c2 b2 a2} + \ // r3 = { p3 o3 n3 m3 l3 k3 j3 i3 h3 g3 f3 e3 d3 c3 b3 a3} + \ // r4 = { p4 o4 n4 m4 l4 k4 j4 i4 h4 g4 f4 e4 d4 c4 b4 a4} + \ // r5 = { p5 o5 n5 m5 l5 k5 j5 i5 h5 g5 f5 e5 d5 c5 b5 a5} + \ // r6 = { p6 o6 n6 m6 l6 k6 j6 i6 h6 g6 f6 e6 d6 c6 b6 a6} + \ // r7 = { p7 o7 n7 m7 l7 k7 j7 i7 h7 g7 f7 e7 d7 c7 b7 a7} + \ // r8 = { p8 o8 n8 m8 l8 k8 j8 i8 h8 g8 f8 e8 d8 c8 b8 a8} + \ // r9 = { p9 o9 n9 m9 l9 k9 j9 i9 h9 g9 f9 e9 d9 c9 b9 a9} + \ // r10 = {p10 o10 n10 m10 l10 k10 j10 i10 h10 g10 f10 e10 d10 c10 b10 a10} + \ // r11 = {p11 o11 n11 m11 l11 k11 j11 i11 h11 g11 f11 e11 d11 c11 b11 a11} + \ // r12 = {p12 o12 n12 m12 l12 k12 j12 i12 h12 g12 f12 e12 d12 c12 b12 a12} + \ // r13 = {p13 o13 n13 m13 l13 k13 j13 i13 h13 g13 f13 e13 d13 c13 b13 a13} + \ // r14 = {p14 o14 n14 m14 l14 k14 j14 i14 h14 g14 f14 e14 d14 c14 b14 a14} + \ // r15 = {p15 o15 n15 m15 l15 k15 j15 i15 h15 g15 f15 e15 d15 c15 b15 a15} + \ + \ // process top half + vshufps _t0, _r0, _r1, 0x44 \ // t0 = {b13 b12 a13 a12 b9 b8 a9 a8 b5 b4 a5 a4 b1 b0 a1 a0} + vshufps _r0, _r0, _r1, 0xEE \ // r0 = {b15 b14 a15 a14 b11 b10 a11 a10 b7 b6 a7 a6 b3 b2 a3 a2} + vshufps _t1, _r2, _r3, 0x44 \ // t1 = {d13 d12 c13 c12 d9 d8 c9 c8 d5 d4 c5 c4 d1 d0 c1 c0} + vshufps _r2, _r2, _r3, 0xEE \ // r2 = {d15 d14 c15 c14 d11 d10 c11 c10 d7 d6 c7 c6 d3 d2 c3 c2} + \ + vshufps _r3, _t0, _t1, 0xDD \ // r3 = {d13 c13 b13 a13 d9 c9 b9 a9 d5 c5 b5 a5 d1 c1 b1 a1} + vshufps _r1, _r0, _r2, 0x88 \ // r1 = {d14 c14 b14 a14 d10 c10 b10 a10 d6 c6 b6 a6 d2 c2 b2 a2} + vshufps _r0, _r0, _r2, 0xDD \ // r0 = {d15 c15 b15 a15 d11 c11 b11 a11 d7 c7 b7 a7 d3 c3 b3 a3} + vshufps _t0, _t0, _t1, 0x88 \ // t0 = {d12 c12 b12 a12 d8 c8 b8 a8 d4 c4 b4 a4 d0 c0 b0 a0} + \ + \ // use r2 in place of t0 + vshufps _r2, _r4, _r5, 0x44 \ // r2 = {f13 f12 e13 e12 f9 f8 e9 e8 f5 f4 e5 e4 f1 f0 e1 e0} + vshufps _r4, _r4, _r5, 0xEE \ // r4 = {f15 f14 e15 e14 f11 f10 e11 e10 f7 f6 e7 e6 f3 f2 e3 e2} + vshufps _t1, _r6, _r7, 0x44 \ // t1 = {h13 h12 g13 g12 h9 h8 g9 g8 h5 h4 g5 g4 h1 h0 g1 g0} + vshufps _r6, _r6, _r7, 0xEE \ // r6 = {h15 h14 g15 g14 h11 h10 g11 g10 h7 h6 g7 g6 h3 h2 g3 g2} + \ + vshufps _r7, _r2, _t1, 0xDD \ // r7 = {h13 g13 f13 e13 h9 g9 f9 e9 h5 g5 f5 e5 h1 g1 f1 e1} + vshufps _r5, _r4, _r6, 0x88 \ // r5 = {h14 g14 f14 e14 h10 g10 f10 e10 h6 g6 f6 e6 h2 g2 f2 e2} + vshufps _r4, _r4, _r6, 0xDD \ // r4 = {h15 g15 f15 e15 h11 g11 f11 e11 h7 g7 f7 e7 h3 g3 f3 e3} + vshufps _r2, _r2, _t1, 0x88 \ // r2 = {h12 g12 f12 e12 h8 g8 f8 e8 h4 g4 f4 e4 h0 g0 f0 e0} + \ + \ // use r6 in place of t0 + vshufps _r6, _r8, _r9, 0x44 \ // r6 = {j13 j12 i13 i12 j9 j8 i9 i8 j5 j4 i5 i4 j1 j0 i1 i0} + vshufps _r8, _r8, _r9, 0xEE \ // r8 = {j15 j14 i15 i14 j11 j10 i11 i10 j7 j6 i7 i6 j3 j2 i3 i2} + vshufps _t1, _r10, _r11, 0x44 \ // t1 = {l13 l12 k13 k12 l9 l8 k9 k8 l5 l4 k5 k4 l1 l0 k1 k0} + vshufps _r10, _r10, _r11, 0xEE \ // r10 = {l15 l14 k15 k14 l11 l10 k11 k10 l7 l6 k7 k6 l3 l2 k3 k2} + \ + vshufps _r11, _r6, _t1, 0xDD \ // r11 = {l13 k13 j13 113 l9 k9 j9 i9 l5 k5 j5 i5 l1 k1 j1 i1} + vshufps _r9, _r8, _r10, 0x88 \ // r9 = {l14 k14 j14 114 l10 k10 j10 i10 l6 k6 j6 i6 l2 k2 j2 i2} + vshufps _r8, _r8, _r10, 0xDD \ // r8 = {l15 k15 j15 115 l11 k11 j11 i11 l7 k7 j7 i7 l3 k3 j3 i3} + vshufps _r6, _r6, _t1, 0x88 \ // r6 = {l12 k12 j12 112 l8 k8 j8 i8 l4 k4 j4 i4 l0 k0 j0 i0} + \ + \ // use r10 in place of t0 + vshufps _r10, _r12, _r13, 0x44 \ // r10 = {n13 n12 m13 m12 n9 n8 m9 m8 n5 n4 m5 m4 n1 n0 a1 m0} + vshufps _r12, _r12, _r13, 0xEE \ // r12 = {n15 n14 m15 m14 n11 n10 m11 m10 n7 n6 m7 m6 n3 n2 a3 m2} + vshufps _t1, _r14, _r15, 0x44 \ // t1 = {p13 p12 013 012 p9 p8 09 08 p5 p4 05 04 p1 p0 01 00} + vshufps _r14, _r14, _r15, 0xEE \ // r14 = {p15 p14 015 014 p11 p10 011 010 p7 p6 07 06 p3 p2 03 02} + \ + vshufps _r15, _r10, _t1, 0xDD \ // r15 = {p13 013 n13 m13 p9 09 n9 m9 p5 05 n5 m5 p1 01 n1 m1} + vshufps _r13, _r12, _r14, 0x88 \ // r13 = {p14 014 n14 m14 p10 010 n10 m10 p6 06 n6 m6 p2 02 n2 m2} + vshufps _r12, _r12, _r14, 0xDD \ // r12 = {p15 015 n15 m15 p11 011 n11 m11 p7 07 n7 m7 p3 03 n3 m3} + vshufps _r10, _r10, _t1, 0x88 \ // r10 = {p12 012 n12 m12 p8 08 n8 m8 p4 04 n4 m4 p0 00 n0 m0} + \ + \ // At this point, the registers that contain interesting data are: + \ // t0, r3, r1, r0, r2, r7, r5, r4, r6, r11, r9, r8, r10, r15, r13, r12 + \ // Can use t1 and r14 as scratch registers + LEAQ PSHUFFLE_TRANSPOSE16_MASK1<>(SB), BX \ + LEAQ PSHUFFLE_TRANSPOSE16_MASK2<>(SB), R8 \ + \ + vmovdqu32 _r14, [rbx] \ + vpermi2q _r14, _t0, _r2 \ // r14 = {h8 g8 f8 e8 d8 c8 b8 a8 h0 g0 f0 e0 d0 c0 b0 a0} + vmovdqu32 _t1, [r8] \ + vpermi2q _t1, _t0, _r2 \ // t1 = {h12 g12 f12 e12 d12 c12 b12 a12 h4 g4 f4 e4 d4 c4 b4 a4} + \ + vmovdqu32 _r2, [rbx] \ + vpermi2q _r2, _r3, _r7 \ // r2 = {h9 g9 f9 e9 d9 c9 b9 a9 h1 g1 f1 e1 d1 c1 b1 a1} + vmovdqu32 _t0, [r8] \ + vpermi2q _t0, _r3, _r7 \ // t0 = {h13 g13 f13 e13 d13 c13 b13 a13 h5 g5 f5 e5 d5 c5 b5 a5} + \ + vmovdqu32 _r3, [rbx] \ + vpermi2q _r3, _r1, _r5 \ // r3 = {h10 g10 f10 e10 d10 c10 b10 a10 h2 g2 f2 e2 d2 c2 b2 a2} + vmovdqu32 _r7, [r8] \ + vpermi2q _r7, _r1, _r5 \ // r7 = {h14 g14 f14 e14 d14 c14 b14 a14 h6 g6 f6 e6 d6 c6 b6 a6} + \ + vmovdqu32 _r1, [rbx] \ + vpermi2q _r1, _r0, _r4 \ // r1 = {h11 g11 f11 e11 d11 c11 b11 a11 h3 g3 f3 e3 d3 c3 b3 a3} + vmovdqu32 _r5, [r8] \ + vpermi2q _r5, _r0, _r4 \ // r5 = {h15 g15 f15 e15 d15 c15 b15 a15 h7 g7 f7 e7 d7 c7 b7 a7} + \ + vmovdqu32 _r0, [rbx] \ + vpermi2q _r0, _r6, _r10 \ // r0 = {p8 o8 n8 m8 l8 k8 j8 i8 p0 o0 n0 m0 l0 k0 j0 i0} + vmovdqu32 _r4, [r8] \ + vpermi2q _r4, _r6, _r10 \ // r4 = {p12 o12 n12 m12 l12 k12 j12 i12 p4 o4 n4 m4 l4 k4 j4 i4} + \ + vmovdqu32 _r6, [rbx] \ + vpermi2q _r6, _r11, _r15 \ // r6 = {p9 o9 n9 m9 l9 k9 j9 i9 p1 o1 n1 m1 l1 k1 j1 i1} + vmovdqu32 _r10, [r8] \ + vpermi2q _r10, _r11, _r15 \ // r10 = {p13 o13 n13 m13 l13 k13 j13 i13 p5 o5 n5 m5 l5 k5 j5 i5} + \ + vmovdqu32 _r11, [rbx] \ + vpermi2q _r11, _r9, _r13 \ // r11 = {p10 o10 n10 m10 l10 k10 j10 i10 p2 o2 n2 m2 l2 k2 j2 i2} + vmovdqu32 _r15, [r8] \ + vpermi2q _r15, _r9, _r13 \ // r15 = {p14 o14 n14 m14 l14 k14 j14 i14 p6 o6 n6 m6 l6 k6 j6 i6} + \ + vmovdqu32 _r9, [rbx] \ + vpermi2q _r9, _r8, _r12 \ // r9 = {p11 o11 n11 m11 l11 k11 j11 i11 p3 o3 n3 m3 l3 k3 j3 i3} + vmovdqu32 _r13, [r8] \ + vpermi2q _r13, _r8, _r12 \ // r13 = {p15 o15 n15 m15 l15 k15 j15 i15 p7 o7 n7 m7 l7 k7 j7 i7} + \ + \ // At this point r8 and r12 can be used as scratch registers + vshuff64x2 _r8, _r14, _r0, 0xEE \ // r8 = {p8 o8 n8 m8 l8 k8 j8 i8 h8 g8 f8 e8 d8 c8 b8 a8} + vshuff64x2 _r0, _r14, _r0, 0x44 \ // r0 = {p0 o0 n0 m0 l0 k0 j0 i0 h0 g0 f0 e0 d0 c0 b0 a0} + \ + vshuff64x2 _r12, _t1, _r4, 0xEE \ // r12 = {p12 o12 n12 m12 l12 k12 j12 i12 h12 g12 f12 e12 d12 c12 b12 a12} + vshuff64x2 _r4, _t1, _r4, 0x44 \ // r4 = {p4 o4 n4 m4 l4 k4 j4 i4 h4 g4 f4 e4 d4 c4 b4 a4} + \ + vshuff64x2 _r14, _r7, _r15, 0xEE \ // r14 = {p14 o14 n14 m14 l14 k14 j14 i14 h14 g14 f14 e14 d14 c14 b14 a14} + vshuff64x2 _t1, _r7, _r15, 0x44 \ // t1 = {p6 o6 n6 m6 l6 k6 j6 i6 h6 g6 f6 e6 d6 c6 b6 a6} + \ + vshuff64x2 _r15, _r5, _r13, 0xEE \ // r15 = {p15 o15 n15 m15 l15 k15 j15 i15 h15 g15 f15 e15 d15 c15 b15 a15} + vshuff64x2 _r7, _r5, _r13, 0x44 \ // r7 = {p7 o7 n7 m7 l7 k7 j7 i7 h7 g7 f7 e7 d7 c7 b7 a7} + \ + vshuff64x2 _r13, _t0, _r10, 0xEE \ // r13 = {p13 o13 n13 m13 l13 k13 j13 i13 h13 g13 f13 e13 d13 c13 b13 a13} + vshuff64x2 _r5, _t0, _r10, 0x44 \ // r5 = {p5 o5 n5 m5 l5 k5 j5 i5 h5 g5 f5 e5 d5 c5 b5 a5} + \ + vshuff64x2 _r10, _r3, _r11, 0xEE \ // r10 = {p10 o10 n10 m10 l10 k10 j10 i10 h10 g10 f10 e10 d10 c10 b10 a10} + vshuff64x2 _t0, _r3, _r11, 0x44 \ // t0 = {p2 o2 n2 m2 l2 k2 j2 i2 h2 g2 f2 e2 d2 c2 b2 a2} + \ + vshuff64x2 _r11, _r1, _r9, 0xEE \ // r11 = {p11 o11 n11 m11 l11 k11 j11 i11 h11 g11 f11 e11 d11 c11 b11 a11} + vshuff64x2 _r3, _r1, _r9, 0x44 \ // r3 = {p3 o3 n3 m3 l3 k3 j3 i3 h3 g3 f3 e3 d3 c3 b3 a3} + \ + vshuff64x2 _r9, _r2, _r6, 0xEE \ // r9 = {p9 o9 n9 m9 l9 k9 j9 i9 h9 g9 f9 e9 d9 c9 b9 a9} + vshuff64x2 _r1, _r2, _r6, 0x44 \ // r1 = {p1 o1 n1 m1 l1 k1 j1 i1 h1 g1 f1 e1 d1 c1 b1 a1} + \ + vmovdqu32 _r2, _t0 \ // r2 = {p2 o2 n2 m2 l2 k2 j2 i2 h2 g2 f2 e2 d2 c2 b2 a2} + vmovdqu32 _r6, _t1 \ // r6 = {p6 o6 n6 m6 l6 k6 j6 i6 h6 g6 f6 e6 d6 c6 b6 a6} + + +// CH(A, B, C) = (A&B) ^ (~A&C) +// MAJ(E, F, G) = (E&F) ^ (E&G) ^ (F&G) +// SIGMA0 = ROR_2 ^ ROR_13 ^ ROR_22 +// SIGMA1 = ROR_6 ^ ROR_11 ^ ROR_25 +// sigma0 = ROR_7 ^ ROR_18 ^ SHR_3 +// sigma1 = ROR_17 ^ ROR_19 ^ SHR_10 + +// Main processing loop per round +#define PROCESS_LOOP(_WT, _ROUND, _A, _B, _C, _D, _E, _F, _G, _H) \ + \ // T1 = H + SIGMA1(E) + CH(E, F, G) + Kt + Wt + \ // T2 = SIGMA0(A) + MAJ(A, B, C) + \ // H=G, G=F, F=E, E=D+T1, D=C, C=B, B=A, A=T1+T2 + \ + \ // H becomes T2, then add T1 for A + \ // D becomes D + T1 for E + \ + vpaddd T1, _H, TMP3 \ // T1 = H + Kt + vmovdqu32 TMP0, _E \ + vprord TMP1, _E, 6 \ // ROR_6(E) + vprord TMP2, _E, 11 \ // ROR_11(E) + vprord TMP3, _E, 25 \ // ROR_25(E) + vpternlogd TMP0, _F, _G, 0xCA \ // TMP0 = CH(E,F,G) + vpaddd T1, T1, _WT \ // T1 = T1 + Wt + vpternlogd TMP1, TMP2, TMP3, 0x96 \ // TMP1 = SIGMA1(E) + vpaddd T1, T1, TMP0 \ // T1 = T1 + CH(E,F,G) + vpaddd T1, T1, TMP1 \ // T1 = T1 + SIGMA1(E) + vpaddd _D, _D, T1 \ // D = D + T1 + \ + vprord _H, _A, 2 \ // ROR_2(A) + vprord TMP2, _A, 13 \ // ROR_13(A) + vprord TMP3, _A, 22 \ // ROR_22(A) + vmovdqu32 TMP0, _A \ + vpternlogd TMP0, _B, _C, 0xE8 \ // TMP0 = MAJ(A,B,C) + vpternlogd _H, TMP2, TMP3, 0x96 \ // H(T2) = SIGMA0(A) + vpaddd _H, _H, TMP0 \ // H(T2) = SIGMA0(A) + MAJ(A,B,C) + vpaddd _H, _H, T1 \ // H(A) = H(T2) + T1 + \ + vmovdqu32 TMP3, [TBL + ((_ROUND+1)*64)] \ // Next Kt + + +#define MSG_SCHED_ROUND_16_63(_WT, _WTp1, _WTp9, _WTp14) \ + vprord TMP4, _WTp14, 17 \ // ROR_17(Wt-2) + vprord TMP5, _WTp14, 19 \ // ROR_19(Wt-2) + vpsrld TMP6, _WTp14, 10 \ // SHR_10(Wt-2) + vpternlogd TMP4, TMP5, TMP6, 0x96 \ // TMP4 = sigma1(Wt-2) + \ + vpaddd _WT, _WT, TMP4 \ // Wt = Wt-16 + sigma1(Wt-2) + vpaddd _WT, _WT, _WTp9 \ // Wt = Wt-16 + sigma1(Wt-2) + Wt-7 + \ + vprord TMP4, _WTp1, 7 \ // ROR_7(Wt-15) + vprord TMP5, _WTp1, 18 \ // ROR_18(Wt-15) + vpsrld TMP6, _WTp1, 3 \ // SHR_3(Wt-15) + vpternlogd TMP4, TMP5, TMP6, 0x96 \ // TMP4 = sigma0(Wt-15) + \ + vpaddd _WT, _WT, TMP4 \ // Wt = Wt-16 + sigma1(Wt-2) + + \ // Wt-7 + sigma0(Wt-15) + + + +// Note this is reading in a block of data for one lane +// When all 16 are read, the data must be transposed to build msg schedule +#define MSG_SCHED_ROUND_00_15(_WT, OFFSET, LABEL) \ + TESTQ $(1<<OFFSET), MASK_P9 \ + JE LABEL \ + MOVQ OFFSET*24(INPUT_P9), R9 \ + vmovups _WT, [inp0+IDX] \ +LABEL: \ + +#define MASKED_LOAD(_WT, OFFSET, LABEL) \ + TESTQ $(1<<OFFSET), MASK_P9 \ + JE LABEL \ + MOVQ OFFSET*24(INPUT_P9), R9 \ + vmovups _WT,[inp0+IDX] \ +LABEL: \ + +TEXT ·sha256_x16_avx512(SB), 7, $0 + MOVQ digests+0(FP), STATE_P9 // + MOVQ scratch+8(FP), SCRATCH_P9 + MOVQ mask_len+32(FP), INP_SIZE_P9 // number of blocks to process + MOVQ mask+24(FP), MASKP_P9 + MOVQ (MASKP_P9), MASK_P9 + kmovq k1, mask + LEAQ inputs+48(FP), INPUT_P9 + + // Initialize digests + vmovdqu32 A, [STATE + 0*SHA256_DIGEST_ROW_SIZE] + vmovdqu32 B, [STATE + 1*SHA256_DIGEST_ROW_SIZE] + vmovdqu32 C, [STATE + 2*SHA256_DIGEST_ROW_SIZE] + vmovdqu32 D, [STATE + 3*SHA256_DIGEST_ROW_SIZE] + vmovdqu32 E, [STATE + 4*SHA256_DIGEST_ROW_SIZE] + vmovdqu32 F, [STATE + 5*SHA256_DIGEST_ROW_SIZE] + vmovdqu32 G, [STATE + 6*SHA256_DIGEST_ROW_SIZE] + vmovdqu32 H, [STATE + 7*SHA256_DIGEST_ROW_SIZE] + + MOVQ table+16(FP), TBL_P9 + + xor IDX, IDX + + // Read in first block of input data + MASKED_LOAD( W0, 0, skipInput0) + MASKED_LOAD( W1, 1, skipInput1) + MASKED_LOAD( W2, 2, skipInput2) + MASKED_LOAD( W3, 3, skipInput3) + MASKED_LOAD( W4, 4, skipInput4) + MASKED_LOAD( W5, 5, skipInput5) + MASKED_LOAD( W6, 6, skipInput6) + MASKED_LOAD( W7, 7, skipInput7) + MASKED_LOAD( W8, 8, skipInput8) + MASKED_LOAD( W9, 9, skipInput9) + MASKED_LOAD(W10, 10, skipInput10) + MASKED_LOAD(W11, 11, skipInput11) + MASKED_LOAD(W12, 12, skipInput12) + MASKED_LOAD(W13, 13, skipInput13) + MASKED_LOAD(W14, 14, skipInput14) + MASKED_LOAD(W15, 15, skipInput15) + +lloop: + LEAQ PSHUFFLE_BYTE_FLIP_MASK<>(SB), TBL_P9 + vmovdqu32 TMP2, [TBL] + + // Get first K from table + MOVQ table+16(FP), TBL_P9 + vmovdqu32 TMP3, [TBL] + + // Save digests for later addition + vmovdqu32 [SCRATCH + 64*0], A + vmovdqu32 [SCRATCH + 64*1], B + vmovdqu32 [SCRATCH + 64*2], C + vmovdqu32 [SCRATCH + 64*3], D + vmovdqu32 [SCRATCH + 64*4], E + vmovdqu32 [SCRATCH + 64*5], F + vmovdqu32 [SCRATCH + 64*6], G + vmovdqu32 [SCRATCH + 64*7], H + + add IDX, 64 + + // Transpose input data + TRANSPOSE16(W0, W1, W2, W3, W4, W5, W6, W7, W8, W9, W10, W11, W12, W13, W14, W15, TMP0, TMP1) + + vpshufb W0, W0, TMP2 + vpshufb W1, W1, TMP2 + vpshufb W2, W2, TMP2 + vpshufb W3, W3, TMP2 + vpshufb W4, W4, TMP2 + vpshufb W5, W5, TMP2 + vpshufb W6, W6, TMP2 + vpshufb W7, W7, TMP2 + vpshufb W8, W8, TMP2 + vpshufb W9, W9, TMP2 + vpshufb W10, W10, TMP2 + vpshufb W11, W11, TMP2 + vpshufb W12, W12, TMP2 + vpshufb W13, W13, TMP2 + vpshufb W14, W14, TMP2 + vpshufb W15, W15, TMP2 + + // MSG Schedule for W0-W15 is now complete in registers + // Process first 48 rounds + // Calculate next Wt+16 after processing is complete and Wt is unneeded + + PROCESS_LOOP( W0, 0, A, B, C, D, E, F, G, H) + MSG_SCHED_ROUND_16_63( W0, W1, W9, W14) + PROCESS_LOOP( W1, 1, H, A, B, C, D, E, F, G) + MSG_SCHED_ROUND_16_63( W1, W2, W10, W15) + PROCESS_LOOP( W2, 2, G, H, A, B, C, D, E, F) + MSG_SCHED_ROUND_16_63( W2, W3, W11, W0) + PROCESS_LOOP( W3, 3, F, G, H, A, B, C, D, E) + MSG_SCHED_ROUND_16_63( W3, W4, W12, W1) + PROCESS_LOOP( W4, 4, E, F, G, H, A, B, C, D) + MSG_SCHED_ROUND_16_63( W4, W5, W13, W2) + PROCESS_LOOP( W5, 5, D, E, F, G, H, A, B, C) + MSG_SCHED_ROUND_16_63( W5, W6, W14, W3) + PROCESS_LOOP( W6, 6, C, D, E, F, G, H, A, B) + MSG_SCHED_ROUND_16_63( W6, W7, W15, W4) + PROCESS_LOOP( W7, 7, B, C, D, E, F, G, H, A) + MSG_SCHED_ROUND_16_63( W7, W8, W0, W5) + PROCESS_LOOP( W8, 8, A, B, C, D, E, F, G, H) + MSG_SCHED_ROUND_16_63( W8, W9, W1, W6) + PROCESS_LOOP( W9, 9, H, A, B, C, D, E, F, G) + MSG_SCHED_ROUND_16_63( W9, W10, W2, W7) + PROCESS_LOOP(W10, 10, G, H, A, B, C, D, E, F) + MSG_SCHED_ROUND_16_63(W10, W11, W3, W8) + PROCESS_LOOP(W11, 11, F, G, H, A, B, C, D, E) + MSG_SCHED_ROUND_16_63(W11, W12, W4, W9) + PROCESS_LOOP(W12, 12, E, F, G, H, A, B, C, D) + MSG_SCHED_ROUND_16_63(W12, W13, W5, W10) + PROCESS_LOOP(W13, 13, D, E, F, G, H, A, B, C) + MSG_SCHED_ROUND_16_63(W13, W14, W6, W11) + PROCESS_LOOP(W14, 14, C, D, E, F, G, H, A, B) + MSG_SCHED_ROUND_16_63(W14, W15, W7, W12) + PROCESS_LOOP(W15, 15, B, C, D, E, F, G, H, A) + MSG_SCHED_ROUND_16_63(W15, W0, W8, W13) + PROCESS_LOOP( W0, 16, A, B, C, D, E, F, G, H) + MSG_SCHED_ROUND_16_63( W0, W1, W9, W14) + PROCESS_LOOP( W1, 17, H, A, B, C, D, E, F, G) + MSG_SCHED_ROUND_16_63( W1, W2, W10, W15) + PROCESS_LOOP( W2, 18, G, H, A, B, C, D, E, F) + MSG_SCHED_ROUND_16_63( W2, W3, W11, W0) + PROCESS_LOOP( W3, 19, F, G, H, A, B, C, D, E) + MSG_SCHED_ROUND_16_63( W3, W4, W12, W1) + PROCESS_LOOP( W4, 20, E, F, G, H, A, B, C, D) + MSG_SCHED_ROUND_16_63( W4, W5, W13, W2) + PROCESS_LOOP( W5, 21, D, E, F, G, H, A, B, C) + MSG_SCHED_ROUND_16_63( W5, W6, W14, W3) + PROCESS_LOOP( W6, 22, C, D, E, F, G, H, A, B) + MSG_SCHED_ROUND_16_63( W6, W7, W15, W4) + PROCESS_LOOP( W7, 23, B, C, D, E, F, G, H, A) + MSG_SCHED_ROUND_16_63( W7, W8, W0, W5) + PROCESS_LOOP( W8, 24, A, B, C, D, E, F, G, H) + MSG_SCHED_ROUND_16_63( W8, W9, W1, W6) + PROCESS_LOOP( W9, 25, H, A, B, C, D, E, F, G) + MSG_SCHED_ROUND_16_63( W9, W10, W2, W7) + PROCESS_LOOP(W10, 26, G, H, A, B, C, D, E, F) + MSG_SCHED_ROUND_16_63(W10, W11, W3, W8) + PROCESS_LOOP(W11, 27, F, G, H, A, B, C, D, E) + MSG_SCHED_ROUND_16_63(W11, W12, W4, W9) + PROCESS_LOOP(W12, 28, E, F, G, H, A, B, C, D) + MSG_SCHED_ROUND_16_63(W12, W13, W5, W10) + PROCESS_LOOP(W13, 29, D, E, F, G, H, A, B, C) + MSG_SCHED_ROUND_16_63(W13, W14, W6, W11) + PROCESS_LOOP(W14, 30, C, D, E, F, G, H, A, B) + MSG_SCHED_ROUND_16_63(W14, W15, W7, W12) + PROCESS_LOOP(W15, 31, B, C, D, E, F, G, H, A) + MSG_SCHED_ROUND_16_63(W15, W0, W8, W13) + PROCESS_LOOP( W0, 32, A, B, C, D, E, F, G, H) + MSG_SCHED_ROUND_16_63( W0, W1, W9, W14) + PROCESS_LOOP( W1, 33, H, A, B, C, D, E, F, G) + MSG_SCHED_ROUND_16_63( W1, W2, W10, W15) + PROCESS_LOOP( W2, 34, G, H, A, B, C, D, E, F) + MSG_SCHED_ROUND_16_63( W2, W3, W11, W0) + PROCESS_LOOP( W3, 35, F, G, H, A, B, C, D, E) + MSG_SCHED_ROUND_16_63( W3, W4, W12, W1) + PROCESS_LOOP( W4, 36, E, F, G, H, A, B, C, D) + MSG_SCHED_ROUND_16_63( W4, W5, W13, W2) + PROCESS_LOOP( W5, 37, D, E, F, G, H, A, B, C) + MSG_SCHED_ROUND_16_63( W5, W6, W14, W3) + PROCESS_LOOP( W6, 38, C, D, E, F, G, H, A, B) + MSG_SCHED_ROUND_16_63( W6, W7, W15, W4) + PROCESS_LOOP( W7, 39, B, C, D, E, F, G, H, A) + MSG_SCHED_ROUND_16_63( W7, W8, W0, W5) + PROCESS_LOOP( W8, 40, A, B, C, D, E, F, G, H) + MSG_SCHED_ROUND_16_63( W8, W9, W1, W6) + PROCESS_LOOP( W9, 41, H, A, B, C, D, E, F, G) + MSG_SCHED_ROUND_16_63( W9, W10, W2, W7) + PROCESS_LOOP(W10, 42, G, H, A, B, C, D, E, F) + MSG_SCHED_ROUND_16_63(W10, W11, W3, W8) + PROCESS_LOOP(W11, 43, F, G, H, A, B, C, D, E) + MSG_SCHED_ROUND_16_63(W11, W12, W4, W9) + PROCESS_LOOP(W12, 44, E, F, G, H, A, B, C, D) + MSG_SCHED_ROUND_16_63(W12, W13, W5, W10) + PROCESS_LOOP(W13, 45, D, E, F, G, H, A, B, C) + MSG_SCHED_ROUND_16_63(W13, W14, W6, W11) + PROCESS_LOOP(W14, 46, C, D, E, F, G, H, A, B) + MSG_SCHED_ROUND_16_63(W14, W15, W7, W12) + PROCESS_LOOP(W15, 47, B, C, D, E, F, G, H, A) + MSG_SCHED_ROUND_16_63(W15, W0, W8, W13) + + // Check if this is the last block + sub INP_SIZE, 1 + JE lastLoop + + // Load next mask for inputs + ADDQ $8, MASKP_P9 + MOVQ (MASKP_P9), MASK_P9 + + // Process last 16 rounds + // Read in next block msg data for use in first 16 words of msg sched + + PROCESS_LOOP( W0, 48, A, B, C, D, E, F, G, H) + MSG_SCHED_ROUND_00_15( W0, 0, skipNext0) + PROCESS_LOOP( W1, 49, H, A, B, C, D, E, F, G) + MSG_SCHED_ROUND_00_15( W1, 1, skipNext1) + PROCESS_LOOP( W2, 50, G, H, A, B, C, D, E, F) + MSG_SCHED_ROUND_00_15( W2, 2, skipNext2) + PROCESS_LOOP( W3, 51, F, G, H, A, B, C, D, E) + MSG_SCHED_ROUND_00_15( W3, 3, skipNext3) + PROCESS_LOOP( W4, 52, E, F, G, H, A, B, C, D) + MSG_SCHED_ROUND_00_15( W4, 4, skipNext4) + PROCESS_LOOP( W5, 53, D, E, F, G, H, A, B, C) + MSG_SCHED_ROUND_00_15( W5, 5, skipNext5) + PROCESS_LOOP( W6, 54, C, D, E, F, G, H, A, B) + MSG_SCHED_ROUND_00_15( W6, 6, skipNext6) + PROCESS_LOOP( W7, 55, B, C, D, E, F, G, H, A) + MSG_SCHED_ROUND_00_15( W7, 7, skipNext7) + PROCESS_LOOP( W8, 56, A, B, C, D, E, F, G, H) + MSG_SCHED_ROUND_00_15( W8, 8, skipNext8) + PROCESS_LOOP( W9, 57, H, A, B, C, D, E, F, G) + MSG_SCHED_ROUND_00_15( W9, 9, skipNext9) + PROCESS_LOOP(W10, 58, G, H, A, B, C, D, E, F) + MSG_SCHED_ROUND_00_15(W10, 10, skipNext10) + PROCESS_LOOP(W11, 59, F, G, H, A, B, C, D, E) + MSG_SCHED_ROUND_00_15(W11, 11, skipNext11) + PROCESS_LOOP(W12, 60, E, F, G, H, A, B, C, D) + MSG_SCHED_ROUND_00_15(W12, 12, skipNext12) + PROCESS_LOOP(W13, 61, D, E, F, G, H, A, B, C) + MSG_SCHED_ROUND_00_15(W13, 13, skipNext13) + PROCESS_LOOP(W14, 62, C, D, E, F, G, H, A, B) + MSG_SCHED_ROUND_00_15(W14, 14, skipNext14) + PROCESS_LOOP(W15, 63, B, C, D, E, F, G, H, A) + MSG_SCHED_ROUND_00_15(W15, 15, skipNext15) + + // Add old digest + vmovdqu32 TMP2, A + vmovdqu32 A, [SCRATCH + 64*0] + vpaddd A{k1}, A, TMP2 + vmovdqu32 TMP2, B + vmovdqu32 B, [SCRATCH + 64*1] + vpaddd B{k1}, B, TMP2 + vmovdqu32 TMP2, C + vmovdqu32 C, [SCRATCH + 64*2] + vpaddd C{k1}, C, TMP2 + vmovdqu32 TMP2, D + vmovdqu32 D, [SCRATCH + 64*3] + vpaddd D{k1}, D, TMP2 + vmovdqu32 TMP2, E + vmovdqu32 E, [SCRATCH + 64*4] + vpaddd E{k1}, E, TMP2 + vmovdqu32 TMP2, F + vmovdqu32 F, [SCRATCH + 64*5] + vpaddd F{k1}, F, TMP2 + vmovdqu32 TMP2, G + vmovdqu32 G, [SCRATCH + 64*6] + vpaddd G{k1}, G, TMP2 + vmovdqu32 TMP2, H + vmovdqu32 H, [SCRATCH + 64*7] + vpaddd H{k1}, H, TMP2 + + kmovq k1, mask + JMP lloop + +lastLoop: + // Process last 16 rounds + PROCESS_LOOP( W0, 48, A, B, C, D, E, F, G, H) + PROCESS_LOOP( W1, 49, H, A, B, C, D, E, F, G) + PROCESS_LOOP( W2, 50, G, H, A, B, C, D, E, F) + PROCESS_LOOP( W3, 51, F, G, H, A, B, C, D, E) + PROCESS_LOOP( W4, 52, E, F, G, H, A, B, C, D) + PROCESS_LOOP( W5, 53, D, E, F, G, H, A, B, C) + PROCESS_LOOP( W6, 54, C, D, E, F, G, H, A, B) + PROCESS_LOOP( W7, 55, B, C, D, E, F, G, H, A) + PROCESS_LOOP( W8, 56, A, B, C, D, E, F, G, H) + PROCESS_LOOP( W9, 57, H, A, B, C, D, E, F, G) + PROCESS_LOOP(W10, 58, G, H, A, B, C, D, E, F) + PROCESS_LOOP(W11, 59, F, G, H, A, B, C, D, E) + PROCESS_LOOP(W12, 60, E, F, G, H, A, B, C, D) + PROCESS_LOOP(W13, 61, D, E, F, G, H, A, B, C) + PROCESS_LOOP(W14, 62, C, D, E, F, G, H, A, B) + PROCESS_LOOP(W15, 63, B, C, D, E, F, G, H, A) + + // Add old digest + vmovdqu32 TMP2, A + vmovdqu32 A, [SCRATCH + 64*0] + vpaddd A{k1}, A, TMP2 + vmovdqu32 TMP2, B + vmovdqu32 B, [SCRATCH + 64*1] + vpaddd B{k1}, B, TMP2 + vmovdqu32 TMP2, C + vmovdqu32 C, [SCRATCH + 64*2] + vpaddd C{k1}, C, TMP2 + vmovdqu32 TMP2, D + vmovdqu32 D, [SCRATCH + 64*3] + vpaddd D{k1}, D, TMP2 + vmovdqu32 TMP2, E + vmovdqu32 E, [SCRATCH + 64*4] + vpaddd E{k1}, E, TMP2 + vmovdqu32 TMP2, F + vmovdqu32 F, [SCRATCH + 64*5] + vpaddd F{k1}, F, TMP2 + vmovdqu32 TMP2, G + vmovdqu32 G, [SCRATCH + 64*6] + vpaddd G{k1}, G, TMP2 + vmovdqu32 TMP2, H + vmovdqu32 H, [SCRATCH + 64*7] + vpaddd H{k1}, H, TMP2 + + // Write out digest + vmovdqu32 [STATE + 0*SHA256_DIGEST_ROW_SIZE], A + vmovdqu32 [STATE + 1*SHA256_DIGEST_ROW_SIZE], B + vmovdqu32 [STATE + 2*SHA256_DIGEST_ROW_SIZE], C + vmovdqu32 [STATE + 3*SHA256_DIGEST_ROW_SIZE], D + vmovdqu32 [STATE + 4*SHA256_DIGEST_ROW_SIZE], E + vmovdqu32 [STATE + 5*SHA256_DIGEST_ROW_SIZE], F + vmovdqu32 [STATE + 6*SHA256_DIGEST_ROW_SIZE], G + vmovdqu32 [STATE + 7*SHA256_DIGEST_ROW_SIZE], H + + VZEROUPPER + RET + +// +// Tables +// + +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x000(SB)/8, $0x0405060700010203 +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x008(SB)/8, $0x0c0d0e0f08090a0b +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x010(SB)/8, $0x0405060700010203 +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x018(SB)/8, $0x0c0d0e0f08090a0b +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x020(SB)/8, $0x0405060700010203 +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x028(SB)/8, $0x0c0d0e0f08090a0b +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x030(SB)/8, $0x0405060700010203 +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x038(SB)/8, $0x0c0d0e0f08090a0b +GLOBL PSHUFFLE_BYTE_FLIP_MASK<>(SB), 8, $64 + +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x000(SB)/8, $0x0000000000000000 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x008(SB)/8, $0x0000000000000001 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x010(SB)/8, $0x0000000000000008 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x018(SB)/8, $0x0000000000000009 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x020(SB)/8, $0x0000000000000004 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x028(SB)/8, $0x0000000000000005 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x030(SB)/8, $0x000000000000000C +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x038(SB)/8, $0x000000000000000D +GLOBL PSHUFFLE_TRANSPOSE16_MASK1<>(SB), 8, $64 + +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x000(SB)/8, $0x0000000000000002 +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x008(SB)/8, $0x0000000000000003 +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x010(SB)/8, $0x000000000000000A +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x018(SB)/8, $0x000000000000000B +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x020(SB)/8, $0x0000000000000006 +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x028(SB)/8, $0x0000000000000007 +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x030(SB)/8, $0x000000000000000E +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x038(SB)/8, $0x000000000000000F +GLOBL PSHUFFLE_TRANSPOSE16_MASK2<>(SB), 8, $64 diff --git a/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.go b/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.go new file mode 100644 index 0000000000..4b9473a4e7 --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.go @@ -0,0 +1,501 @@ +//go:build !noasm && !appengine && gc +// +build !noasm,!appengine,gc + +/* + * Minio Cloud Storage, (C) 2017 Minio, Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package sha256 + +import ( + "encoding/binary" + "errors" + "hash" + "sort" + "sync/atomic" + "time" +) + +//go:noescape +func sha256X16Avx512(digests *[512]byte, scratch *[512]byte, table *[512]uint64, mask []uint64, inputs [16][]byte) + +// Avx512ServerUID - Do not start at 0 but next multiple of 16 so as to be able to +// differentiate with default initialiation value of 0 +const Avx512ServerUID = 16 + +var uidCounter uint64 + +// NewAvx512 - initialize sha256 Avx512 implementation. +func NewAvx512(a512srv *Avx512Server) hash.Hash { + uid := atomic.AddUint64(&uidCounter, 1) + return &Avx512Digest{uid: uid, a512srv: a512srv} +} + +// Avx512Digest - Type for computing SHA256 using Avx512 +type Avx512Digest struct { + uid uint64 + a512srv *Avx512Server + x [chunk]byte + nx int + len uint64 + final bool + result [Size]byte +} + +// Size - Return size of checksum +func (d *Avx512Digest) Size() int { return Size } + +// BlockSize - Return blocksize of checksum +func (d Avx512Digest) BlockSize() int { return BlockSize } + +// Reset - reset sha digest to its initial values +func (d *Avx512Digest) Reset() { + d.a512srv.blocksCh <- blockInput{uid: d.uid, reset: true} + d.nx = 0 + d.len = 0 + d.final = false +} + +// Write to digest +func (d *Avx512Digest) Write(p []byte) (nn int, err error) { + + if d.final { + return 0, errors.New("Avx512Digest already finalized. Reset first before writing again") + } + + nn = len(p) + d.len += uint64(nn) + if d.nx > 0 { + n := copy(d.x[d.nx:], p) + d.nx += n + if d.nx == chunk { + d.a512srv.blocksCh <- blockInput{uid: d.uid, msg: d.x[:]} + d.nx = 0 + } + p = p[n:] + } + if len(p) >= chunk { + n := len(p) &^ (chunk - 1) + d.a512srv.blocksCh <- blockInput{uid: d.uid, msg: p[:n]} + p = p[n:] + } + if len(p) > 0 { + d.nx = copy(d.x[:], p) + } + return +} + +// Sum - Return sha256 sum in bytes +func (d *Avx512Digest) Sum(in []byte) (result []byte) { + + if d.final { + return append(in, d.result[:]...) + } + + trail := make([]byte, 0, 128) + trail = append(trail, d.x[:d.nx]...) + + len := d.len + // Padding. Add a 1 bit and 0 bits until 56 bytes mod 64. + var tmp [64]byte + tmp[0] = 0x80 + if len%64 < 56 { + trail = append(trail, tmp[0:56-len%64]...) + } else { + trail = append(trail, tmp[0:64+56-len%64]...) + } + d.nx = 0 + + // Length in bits. + len <<= 3 + for i := uint(0); i < 8; i++ { + tmp[i] = byte(len >> (56 - 8*i)) + } + trail = append(trail, tmp[0:8]...) + + sumCh := make(chan [Size]byte) + d.a512srv.blocksCh <- blockInput{uid: d.uid, msg: trail, final: true, sumCh: sumCh} + d.result = <-sumCh + d.final = true + return append(in, d.result[:]...) +} + +var table = [512]uint64{ + 0x428a2f98428a2f98, 0x428a2f98428a2f98, 0x428a2f98428a2f98, 0x428a2f98428a2f98, + 0x428a2f98428a2f98, 0x428a2f98428a2f98, 0x428a2f98428a2f98, 0x428a2f98428a2f98, + 0x7137449171374491, 0x7137449171374491, 0x7137449171374491, 0x7137449171374491, + 0x7137449171374491, 0x7137449171374491, 0x7137449171374491, 0x7137449171374491, + 0xb5c0fbcfb5c0fbcf, 0xb5c0fbcfb5c0fbcf, 0xb5c0fbcfb5c0fbcf, 0xb5c0fbcfb5c0fbcf, + 0xb5c0fbcfb5c0fbcf, 0xb5c0fbcfb5c0fbcf, 0xb5c0fbcfb5c0fbcf, 0xb5c0fbcfb5c0fbcf, + 0xe9b5dba5e9b5dba5, 0xe9b5dba5e9b5dba5, 0xe9b5dba5e9b5dba5, 0xe9b5dba5e9b5dba5, + 0xe9b5dba5e9b5dba5, 0xe9b5dba5e9b5dba5, 0xe9b5dba5e9b5dba5, 0xe9b5dba5e9b5dba5, + 0x3956c25b3956c25b, 0x3956c25b3956c25b, 0x3956c25b3956c25b, 0x3956c25b3956c25b, + 0x3956c25b3956c25b, 0x3956c25b3956c25b, 0x3956c25b3956c25b, 0x3956c25b3956c25b, + 0x59f111f159f111f1, 0x59f111f159f111f1, 0x59f111f159f111f1, 0x59f111f159f111f1, + 0x59f111f159f111f1, 0x59f111f159f111f1, 0x59f111f159f111f1, 0x59f111f159f111f1, + 0x923f82a4923f82a4, 0x923f82a4923f82a4, 0x923f82a4923f82a4, 0x923f82a4923f82a4, + 0x923f82a4923f82a4, 0x923f82a4923f82a4, 0x923f82a4923f82a4, 0x923f82a4923f82a4, + 0xab1c5ed5ab1c5ed5, 0xab1c5ed5ab1c5ed5, 0xab1c5ed5ab1c5ed5, 0xab1c5ed5ab1c5ed5, + 0xab1c5ed5ab1c5ed5, 0xab1c5ed5ab1c5ed5, 0xab1c5ed5ab1c5ed5, 0xab1c5ed5ab1c5ed5, + 0xd807aa98d807aa98, 0xd807aa98d807aa98, 0xd807aa98d807aa98, 0xd807aa98d807aa98, + 0xd807aa98d807aa98, 0xd807aa98d807aa98, 0xd807aa98d807aa98, 0xd807aa98d807aa98, + 0x12835b0112835b01, 0x12835b0112835b01, 0x12835b0112835b01, 0x12835b0112835b01, + 0x12835b0112835b01, 0x12835b0112835b01, 0x12835b0112835b01, 0x12835b0112835b01, + 0x243185be243185be, 0x243185be243185be, 0x243185be243185be, 0x243185be243185be, + 0x243185be243185be, 0x243185be243185be, 0x243185be243185be, 0x243185be243185be, + 0x550c7dc3550c7dc3, 0x550c7dc3550c7dc3, 0x550c7dc3550c7dc3, 0x550c7dc3550c7dc3, + 0x550c7dc3550c7dc3, 0x550c7dc3550c7dc3, 0x550c7dc3550c7dc3, 0x550c7dc3550c7dc3, + 0x72be5d7472be5d74, 0x72be5d7472be5d74, 0x72be5d7472be5d74, 0x72be5d7472be5d74, + 0x72be5d7472be5d74, 0x72be5d7472be5d74, 0x72be5d7472be5d74, 0x72be5d7472be5d74, + 0x80deb1fe80deb1fe, 0x80deb1fe80deb1fe, 0x80deb1fe80deb1fe, 0x80deb1fe80deb1fe, + 0x80deb1fe80deb1fe, 0x80deb1fe80deb1fe, 0x80deb1fe80deb1fe, 0x80deb1fe80deb1fe, + 0x9bdc06a79bdc06a7, 0x9bdc06a79bdc06a7, 0x9bdc06a79bdc06a7, 0x9bdc06a79bdc06a7, + 0x9bdc06a79bdc06a7, 0x9bdc06a79bdc06a7, 0x9bdc06a79bdc06a7, 0x9bdc06a79bdc06a7, + 0xc19bf174c19bf174, 0xc19bf174c19bf174, 0xc19bf174c19bf174, 0xc19bf174c19bf174, + 0xc19bf174c19bf174, 0xc19bf174c19bf174, 0xc19bf174c19bf174, 0xc19bf174c19bf174, + 0xe49b69c1e49b69c1, 0xe49b69c1e49b69c1, 0xe49b69c1e49b69c1, 0xe49b69c1e49b69c1, + 0xe49b69c1e49b69c1, 0xe49b69c1e49b69c1, 0xe49b69c1e49b69c1, 0xe49b69c1e49b69c1, + 0xefbe4786efbe4786, 0xefbe4786efbe4786, 0xefbe4786efbe4786, 0xefbe4786efbe4786, + 0xefbe4786efbe4786, 0xefbe4786efbe4786, 0xefbe4786efbe4786, 0xefbe4786efbe4786, + 0x0fc19dc60fc19dc6, 0x0fc19dc60fc19dc6, 0x0fc19dc60fc19dc6, 0x0fc19dc60fc19dc6, + 0x0fc19dc60fc19dc6, 0x0fc19dc60fc19dc6, 0x0fc19dc60fc19dc6, 0x0fc19dc60fc19dc6, + 0x240ca1cc240ca1cc, 0x240ca1cc240ca1cc, 0x240ca1cc240ca1cc, 0x240ca1cc240ca1cc, + 0x240ca1cc240ca1cc, 0x240ca1cc240ca1cc, 0x240ca1cc240ca1cc, 0x240ca1cc240ca1cc, + 0x2de92c6f2de92c6f, 0x2de92c6f2de92c6f, 0x2de92c6f2de92c6f, 0x2de92c6f2de92c6f, + 0x2de92c6f2de92c6f, 0x2de92c6f2de92c6f, 0x2de92c6f2de92c6f, 0x2de92c6f2de92c6f, + 0x4a7484aa4a7484aa, 0x4a7484aa4a7484aa, 0x4a7484aa4a7484aa, 0x4a7484aa4a7484aa, + 0x4a7484aa4a7484aa, 0x4a7484aa4a7484aa, 0x4a7484aa4a7484aa, 0x4a7484aa4a7484aa, + 0x5cb0a9dc5cb0a9dc, 0x5cb0a9dc5cb0a9dc, 0x5cb0a9dc5cb0a9dc, 0x5cb0a9dc5cb0a9dc, + 0x5cb0a9dc5cb0a9dc, 0x5cb0a9dc5cb0a9dc, 0x5cb0a9dc5cb0a9dc, 0x5cb0a9dc5cb0a9dc, + 0x76f988da76f988da, 0x76f988da76f988da, 0x76f988da76f988da, 0x76f988da76f988da, + 0x76f988da76f988da, 0x76f988da76f988da, 0x76f988da76f988da, 0x76f988da76f988da, + 0x983e5152983e5152, 0x983e5152983e5152, 0x983e5152983e5152, 0x983e5152983e5152, + 0x983e5152983e5152, 0x983e5152983e5152, 0x983e5152983e5152, 0x983e5152983e5152, + 0xa831c66da831c66d, 0xa831c66da831c66d, 0xa831c66da831c66d, 0xa831c66da831c66d, + 0xa831c66da831c66d, 0xa831c66da831c66d, 0xa831c66da831c66d, 0xa831c66da831c66d, + 0xb00327c8b00327c8, 0xb00327c8b00327c8, 0xb00327c8b00327c8, 0xb00327c8b00327c8, + 0xb00327c8b00327c8, 0xb00327c8b00327c8, 0xb00327c8b00327c8, 0xb00327c8b00327c8, + 0xbf597fc7bf597fc7, 0xbf597fc7bf597fc7, 0xbf597fc7bf597fc7, 0xbf597fc7bf597fc7, + 0xbf597fc7bf597fc7, 0xbf597fc7bf597fc7, 0xbf597fc7bf597fc7, 0xbf597fc7bf597fc7, + 0xc6e00bf3c6e00bf3, 0xc6e00bf3c6e00bf3, 0xc6e00bf3c6e00bf3, 0xc6e00bf3c6e00bf3, + 0xc6e00bf3c6e00bf3, 0xc6e00bf3c6e00bf3, 0xc6e00bf3c6e00bf3, 0xc6e00bf3c6e00bf3, + 0xd5a79147d5a79147, 0xd5a79147d5a79147, 0xd5a79147d5a79147, 0xd5a79147d5a79147, + 0xd5a79147d5a79147, 0xd5a79147d5a79147, 0xd5a79147d5a79147, 0xd5a79147d5a79147, + 0x06ca635106ca6351, 0x06ca635106ca6351, 0x06ca635106ca6351, 0x06ca635106ca6351, + 0x06ca635106ca6351, 0x06ca635106ca6351, 0x06ca635106ca6351, 0x06ca635106ca6351, + 0x1429296714292967, 0x1429296714292967, 0x1429296714292967, 0x1429296714292967, + 0x1429296714292967, 0x1429296714292967, 0x1429296714292967, 0x1429296714292967, + 0x27b70a8527b70a85, 0x27b70a8527b70a85, 0x27b70a8527b70a85, 0x27b70a8527b70a85, + 0x27b70a8527b70a85, 0x27b70a8527b70a85, 0x27b70a8527b70a85, 0x27b70a8527b70a85, + 0x2e1b21382e1b2138, 0x2e1b21382e1b2138, 0x2e1b21382e1b2138, 0x2e1b21382e1b2138, + 0x2e1b21382e1b2138, 0x2e1b21382e1b2138, 0x2e1b21382e1b2138, 0x2e1b21382e1b2138, + 0x4d2c6dfc4d2c6dfc, 0x4d2c6dfc4d2c6dfc, 0x4d2c6dfc4d2c6dfc, 0x4d2c6dfc4d2c6dfc, + 0x4d2c6dfc4d2c6dfc, 0x4d2c6dfc4d2c6dfc, 0x4d2c6dfc4d2c6dfc, 0x4d2c6dfc4d2c6dfc, + 0x53380d1353380d13, 0x53380d1353380d13, 0x53380d1353380d13, 0x53380d1353380d13, + 0x53380d1353380d13, 0x53380d1353380d13, 0x53380d1353380d13, 0x53380d1353380d13, + 0x650a7354650a7354, 0x650a7354650a7354, 0x650a7354650a7354, 0x650a7354650a7354, + 0x650a7354650a7354, 0x650a7354650a7354, 0x650a7354650a7354, 0x650a7354650a7354, + 0x766a0abb766a0abb, 0x766a0abb766a0abb, 0x766a0abb766a0abb, 0x766a0abb766a0abb, + 0x766a0abb766a0abb, 0x766a0abb766a0abb, 0x766a0abb766a0abb, 0x766a0abb766a0abb, + 0x81c2c92e81c2c92e, 0x81c2c92e81c2c92e, 0x81c2c92e81c2c92e, 0x81c2c92e81c2c92e, + 0x81c2c92e81c2c92e, 0x81c2c92e81c2c92e, 0x81c2c92e81c2c92e, 0x81c2c92e81c2c92e, + 0x92722c8592722c85, 0x92722c8592722c85, 0x92722c8592722c85, 0x92722c8592722c85, + 0x92722c8592722c85, 0x92722c8592722c85, 0x92722c8592722c85, 0x92722c8592722c85, + 0xa2bfe8a1a2bfe8a1, 0xa2bfe8a1a2bfe8a1, 0xa2bfe8a1a2bfe8a1, 0xa2bfe8a1a2bfe8a1, + 0xa2bfe8a1a2bfe8a1, 0xa2bfe8a1a2bfe8a1, 0xa2bfe8a1a2bfe8a1, 0xa2bfe8a1a2bfe8a1, + 0xa81a664ba81a664b, 0xa81a664ba81a664b, 0xa81a664ba81a664b, 0xa81a664ba81a664b, + 0xa81a664ba81a664b, 0xa81a664ba81a664b, 0xa81a664ba81a664b, 0xa81a664ba81a664b, + 0xc24b8b70c24b8b70, 0xc24b8b70c24b8b70, 0xc24b8b70c24b8b70, 0xc24b8b70c24b8b70, + 0xc24b8b70c24b8b70, 0xc24b8b70c24b8b70, 0xc24b8b70c24b8b70, 0xc24b8b70c24b8b70, + 0xc76c51a3c76c51a3, 0xc76c51a3c76c51a3, 0xc76c51a3c76c51a3, 0xc76c51a3c76c51a3, + 0xc76c51a3c76c51a3, 0xc76c51a3c76c51a3, 0xc76c51a3c76c51a3, 0xc76c51a3c76c51a3, + 0xd192e819d192e819, 0xd192e819d192e819, 0xd192e819d192e819, 0xd192e819d192e819, + 0xd192e819d192e819, 0xd192e819d192e819, 0xd192e819d192e819, 0xd192e819d192e819, + 0xd6990624d6990624, 0xd6990624d6990624, 0xd6990624d6990624, 0xd6990624d6990624, + 0xd6990624d6990624, 0xd6990624d6990624, 0xd6990624d6990624, 0xd6990624d6990624, + 0xf40e3585f40e3585, 0xf40e3585f40e3585, 0xf40e3585f40e3585, 0xf40e3585f40e3585, + 0xf40e3585f40e3585, 0xf40e3585f40e3585, 0xf40e3585f40e3585, 0xf40e3585f40e3585, + 0x106aa070106aa070, 0x106aa070106aa070, 0x106aa070106aa070, 0x106aa070106aa070, + 0x106aa070106aa070, 0x106aa070106aa070, 0x106aa070106aa070, 0x106aa070106aa070, + 0x19a4c11619a4c116, 0x19a4c11619a4c116, 0x19a4c11619a4c116, 0x19a4c11619a4c116, + 0x19a4c11619a4c116, 0x19a4c11619a4c116, 0x19a4c11619a4c116, 0x19a4c11619a4c116, + 0x1e376c081e376c08, 0x1e376c081e376c08, 0x1e376c081e376c08, 0x1e376c081e376c08, + 0x1e376c081e376c08, 0x1e376c081e376c08, 0x1e376c081e376c08, 0x1e376c081e376c08, + 0x2748774c2748774c, 0x2748774c2748774c, 0x2748774c2748774c, 0x2748774c2748774c, + 0x2748774c2748774c, 0x2748774c2748774c, 0x2748774c2748774c, 0x2748774c2748774c, + 0x34b0bcb534b0bcb5, 0x34b0bcb534b0bcb5, 0x34b0bcb534b0bcb5, 0x34b0bcb534b0bcb5, + 0x34b0bcb534b0bcb5, 0x34b0bcb534b0bcb5, 0x34b0bcb534b0bcb5, 0x34b0bcb534b0bcb5, + 0x391c0cb3391c0cb3, 0x391c0cb3391c0cb3, 0x391c0cb3391c0cb3, 0x391c0cb3391c0cb3, + 0x391c0cb3391c0cb3, 0x391c0cb3391c0cb3, 0x391c0cb3391c0cb3, 0x391c0cb3391c0cb3, + 0x4ed8aa4a4ed8aa4a, 0x4ed8aa4a4ed8aa4a, 0x4ed8aa4a4ed8aa4a, 0x4ed8aa4a4ed8aa4a, + 0x4ed8aa4a4ed8aa4a, 0x4ed8aa4a4ed8aa4a, 0x4ed8aa4a4ed8aa4a, 0x4ed8aa4a4ed8aa4a, + 0x5b9cca4f5b9cca4f, 0x5b9cca4f5b9cca4f, 0x5b9cca4f5b9cca4f, 0x5b9cca4f5b9cca4f, + 0x5b9cca4f5b9cca4f, 0x5b9cca4f5b9cca4f, 0x5b9cca4f5b9cca4f, 0x5b9cca4f5b9cca4f, + 0x682e6ff3682e6ff3, 0x682e6ff3682e6ff3, 0x682e6ff3682e6ff3, 0x682e6ff3682e6ff3, + 0x682e6ff3682e6ff3, 0x682e6ff3682e6ff3, 0x682e6ff3682e6ff3, 0x682e6ff3682e6ff3, + 0x748f82ee748f82ee, 0x748f82ee748f82ee, 0x748f82ee748f82ee, 0x748f82ee748f82ee, + 0x748f82ee748f82ee, 0x748f82ee748f82ee, 0x748f82ee748f82ee, 0x748f82ee748f82ee, + 0x78a5636f78a5636f, 0x78a5636f78a5636f, 0x78a5636f78a5636f, 0x78a5636f78a5636f, + 0x78a5636f78a5636f, 0x78a5636f78a5636f, 0x78a5636f78a5636f, 0x78a5636f78a5636f, + 0x84c8781484c87814, 0x84c8781484c87814, 0x84c8781484c87814, 0x84c8781484c87814, + 0x84c8781484c87814, 0x84c8781484c87814, 0x84c8781484c87814, 0x84c8781484c87814, + 0x8cc702088cc70208, 0x8cc702088cc70208, 0x8cc702088cc70208, 0x8cc702088cc70208, + 0x8cc702088cc70208, 0x8cc702088cc70208, 0x8cc702088cc70208, 0x8cc702088cc70208, + 0x90befffa90befffa, 0x90befffa90befffa, 0x90befffa90befffa, 0x90befffa90befffa, + 0x90befffa90befffa, 0x90befffa90befffa, 0x90befffa90befffa, 0x90befffa90befffa, + 0xa4506ceba4506ceb, 0xa4506ceba4506ceb, 0xa4506ceba4506ceb, 0xa4506ceba4506ceb, + 0xa4506ceba4506ceb, 0xa4506ceba4506ceb, 0xa4506ceba4506ceb, 0xa4506ceba4506ceb, + 0xbef9a3f7bef9a3f7, 0xbef9a3f7bef9a3f7, 0xbef9a3f7bef9a3f7, 0xbef9a3f7bef9a3f7, + 0xbef9a3f7bef9a3f7, 0xbef9a3f7bef9a3f7, 0xbef9a3f7bef9a3f7, 0xbef9a3f7bef9a3f7, + 0xc67178f2c67178f2, 0xc67178f2c67178f2, 0xc67178f2c67178f2, 0xc67178f2c67178f2, + 0xc67178f2c67178f2, 0xc67178f2c67178f2, 0xc67178f2c67178f2, 0xc67178f2c67178f2} + +// Interface function to assembly ode +func blockAvx512(digests *[512]byte, input [16][]byte, mask []uint64) [16][Size]byte { + + scratch := [512]byte{} + sha256X16Avx512(digests, &scratch, &table, mask, input) + + output := [16][Size]byte{} + for i := 0; i < 16; i++ { + output[i] = getDigest(i, digests[:]) + } + + return output +} + +func getDigest(index int, state []byte) (sum [Size]byte) { + for j := 0; j < 16; j += 2 { + for i := index*4 + j*Size; i < index*4+(j+1)*Size; i += Size { + binary.BigEndian.PutUint32(sum[j*2:], binary.LittleEndian.Uint32(state[i:i+4])) + } + } + return +} + +// Message to send across input channel +type blockInput struct { + uid uint64 + msg []byte + reset bool + final bool + sumCh chan [Size]byte +} + +// Avx512Server - Type to implement 16x parallel handling of SHA256 invocations +type Avx512Server struct { + blocksCh chan blockInput // Input channel + totalIn int // Total number of inputs waiting to be processed + lanes [16]Avx512LaneInfo // Array with info per lane (out of 16) + digests map[uint64][Size]byte // Map of uids to (interim) digest results +} + +// Avx512LaneInfo - Info for each lane +type Avx512LaneInfo struct { + uid uint64 // unique identification for this SHA processing + block []byte // input block to be processed + outputCh chan [Size]byte // channel for output result +} + +// NewAvx512Server - Create new object for parallel processing handling +func NewAvx512Server() *Avx512Server { + a512srv := &Avx512Server{} + a512srv.digests = make(map[uint64][Size]byte) + a512srv.blocksCh = make(chan blockInput) + + // Start a single thread for reading from the input channel + go a512srv.Process() + return a512srv +} + +// Process - Sole handler for reading from the input channel +func (a512srv *Avx512Server) Process() { + for { + select { + case block := <-a512srv.blocksCh: + if block.reset { + a512srv.reset(block.uid) + continue + } + index := block.uid & 0xf + // fmt.Println("Adding message:", block.uid, index) + + if a512srv.lanes[index].block != nil { // If slot is already filled, process all inputs + //fmt.Println("Invoking Blocks()") + a512srv.blocks() + } + a512srv.totalIn++ + a512srv.lanes[index] = Avx512LaneInfo{uid: block.uid, block: block.msg} + if block.final { + a512srv.lanes[index].outputCh = block.sumCh + } + if a512srv.totalIn == len(a512srv.lanes) { + // fmt.Println("Invoking Blocks() while FULL: ") + a512srv.blocks() + } + + // TODO: test with larger timeout + case <-time.After(1 * time.Microsecond): + for _, lane := range a512srv.lanes { + if lane.block != nil { // check if there is any input to process + // fmt.Println("Invoking Blocks() on TIMEOUT: ") + a512srv.blocks() + break // we are done + } + } + } + } +} + +// Do a reset for this calculation +func (a512srv *Avx512Server) reset(uid uint64) { + + // Check if there is a message still waiting to be processed (and remove if so) + for i, lane := range a512srv.lanes { + if lane.uid == uid { + if lane.block != nil { + a512srv.lanes[i] = Avx512LaneInfo{} // clear message + a512srv.totalIn-- + } + } + } + + // Delete entry from hash map + delete(a512srv.digests, uid) +} + +// Invoke assembly and send results back +func (a512srv *Avx512Server) blocks() { + + inputs := [16][]byte{} + for i := range inputs { + inputs[i] = a512srv.lanes[i].block + } + + mask := expandMask(genMask(inputs)) + outputs := blockAvx512(a512srv.getDigests(), inputs, mask) + + a512srv.totalIn = 0 + for i := 0; i < len(outputs); i++ { + uid, outputCh := a512srv.lanes[i].uid, a512srv.lanes[i].outputCh + a512srv.digests[uid] = outputs[i] + a512srv.lanes[i] = Avx512LaneInfo{} + + if outputCh != nil { + // Send back result + outputCh <- outputs[i] + delete(a512srv.digests, uid) // Delete entry from hashmap + } + } +} + +func (a512srv *Avx512Server) Write(uid uint64, p []byte) (nn int, err error) { + a512srv.blocksCh <- blockInput{uid: uid, msg: p} + return len(p), nil +} + +// Sum - return sha256 sum in bytes for a given sum id. +func (a512srv *Avx512Server) Sum(uid uint64, p []byte) [32]byte { + sumCh := make(chan [32]byte) + a512srv.blocksCh <- blockInput{uid: uid, msg: p, final: true, sumCh: sumCh} + return <-sumCh +} + +func (a512srv *Avx512Server) getDigests() *[512]byte { + digests := [512]byte{} + for i, lane := range a512srv.lanes { + a, ok := a512srv.digests[lane.uid] + if ok { + binary.BigEndian.PutUint32(digests[(i+0*16)*4:], binary.LittleEndian.Uint32(a[0:4])) + binary.BigEndian.PutUint32(digests[(i+1*16)*4:], binary.LittleEndian.Uint32(a[4:8])) + binary.BigEndian.PutUint32(digests[(i+2*16)*4:], binary.LittleEndian.Uint32(a[8:12])) + binary.BigEndian.PutUint32(digests[(i+3*16)*4:], binary.LittleEndian.Uint32(a[12:16])) + binary.BigEndian.PutUint32(digests[(i+4*16)*4:], binary.LittleEndian.Uint32(a[16:20])) + binary.BigEndian.PutUint32(digests[(i+5*16)*4:], binary.LittleEndian.Uint32(a[20:24])) + binary.BigEndian.PutUint32(digests[(i+6*16)*4:], binary.LittleEndian.Uint32(a[24:28])) + binary.BigEndian.PutUint32(digests[(i+7*16)*4:], binary.LittleEndian.Uint32(a[28:32])) + } else { + binary.LittleEndian.PutUint32(digests[(i+0*16)*4:], init0) + binary.LittleEndian.PutUint32(digests[(i+1*16)*4:], init1) + binary.LittleEndian.PutUint32(digests[(i+2*16)*4:], init2) + binary.LittleEndian.PutUint32(digests[(i+3*16)*4:], init3) + binary.LittleEndian.PutUint32(digests[(i+4*16)*4:], init4) + binary.LittleEndian.PutUint32(digests[(i+5*16)*4:], init5) + binary.LittleEndian.PutUint32(digests[(i+6*16)*4:], init6) + binary.LittleEndian.PutUint32(digests[(i+7*16)*4:], init7) + } + } + return &digests +} + +// Helper struct for sorting blocks based on length +type lane struct { + len uint + pos uint +} + +type lanes []lane + +func (lns lanes) Len() int { return len(lns) } +func (lns lanes) Swap(i, j int) { lns[i], lns[j] = lns[j], lns[i] } +func (lns lanes) Less(i, j int) bool { return lns[i].len < lns[j].len } + +// Helper struct for +type maskRounds struct { + mask uint64 + rounds uint64 +} + +func genMask(input [16][]byte) [16]maskRounds { + + // Sort on blocks length small to large + var sorted [16]lane + for c, inpt := range input { + sorted[c] = lane{uint(len(inpt)), uint(c)} + } + sort.Sort(lanes(sorted[:])) + + // Create mask array including 'rounds' between masks + m, round, index := uint64(0xffff), uint64(0), 0 + var mr [16]maskRounds + for _, s := range sorted { + if s.len > 0 { + if uint64(s.len)>>6 > round { + mr[index] = maskRounds{m, (uint64(s.len) >> 6) - round} + index++ + } + round = uint64(s.len) >> 6 + } + m = m & ^(1 << uint(s.pos)) + } + + return mr +} + +// TODO: remove function +func expandMask(mr [16]maskRounds) []uint64 { + size := uint64(0) + for _, r := range mr { + size += r.rounds + } + result, index := make([]uint64, size), 0 + for _, r := range mr { + for j := uint64(0); j < r.rounds; j++ { + result[index] = r.mask + index++ + } + } + return result +} diff --git a/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.s b/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.s new file mode 100644 index 0000000000..cca534e461 --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/sha256blockAvx512_amd64.s @@ -0,0 +1,267 @@ +//+build !noasm,!appengine,gc + +TEXT ·sha256X16Avx512(SB), 7, $0 + MOVQ digests+0(FP), DI + MOVQ scratch+8(FP), R12 + MOVQ mask_len+32(FP), SI + MOVQ mask_base+24(FP), R13 + MOVQ (R13), R14 + LONG $0x92fbc1c4; BYTE $0xce + LEAQ inputs+48(FP), AX + QUAD $0xf162076f487ef162; QUAD $0x7ef162014f6f487e; QUAD $0x487ef16202576f48; QUAD $0x6f487ef162035f6f; QUAD $0x6f6f487ef1620467; QUAD $0x06776f487ef16205; LONG $0x487ef162; WORD $0x7f6f; BYTE $0x07 + MOVQ table+16(FP), DX + WORD $0x3148; BYTE $0xc9 + TESTQ $(1<<0), R14 + JE skipInput0 + MOVQ 0*24(AX), R9 + LONG $0x487cc162; WORD $0x0410; BYTE $0x09 + +skipInput0: + TESTQ $(1<<1), R14 + JE skipInput1 + MOVQ 1*24(AX), R9 + LONG $0x487cc162; WORD $0x0c10; BYTE $0x09 + +skipInput1: + TESTQ $(1<<2), R14 + JE skipInput2 + MOVQ 2*24(AX), R9 + LONG $0x487cc162; WORD $0x1410; BYTE $0x09 + +skipInput2: + TESTQ $(1<<3), R14 + JE skipInput3 + MOVQ 3*24(AX), R9 + LONG $0x487cc162; WORD $0x1c10; BYTE $0x09 + +skipInput3: + TESTQ $(1<<4), R14 + JE skipInput4 + MOVQ 4*24(AX), R9 + LONG $0x487cc162; WORD $0x2410; BYTE $0x09 + +skipInput4: + TESTQ $(1<<5), R14 + JE skipInput5 + MOVQ 5*24(AX), R9 + LONG $0x487cc162; WORD $0x2c10; BYTE $0x09 + +skipInput5: + TESTQ $(1<<6), R14 + JE skipInput6 + MOVQ 6*24(AX), R9 + LONG $0x487cc162; WORD $0x3410; BYTE $0x09 + +skipInput6: + TESTQ $(1<<7), R14 + JE skipInput7 + MOVQ 7*24(AX), R9 + LONG $0x487cc162; WORD $0x3c10; BYTE $0x09 + +skipInput7: + TESTQ $(1<<8), R14 + JE skipInput8 + MOVQ 8*24(AX), R9 + LONG $0x487c4162; WORD $0x0410; BYTE $0x09 + +skipInput8: + TESTQ $(1<<9), R14 + JE skipInput9 + MOVQ 9*24(AX), R9 + LONG $0x487c4162; WORD $0x0c10; BYTE $0x09 + +skipInput9: + TESTQ $(1<<10), R14 + JE skipInput10 + MOVQ 10*24(AX), R9 + LONG $0x487c4162; WORD $0x1410; BYTE $0x09 + +skipInput10: + TESTQ $(1<<11), R14 + JE skipInput11 + MOVQ 11*24(AX), R9 + LONG $0x487c4162; WORD $0x1c10; BYTE $0x09 + +skipInput11: + TESTQ $(1<<12), R14 + JE skipInput12 + MOVQ 12*24(AX), R9 + LONG $0x487c4162; WORD $0x2410; BYTE $0x09 + +skipInput12: + TESTQ $(1<<13), R14 + JE skipInput13 + MOVQ 13*24(AX), R9 + LONG $0x487c4162; WORD $0x2c10; BYTE $0x09 + +skipInput13: + TESTQ $(1<<14), R14 + JE skipInput14 + MOVQ 14*24(AX), R9 + LONG $0x487c4162; WORD $0x3410; BYTE $0x09 + +skipInput14: + TESTQ $(1<<15), R14 + JE skipInput15 + MOVQ 15*24(AX), R9 + LONG $0x487c4162; WORD $0x3c10; BYTE $0x09 + +skipInput15: +lloop: + LEAQ PSHUFFLE_BYTE_FLIP_MASK<>(SB), DX + LONG $0x487e7162; WORD $0x1a6f + MOVQ table+16(FP), DX + QUAD $0xd162226f487e7162; QUAD $0x7ed16224047f487e; QUAD $0x7ed16201244c7f48; QUAD $0x7ed1620224547f48; QUAD $0x7ed16203245c7f48; QUAD $0x7ed1620424647f48; QUAD $0x7ed16205246c7f48; QUAD $0x7ed1620624747f48; QUAD $0xc1834807247c7f48; QUAD $0x44c9c6407c316240; QUAD $0x62eec1c6407ca162; QUAD $0xa16244d3c6406c31; QUAD $0x34c162eed3c6406c; QUAD $0x407ca162dddac648; QUAD $0xc6407ca16288cac6; QUAD $0xcac648345162ddc2; QUAD $0x44d5c6405ca16288; QUAD $0x62eee5c6405ca162; QUAD $0xa16244d7c6404c31; QUAD $0x6cc162eef7c6404c; QUAD $0x405ca162ddfac640; QUAD $0xc6405ca16288eec6; QUAD $0xd2c6406cc162dde6; QUAD $0x44f1c6403c816288; QUAD $0x62eec1c6403c0162; QUAD $0x016244d3c6402c11; QUAD $0x4c4162eed3c6402c; QUAD $0x403c0162dddac640; QUAD $0xc6403c016288cac6; QUAD $0xf2c6404cc162ddc2; QUAD $0x44d5c6401c016288; QUAD $0x62eee5c6401c0162; QUAD $0x016244d7c6400c11; QUAD $0x2c4162eef7c6400c; QUAD $0x401c0162ddfac640; QUAD $0xc6401c016288eec6; QUAD $0xd2c6402c4162dde6; BYTE $0x88 + LEAQ PSHUFFLE_TRANSPOSE16_MASK1<>(SB), BX + LEAQ PSHUFFLE_TRANSPOSE16_MASK2<>(SB), R8 + QUAD $0x2262336f487e6162; QUAD $0x487e5162f27648b5; QUAD $0xd27648b53262106f; QUAD $0xa262136f487ee162; QUAD $0x487e5162d77640e5; QUAD $0xcf7640e53262086f; QUAD $0xa2621b6f487ee162; QUAD $0x487ec162dd7640f5; QUAD $0xfd7640f5a262386f; QUAD $0xa2620b6f487ee162; QUAD $0x487ec162cc7640fd; QUAD $0xec7640fda262286f; QUAD $0x8262036f487ee162; QUAD $0x487ec162c27640cd; QUAD $0xe27640cd8262206f; QUAD $0x8262336f487ee162; QUAD $0x487e4162f77640a5; QUAD $0xd77640a50262106f; QUAD $0x02621b6f487e6162; QUAD $0x487e4162dd7640b5; QUAD $0xfd7640b50262386f; QUAD $0x02620b6f487e6162; QUAD $0x487e4162cc7640bd; QUAD $0xec7640bd0262286f; QUAD $0x62eec023408d2362; QUAD $0x236244c023408da3; QUAD $0xada362eee42348ad; QUAD $0x40c5036244e42348; QUAD $0x2340c51362eef723; QUAD $0xfd2340d5036244d7; QUAD $0x44fd2340d58362ee; QUAD $0x62eeea2348b50362; QUAD $0x036244ea2348b583; QUAD $0xe51362eed32340e5; QUAD $0x40f5036244cb2340; QUAD $0x2340f58362eed923; QUAD $0xce2340ed236244d9; QUAD $0x44ce2340eda362ee; QUAD $0xc162d16f487ec162; QUAD $0x407dc262f26f487e; QUAD $0xcb004075c262c300; QUAD $0xc262d300406dc262; QUAD $0x405dc262db004065; QUAD $0xeb004055c262e300; QUAD $0xc262f300404dc262; QUAD $0x403d4262fb004045; QUAD $0xcb0040354262c300; QUAD $0x4262d300402d4262; QUAD $0x401d4262db004025; QUAD $0xeb0040154262e300; QUAD $0x4262f300400d4262; QUAD $0x48455162fb004005; QUAD $0xcc6f487e7162c4fe; QUAD $0x6206c472482df162; QUAD $0xf1620bc4724825f1; QUAD $0x55736219c472481d; QUAD $0x483d3162cace2548; QUAD $0xd42548255362c0fe; QUAD $0x62c1fe483d516296; QUAD $0x65d162c2fe483d51; QUAD $0x724845f162d8fe48; QUAD $0xc0724825f16202c0; QUAD $0x16c072481df1620d; QUAD $0x7362c86f487e7162; QUAD $0x25d362e8ca254875; QUAD $0x4845d16296fc2548; QUAD $0xf8fe4845d162f9fe; QUAD $0x6201626f487e7162; QUAD $0x916211c672481591; QUAD $0x05916213c672480d; QUAD $0x480d53620ad67248; QUAD $0xfe407dc16296ef25; QUAD $0x62c1fe407d8162c5; QUAD $0xb16207c1724815b1; QUAD $0x05b16212c172480d; QUAD $0x480d536203d17248; QUAD $0xfe407dc16296ef25; QUAD $0x62c4fe484d5162c5; QUAD $0x2df162cb6f487e71; QUAD $0x4825f16206c37248; QUAD $0x72481df1620bc372; QUAD $0xcd25485d736219c3; QUAD $0x62c1fe483d3162ca; QUAD $0x516296d425482553; QUAD $0x483d5162c1fe483d; QUAD $0xd0fe486dd162c2fe; QUAD $0x6202c772484df162; QUAD $0xf1620dc7724825f1; QUAD $0x7e716216c772481d; QUAD $0x25487d7362cf6f48; QUAD $0xf4254825d362e8c9; QUAD $0x62f1fe484dd16296; QUAD $0x7e7162f0fe484dd1; QUAD $0x4815916202626f48; QUAD $0x72480d916211c772; QUAD $0xd7724805916213c7; QUAD $0x96ef25480d53620a; QUAD $0x8162cdfe4075c162; QUAD $0x4815b162cafe4075; QUAD $0x72480db16207c272; QUAD $0xd2724805b16212c2; QUAD $0x96ef25480d536203; QUAD $0x5162cdfe4075c162; QUAD $0x487e7162c4fe4855; QUAD $0xc272482df162ca6f; QUAD $0x0bc2724825f16206; QUAD $0x6219c272481df162; QUAD $0x3162cacc25486573; QUAD $0x48255362c2fe483d; QUAD $0xfe483d516296d425; QUAD $0x62c2fe483d5162c1; QUAD $0x55f162c8fe4875d1; QUAD $0x4825f16202c67248; QUAD $0x72481df1620dc672; QUAD $0xce6f487e716216c6; QUAD $0x62e8c82548457362; QUAD $0xd16296ec254825d3; QUAD $0x4855d162e9fe4855; QUAD $0x626f487e7162e8fe; QUAD $0x11c0724815b16203; QUAD $0x6213c072480db162; QUAD $0x53620ad0724805b1; QUAD $0x6dc16296ef25480d; QUAD $0xfe406d8162d5fe40; QUAD $0x07c3724815b162d3; QUAD $0x6212c372480db162; QUAD $0x536203d3724805b1; QUAD $0x6dc16296ef25480d; QUAD $0xfe485d5162d5fe40; QUAD $0x62c96f487e7162c4; QUAD $0xf16206c172482df1; QUAD $0x1df1620bc1724825; QUAD $0x486d736219c17248; QUAD $0xfe483d3162cacb25; QUAD $0x96d42548255362c3; QUAD $0x5162c1fe483d5162; QUAD $0x487dd162c2fe483d; QUAD $0xc572485df162c0fe; QUAD $0x0dc5724825f16202; QUAD $0x6216c572481df162; QUAD $0x4d7362cd6f487e71; QUAD $0x4825d362e8cf2548; QUAD $0xfe485dd16296e425; QUAD $0x62e0fe485dd162e1; QUAD $0xb16204626f487e71; QUAD $0x0db16211c1724815; QUAD $0x4805b16213c17248; QUAD $0x25480d53620ad172; QUAD $0xddfe4065c16296ef; QUAD $0xb162dcfe40658162; QUAD $0x0db16207c4724815; QUAD $0x4805b16212c47248; QUAD $0x25480d536203d472; QUAD $0xddfe4065c16296ef; QUAD $0x7162c4fe48655162; QUAD $0x482df162c86f487e; QUAD $0x724825f16206c072; QUAD $0xc072481df1620bc0; QUAD $0xcaca254875736219; QUAD $0x5362c4fe483d3162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62f8fe4845d162c2; QUAD $0xf16202c4724865f1; QUAD $0x1df1620dc4724825; QUAD $0x487e716216c47248; QUAD $0xce2548557362cc6f; QUAD $0x96dc254825d362e8; QUAD $0xd162d9fe4865d162; QUAD $0x487e7162d8fe4865; QUAD $0x724815b16205626f; QUAD $0xc272480db16211c2; QUAD $0x0ad2724805b16213; QUAD $0x6296ef25480d5362; QUAD $0x5d8162e5fe405dc1; QUAD $0x724815b162e5fe40; QUAD $0xc572480db16207c5; QUAD $0x03d5724805b16212; QUAD $0x6296ef25480d5362; QUAD $0x6d5162e5fe405dc1; QUAD $0x6f487e7162c4fe48; QUAD $0x06c772482df162cf; QUAD $0x620bc7724825f162; QUAD $0x736219c772481df1; QUAD $0x3d3162cac925487d; QUAD $0x2548255362c5fe48; QUAD $0xc1fe483d516296d4; QUAD $0xd162c2fe483d5162; QUAD $0x486df162f0fe484d; QUAD $0x724825f16202c372; QUAD $0xc372481df1620dc3; QUAD $0x62cb6f487e716216; QUAD $0xd362e8cd25485d73; QUAD $0x6dd16296d4254825; QUAD $0xfe486dd162d1fe48; QUAD $0x06626f487e7162d0; QUAD $0x6211c3724815b162; QUAD $0xb16213c372480db1; QUAD $0x0d53620ad3724805; QUAD $0x4055c16296ef2548; QUAD $0xeefe40558162edfe; QUAD $0x6207c6724815b162; QUAD $0xb16212c672480db1; QUAD $0x0d536203d6724805; QUAD $0x4055c16296ef2548; QUAD $0xc4fe48755162edfe; QUAD $0xf162ce6f487e7162; QUAD $0x25f16206c672482d; QUAD $0x481df1620bc67248; QUAD $0x254845736219c672; QUAD $0xc6fe483d3162cac8; QUAD $0x6296d42548255362; QUAD $0x3d5162c1fe483d51; QUAD $0xfe4855d162c2fe48; QUAD $0x02c2724875f162e8; QUAD $0x620dc2724825f162; QUAD $0x716216c272481df1; QUAD $0x48657362ca6f487e; QUAD $0x254825d362e8cc25; QUAD $0xc9fe4875d16296cc; QUAD $0x7162c8fe4875d162; QUAD $0x15b16207626f487e; QUAD $0x480db16211c47248; QUAD $0x724805b16213c472; QUAD $0xef25480d53620ad4; QUAD $0x62f5fe404dc16296; QUAD $0x15b162f7fe404d81; QUAD $0x480db16207c77248; QUAD $0x724805b16212c772; QUAD $0xef25480d536203d7; QUAD $0x62f5fe404dc16296; QUAD $0x7e7162c4fe487d51; QUAD $0x72482df162cd6f48; QUAD $0xc5724825f16206c5; QUAD $0x19c572481df1620b; QUAD $0x62cacf25484d7362; QUAD $0x255362c7fe483d31; QUAD $0x483d516296d42548; QUAD $0xc2fe483d5162c1fe; QUAD $0xf162e0fe485dd162; QUAD $0x25f16202c172487d; QUAD $0x481df1620dc17248; QUAD $0x6f487e716216c172; QUAD $0xe8cb25486d7362c9; QUAD $0x6296c4254825d362; QUAD $0x7dd162c1fe487dd1; QUAD $0x6f487e7162c0fe48; QUAD $0xc5724815b1620862; QUAD $0x13c572480db16211; QUAD $0x620ad5724805b162; QUAD $0xc16296ef25480d53; QUAD $0x4045a162fdfe4045; QUAD $0xc07248159162f8fe; QUAD $0x12c072480d916207; QUAD $0x6203d07248059162; QUAD $0xc16296ef25480d53; QUAD $0x48455162fdfe4045; QUAD $0xcc6f487e7162c4fe; QUAD $0x6206c472482df162; QUAD $0xf1620bc4724825f1; QUAD $0x55736219c472481d; QUAD $0x483d1162cace2548; QUAD $0xd42548255362c0fe; QUAD $0x62c1fe483d516296; QUAD $0x65d162c2fe483d51; QUAD $0x724845f162d8fe48; QUAD $0xc0724825f16202c0; QUAD $0x16c072481df1620d; QUAD $0x7362c86f487e7162; QUAD $0x25d362e8ca254875; QUAD $0x4845d16296fc2548; QUAD $0xf8fe4845d162f9fe; QUAD $0x6209626f487e7162; QUAD $0xb16211c6724815b1; QUAD $0x05b16213c672480d; QUAD $0x480d53620ad67248; QUAD $0xfe403d416296ef25; QUAD $0x62c1fe403d2162c5; QUAD $0x916207c172481591; QUAD $0x05916212c172480d; QUAD $0x480d536203d17248; QUAD $0xfe403d416296ef25; QUAD $0x62c4fe484d5162c5; QUAD $0x2df162cb6f487e71; QUAD $0x4825f16206c37248; QUAD $0x72481df1620bc372; QUAD $0xcd25485d736219c3; QUAD $0x62c1fe483d1162ca; QUAD $0x516296d425482553; QUAD $0x483d5162c1fe483d; QUAD $0xd0fe486dd162c2fe; QUAD $0x6202c772484df162; QUAD $0xf1620dc7724825f1; QUAD $0x7e716216c772481d; QUAD $0x25487d7362cf6f48; QUAD $0xf4254825d362e8c9; QUAD $0x62f1fe484dd16296; QUAD $0x7e7162f0fe484dd1; QUAD $0x4815b1620a626f48; QUAD $0x72480db16211c772; QUAD $0xd7724805b16213c7; QUAD $0x96ef25480d53620a; QUAD $0x2162cdfe40354162; QUAD $0x48159162cafe4035; QUAD $0x72480d916207c272; QUAD $0xd2724805916212c2; QUAD $0x96ef25480d536203; QUAD $0x5162cdfe40354162; QUAD $0x487e7162c4fe4855; QUAD $0xc272482df162ca6f; QUAD $0x0bc2724825f16206; QUAD $0x6219c272481df162; QUAD $0x1162cacc25486573; QUAD $0x48255362c2fe483d; QUAD $0xfe483d516296d425; QUAD $0x62c2fe483d5162c1; QUAD $0x55f162c8fe4875d1; QUAD $0x4825f16202c67248; QUAD $0x72481df1620dc672; QUAD $0xce6f487e716216c6; QUAD $0x62e8c82548457362; QUAD $0xd16296ec254825d3; QUAD $0x4855d162e9fe4855; QUAD $0x626f487e7162e8fe; QUAD $0x11c072481591620b; QUAD $0x6213c072480d9162; QUAD $0x53620ad072480591; QUAD $0x2d416296ef25480d; QUAD $0xfe402d2162d5fe40; QUAD $0x07c37248159162d3; QUAD $0x6212c372480d9162; QUAD $0x536203d372480591; QUAD $0x2d416296ef25480d; QUAD $0xfe485d5162d5fe40; QUAD $0x62c96f487e7162c4; QUAD $0xf16206c172482df1; QUAD $0x1df1620bc1724825; QUAD $0x486d736219c17248; QUAD $0xfe483d1162cacb25; QUAD $0x96d42548255362c3; QUAD $0x5162c1fe483d5162; QUAD $0x487dd162c2fe483d; QUAD $0xc572485df162c0fe; QUAD $0x0dc5724825f16202; QUAD $0x6216c572481df162; QUAD $0x4d7362cd6f487e71; QUAD $0x4825d362e8cf2548; QUAD $0xfe485dd16296e425; QUAD $0x62e0fe485dd162e1; QUAD $0x91620c626f487e71; QUAD $0x0d916211c1724815; QUAD $0x4805916213c17248; QUAD $0x25480d53620ad172; QUAD $0xddfe4025416296ef; QUAD $0x9162dcfe40252162; QUAD $0x0d916207c4724815; QUAD $0x4805916212c47248; QUAD $0x25480d536203d472; QUAD $0xddfe4025416296ef; QUAD $0x7162c4fe48655162; QUAD $0x482df162c86f487e; QUAD $0x724825f16206c072; QUAD $0xc072481df1620bc0; QUAD $0xcaca254875736219; QUAD $0x5362c4fe483d1162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62f8fe4845d162c2; QUAD $0xf16202c4724865f1; QUAD $0x1df1620dc4724825; QUAD $0x487e716216c47248; QUAD $0xce2548557362cc6f; QUAD $0x96dc254825d362e8; QUAD $0xd162d9fe4865d162; QUAD $0x487e7162d8fe4865; QUAD $0x72481591620d626f; QUAD $0xc272480d916211c2; QUAD $0x0ad2724805916213; QUAD $0x6296ef25480d5362; QUAD $0x1d2162e5fe401d41; QUAD $0x7248159162e5fe40; QUAD $0xc572480d916207c5; QUAD $0x03d5724805916212; QUAD $0x6296ef25480d5362; QUAD $0x6d5162e5fe401d41; QUAD $0x6f487e7162c4fe48; QUAD $0x06c772482df162cf; QUAD $0x620bc7724825f162; QUAD $0x736219c772481df1; QUAD $0x3d1162cac925487d; QUAD $0x2548255362c5fe48; QUAD $0xc1fe483d516296d4; QUAD $0xd162c2fe483d5162; QUAD $0x486df162f0fe484d; QUAD $0x724825f16202c372; QUAD $0xc372481df1620dc3; QUAD $0x62cb6f487e716216; QUAD $0xd362e8cd25485d73; QUAD $0x6dd16296d4254825; QUAD $0xfe486dd162d1fe48; QUAD $0x0e626f487e7162d0; QUAD $0x6211c37248159162; QUAD $0x916213c372480d91; QUAD $0x0d53620ad3724805; QUAD $0x4015416296ef2548; QUAD $0xeefe40152162edfe; QUAD $0x6207c67248159162; QUAD $0x916212c672480d91; QUAD $0x0d536203d6724805; QUAD $0x4015416296ef2548; QUAD $0xc4fe48755162edfe; QUAD $0xf162ce6f487e7162; QUAD $0x25f16206c672482d; QUAD $0x481df1620bc67248; QUAD $0x254845736219c672; QUAD $0xc6fe483d1162cac8; QUAD $0x6296d42548255362; QUAD $0x3d5162c1fe483d51; QUAD $0xfe4855d162c2fe48; QUAD $0x02c2724875f162e8; QUAD $0x620dc2724825f162; QUAD $0x716216c272481df1; QUAD $0x48657362ca6f487e; QUAD $0x254825d362e8cc25; QUAD $0xc9fe4875d16296cc; QUAD $0x7162c8fe4875d162; QUAD $0x1591620f626f487e; QUAD $0x480d916211c47248; QUAD $0x724805916213c472; QUAD $0xef25480d53620ad4; QUAD $0x62f5fe400d416296; QUAD $0x159162f7fe400d21; QUAD $0x480d916207c77248; QUAD $0x724805916212c772; QUAD $0xef25480d536203d7; QUAD $0x62f5fe400d416296; QUAD $0x7e7162c4fe487d51; QUAD $0x72482df162cd6f48; QUAD $0xc5724825f16206c5; QUAD $0x19c572481df1620b; QUAD $0x62cacf25484d7362; QUAD $0x255362c7fe483d11; QUAD $0x483d516296d42548; QUAD $0xc2fe483d5162c1fe; QUAD $0xf162e0fe485dd162; QUAD $0x25f16202c172487d; QUAD $0x481df1620dc17248; QUAD $0x6f487e716216c172; QUAD $0xe8cb25486d7362c9; QUAD $0x6296c4254825d362; QUAD $0x7dd162c1fe487dd1; QUAD $0x6f487e7162c0fe48; QUAD $0xc572481591621062; QUAD $0x13c572480d916211; QUAD $0x620ad57248059162; QUAD $0x416296ef25480d53; QUAD $0x40050162fdfe4005; QUAD $0xc0724815b162f8fe; QUAD $0x12c072480db16207; QUAD $0x6203d0724805b162; QUAD $0x416296ef25480d53; QUAD $0x48455162fdfe4005; QUAD $0xcc6f487e7162c4fe; QUAD $0x6206c472482df162; QUAD $0xf1620bc4724825f1; QUAD $0x55736219c472481d; QUAD $0x483d3162cace2548; QUAD $0xd42548255362c0fe; QUAD $0x62c1fe483d516296; QUAD $0x65d162c2fe483d51; QUAD $0x724845f162d8fe48; QUAD $0xc0724825f16202c0; QUAD $0x16c072481df1620d; QUAD $0x7362c86f487e7162; QUAD $0x25d362e8ca254875; QUAD $0x4845d16296fc2548; QUAD $0xf8fe4845d162f9fe; QUAD $0x6211626f487e7162; QUAD $0x916211c672481591; QUAD $0x05916213c672480d; QUAD $0x480d53620ad67248; QUAD $0xfe407dc16296ef25; QUAD $0x62c1fe407d8162c5; QUAD $0xb16207c1724815b1; QUAD $0x05b16212c172480d; QUAD $0x480d536203d17248; QUAD $0xfe407dc16296ef25; QUAD $0x62c4fe484d5162c5; QUAD $0x2df162cb6f487e71; QUAD $0x4825f16206c37248; QUAD $0x72481df1620bc372; QUAD $0xcd25485d736219c3; QUAD $0x62c1fe483d3162ca; QUAD $0x516296d425482553; QUAD $0x483d5162c1fe483d; QUAD $0xd0fe486dd162c2fe; QUAD $0x6202c772484df162; QUAD $0xf1620dc7724825f1; QUAD $0x7e716216c772481d; QUAD $0x25487d7362cf6f48; QUAD $0xf4254825d362e8c9; QUAD $0x62f1fe484dd16296; QUAD $0x7e7162f0fe484dd1; QUAD $0x4815916212626f48; QUAD $0x72480d916211c772; QUAD $0xd7724805916213c7; QUAD $0x96ef25480d53620a; QUAD $0x8162cdfe4075c162; QUAD $0x4815b162cafe4075; QUAD $0x72480db16207c272; QUAD $0xd2724805b16212c2; QUAD $0x96ef25480d536203; QUAD $0x5162cdfe4075c162; QUAD $0x487e7162c4fe4855; QUAD $0xc272482df162ca6f; QUAD $0x0bc2724825f16206; QUAD $0x6219c272481df162; QUAD $0x3162cacc25486573; QUAD $0x48255362c2fe483d; QUAD $0xfe483d516296d425; QUAD $0x62c2fe483d5162c1; QUAD $0x55f162c8fe4875d1; QUAD $0x4825f16202c67248; QUAD $0x72481df1620dc672; QUAD $0xce6f487e716216c6; QUAD $0x62e8c82548457362; QUAD $0xd16296ec254825d3; QUAD $0x4855d162e9fe4855; QUAD $0x626f487e7162e8fe; QUAD $0x11c0724815b16213; QUAD $0x6213c072480db162; QUAD $0x53620ad0724805b1; QUAD $0x6dc16296ef25480d; QUAD $0xfe406d8162d5fe40; QUAD $0x07c3724815b162d3; QUAD $0x6212c372480db162; QUAD $0x536203d3724805b1; QUAD $0x6dc16296ef25480d; QUAD $0xfe485d5162d5fe40; QUAD $0x62c96f487e7162c4; QUAD $0xf16206c172482df1; QUAD $0x1df1620bc1724825; QUAD $0x486d736219c17248; QUAD $0xfe483d3162cacb25; QUAD $0x96d42548255362c3; QUAD $0x5162c1fe483d5162; QUAD $0x487dd162c2fe483d; QUAD $0xc572485df162c0fe; QUAD $0x0dc5724825f16202; QUAD $0x6216c572481df162; QUAD $0x4d7362cd6f487e71; QUAD $0x4825d362e8cf2548; QUAD $0xfe485dd16296e425; QUAD $0x62e0fe485dd162e1; QUAD $0xb16214626f487e71; QUAD $0x0db16211c1724815; QUAD $0x4805b16213c17248; QUAD $0x25480d53620ad172; QUAD $0xddfe4065c16296ef; QUAD $0xb162dcfe40658162; QUAD $0x0db16207c4724815; QUAD $0x4805b16212c47248; QUAD $0x25480d536203d472; QUAD $0xddfe4065c16296ef; QUAD $0x7162c4fe48655162; QUAD $0x482df162c86f487e; QUAD $0x724825f16206c072; QUAD $0xc072481df1620bc0; QUAD $0xcaca254875736219; QUAD $0x5362c4fe483d3162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62f8fe4845d162c2; QUAD $0xf16202c4724865f1; QUAD $0x1df1620dc4724825; QUAD $0x487e716216c47248; QUAD $0xce2548557362cc6f; QUAD $0x96dc254825d362e8; QUAD $0xd162d9fe4865d162; QUAD $0x487e7162d8fe4865; QUAD $0x724815b16215626f; QUAD $0xc272480db16211c2; QUAD $0x0ad2724805b16213; QUAD $0x6296ef25480d5362; QUAD $0x5d8162e5fe405dc1; QUAD $0x724815b162e5fe40; QUAD $0xc572480db16207c5; QUAD $0x03d5724805b16212; QUAD $0x6296ef25480d5362; QUAD $0x6d5162e5fe405dc1; QUAD $0x6f487e7162c4fe48; QUAD $0x06c772482df162cf; QUAD $0x620bc7724825f162; QUAD $0x736219c772481df1; QUAD $0x3d3162cac925487d; QUAD $0x2548255362c5fe48; QUAD $0xc1fe483d516296d4; QUAD $0xd162c2fe483d5162; QUAD $0x486df162f0fe484d; QUAD $0x724825f16202c372; QUAD $0xc372481df1620dc3; QUAD $0x62cb6f487e716216; QUAD $0xd362e8cd25485d73; QUAD $0x6dd16296d4254825; QUAD $0xfe486dd162d1fe48; QUAD $0x16626f487e7162d0; QUAD $0x6211c3724815b162; QUAD $0xb16213c372480db1; QUAD $0x0d53620ad3724805; QUAD $0x4055c16296ef2548; QUAD $0xeefe40558162edfe; QUAD $0x6207c6724815b162; QUAD $0xb16212c672480db1; QUAD $0x0d536203d6724805; QUAD $0x4055c16296ef2548; QUAD $0xc4fe48755162edfe; QUAD $0xf162ce6f487e7162; QUAD $0x25f16206c672482d; QUAD $0x481df1620bc67248; QUAD $0x254845736219c672; QUAD $0xc6fe483d3162cac8; QUAD $0x6296d42548255362; QUAD $0x3d5162c1fe483d51; QUAD $0xfe4855d162c2fe48; QUAD $0x02c2724875f162e8; QUAD $0x620dc2724825f162; QUAD $0x716216c272481df1; QUAD $0x48657362ca6f487e; QUAD $0x254825d362e8cc25; QUAD $0xc9fe4875d16296cc; QUAD $0x7162c8fe4875d162; QUAD $0x15b16217626f487e; QUAD $0x480db16211c47248; QUAD $0x724805b16213c472; QUAD $0xef25480d53620ad4; QUAD $0x62f5fe404dc16296; QUAD $0x15b162f7fe404d81; QUAD $0x480db16207c77248; QUAD $0x724805b16212c772; QUAD $0xef25480d536203d7; QUAD $0x62f5fe404dc16296; QUAD $0x7e7162c4fe487d51; QUAD $0x72482df162cd6f48; QUAD $0xc5724825f16206c5; QUAD $0x19c572481df1620b; QUAD $0x62cacf25484d7362; QUAD $0x255362c7fe483d31; QUAD $0x483d516296d42548; QUAD $0xc2fe483d5162c1fe; QUAD $0xf162e0fe485dd162; QUAD $0x25f16202c172487d; QUAD $0x481df1620dc17248; QUAD $0x6f487e716216c172; QUAD $0xe8cb25486d7362c9; QUAD $0x6296c4254825d362; QUAD $0x7dd162c1fe487dd1; QUAD $0x6f487e7162c0fe48; QUAD $0xc5724815b1621862; QUAD $0x13c572480db16211; QUAD $0x620ad5724805b162; QUAD $0xc16296ef25480d53; QUAD $0x4045a162fdfe4045; QUAD $0xc07248159162f8fe; QUAD $0x12c072480d916207; QUAD $0x6203d07248059162; QUAD $0xc16296ef25480d53; QUAD $0x48455162fdfe4045; QUAD $0xcc6f487e7162c4fe; QUAD $0x6206c472482df162; QUAD $0xf1620bc4724825f1; QUAD $0x55736219c472481d; QUAD $0x483d1162cace2548; QUAD $0xd42548255362c0fe; QUAD $0x62c1fe483d516296; QUAD $0x65d162c2fe483d51; QUAD $0x724845f162d8fe48; QUAD $0xc0724825f16202c0; QUAD $0x16c072481df1620d; QUAD $0x7362c86f487e7162; QUAD $0x25d362e8ca254875; QUAD $0x4845d16296fc2548; QUAD $0xf8fe4845d162f9fe; QUAD $0x6219626f487e7162; QUAD $0xb16211c6724815b1; QUAD $0x05b16213c672480d; QUAD $0x480d53620ad67248; QUAD $0xfe403d416296ef25; QUAD $0x62c1fe403d2162c5; QUAD $0x916207c172481591; QUAD $0x05916212c172480d; QUAD $0x480d536203d17248; QUAD $0xfe403d416296ef25; QUAD $0x62c4fe484d5162c5; QUAD $0x2df162cb6f487e71; QUAD $0x4825f16206c37248; QUAD $0x72481df1620bc372; QUAD $0xcd25485d736219c3; QUAD $0x62c1fe483d1162ca; QUAD $0x516296d425482553; QUAD $0x483d5162c1fe483d; QUAD $0xd0fe486dd162c2fe; QUAD $0x6202c772484df162; QUAD $0xf1620dc7724825f1; QUAD $0x7e716216c772481d; QUAD $0x25487d7362cf6f48; QUAD $0xf4254825d362e8c9; QUAD $0x62f1fe484dd16296; QUAD $0x7e7162f0fe484dd1; QUAD $0x4815b1621a626f48; QUAD $0x72480db16211c772; QUAD $0xd7724805b16213c7; QUAD $0x96ef25480d53620a; QUAD $0x2162cdfe40354162; QUAD $0x48159162cafe4035; QUAD $0x72480d916207c272; QUAD $0xd2724805916212c2; QUAD $0x96ef25480d536203; QUAD $0x5162cdfe40354162; QUAD $0x487e7162c4fe4855; QUAD $0xc272482df162ca6f; QUAD $0x0bc2724825f16206; QUAD $0x6219c272481df162; QUAD $0x1162cacc25486573; QUAD $0x48255362c2fe483d; QUAD $0xfe483d516296d425; QUAD $0x62c2fe483d5162c1; QUAD $0x55f162c8fe4875d1; QUAD $0x4825f16202c67248; QUAD $0x72481df1620dc672; QUAD $0xce6f487e716216c6; QUAD $0x62e8c82548457362; QUAD $0xd16296ec254825d3; QUAD $0x4855d162e9fe4855; QUAD $0x626f487e7162e8fe; QUAD $0x11c072481591621b; QUAD $0x6213c072480d9162; QUAD $0x53620ad072480591; QUAD $0x2d416296ef25480d; QUAD $0xfe402d2162d5fe40; QUAD $0x07c37248159162d3; QUAD $0x6212c372480d9162; QUAD $0x536203d372480591; QUAD $0x2d416296ef25480d; QUAD $0xfe485d5162d5fe40; QUAD $0x62c96f487e7162c4; QUAD $0xf16206c172482df1; QUAD $0x1df1620bc1724825; QUAD $0x486d736219c17248; QUAD $0xfe483d1162cacb25; QUAD $0x96d42548255362c3; QUAD $0x5162c1fe483d5162; QUAD $0x487dd162c2fe483d; QUAD $0xc572485df162c0fe; QUAD $0x0dc5724825f16202; QUAD $0x6216c572481df162; QUAD $0x4d7362cd6f487e71; QUAD $0x4825d362e8cf2548; QUAD $0xfe485dd16296e425; QUAD $0x62e0fe485dd162e1; QUAD $0x91621c626f487e71; QUAD $0x0d916211c1724815; QUAD $0x4805916213c17248; QUAD $0x25480d53620ad172; QUAD $0xddfe4025416296ef; QUAD $0x9162dcfe40252162; QUAD $0x0d916207c4724815; QUAD $0x4805916212c47248; QUAD $0x25480d536203d472; QUAD $0xddfe4025416296ef; QUAD $0x7162c4fe48655162; QUAD $0x482df162c86f487e; QUAD $0x724825f16206c072; QUAD $0xc072481df1620bc0; QUAD $0xcaca254875736219; QUAD $0x5362c4fe483d1162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62f8fe4845d162c2; QUAD $0xf16202c4724865f1; QUAD $0x1df1620dc4724825; QUAD $0x487e716216c47248; QUAD $0xce2548557362cc6f; QUAD $0x96dc254825d362e8; QUAD $0xd162d9fe4865d162; QUAD $0x487e7162d8fe4865; QUAD $0x72481591621d626f; QUAD $0xc272480d916211c2; QUAD $0x0ad2724805916213; QUAD $0x6296ef25480d5362; QUAD $0x1d2162e5fe401d41; QUAD $0x7248159162e5fe40; QUAD $0xc572480d916207c5; QUAD $0x03d5724805916212; QUAD $0x6296ef25480d5362; QUAD $0x6d5162e5fe401d41; QUAD $0x6f487e7162c4fe48; QUAD $0x06c772482df162cf; QUAD $0x620bc7724825f162; QUAD $0x736219c772481df1; QUAD $0x3d1162cac925487d; QUAD $0x2548255362c5fe48; QUAD $0xc1fe483d516296d4; QUAD $0xd162c2fe483d5162; QUAD $0x486df162f0fe484d; QUAD $0x724825f16202c372; QUAD $0xc372481df1620dc3; QUAD $0x62cb6f487e716216; QUAD $0xd362e8cd25485d73; QUAD $0x6dd16296d4254825; QUAD $0xfe486dd162d1fe48; QUAD $0x1e626f487e7162d0; QUAD $0x6211c37248159162; QUAD $0x916213c372480d91; QUAD $0x0d53620ad3724805; QUAD $0x4015416296ef2548; QUAD $0xeefe40152162edfe; QUAD $0x6207c67248159162; QUAD $0x916212c672480d91; QUAD $0x0d536203d6724805; QUAD $0x4015416296ef2548; QUAD $0xc4fe48755162edfe; QUAD $0xf162ce6f487e7162; QUAD $0x25f16206c672482d; QUAD $0x481df1620bc67248; QUAD $0x254845736219c672; QUAD $0xc6fe483d1162cac8; QUAD $0x6296d42548255362; QUAD $0x3d5162c1fe483d51; QUAD $0xfe4855d162c2fe48; QUAD $0x02c2724875f162e8; QUAD $0x620dc2724825f162; QUAD $0x716216c272481df1; QUAD $0x48657362ca6f487e; QUAD $0x254825d362e8cc25; QUAD $0xc9fe4875d16296cc; QUAD $0x7162c8fe4875d162; QUAD $0x1591621f626f487e; QUAD $0x480d916211c47248; QUAD $0x724805916213c472; QUAD $0xef25480d53620ad4; QUAD $0x62f5fe400d416296; QUAD $0x159162f7fe400d21; QUAD $0x480d916207c77248; QUAD $0x724805916212c772; QUAD $0xef25480d536203d7; QUAD $0x62f5fe400d416296; QUAD $0x7e7162c4fe487d51; QUAD $0x72482df162cd6f48; QUAD $0xc5724825f16206c5; QUAD $0x19c572481df1620b; QUAD $0x62cacf25484d7362; QUAD $0x255362c7fe483d11; QUAD $0x483d516296d42548; QUAD $0xc2fe483d5162c1fe; QUAD $0xf162e0fe485dd162; QUAD $0x25f16202c172487d; QUAD $0x481df1620dc17248; QUAD $0x6f487e716216c172; QUAD $0xe8cb25486d7362c9; QUAD $0x6296c4254825d362; QUAD $0x7dd162c1fe487dd1; QUAD $0x6f487e7162c0fe48; QUAD $0xc572481591622062; QUAD $0x13c572480d916211; QUAD $0x620ad57248059162; QUAD $0x416296ef25480d53; QUAD $0x40050162fdfe4005; QUAD $0xc0724815b162f8fe; QUAD $0x12c072480db16207; QUAD $0x6203d0724805b162; QUAD $0x416296ef25480d53; QUAD $0x48455162fdfe4005; QUAD $0xcc6f487e7162c4fe; QUAD $0x6206c472482df162; QUAD $0xf1620bc4724825f1; QUAD $0x55736219c472481d; QUAD $0x483d3162cace2548; QUAD $0xd42548255362c0fe; QUAD $0x62c1fe483d516296; QUAD $0x65d162c2fe483d51; QUAD $0x724845f162d8fe48; QUAD $0xc0724825f16202c0; QUAD $0x16c072481df1620d; QUAD $0x7362c86f487e7162; QUAD $0x25d362e8ca254875; QUAD $0x4845d16296fc2548; QUAD $0xf8fe4845d162f9fe; QUAD $0x6221626f487e7162; QUAD $0x916211c672481591; QUAD $0x05916213c672480d; QUAD $0x480d53620ad67248; QUAD $0xfe407dc16296ef25; QUAD $0x62c1fe407d8162c5; QUAD $0xb16207c1724815b1; QUAD $0x05b16212c172480d; QUAD $0x480d536203d17248; QUAD $0xfe407dc16296ef25; QUAD $0x62c4fe484d5162c5; QUAD $0x2df162cb6f487e71; QUAD $0x4825f16206c37248; QUAD $0x72481df1620bc372; QUAD $0xcd25485d736219c3; QUAD $0x62c1fe483d3162ca; QUAD $0x516296d425482553; QUAD $0x483d5162c1fe483d; QUAD $0xd0fe486dd162c2fe; QUAD $0x6202c772484df162; QUAD $0xf1620dc7724825f1; QUAD $0x7e716216c772481d; QUAD $0x25487d7362cf6f48; QUAD $0xf4254825d362e8c9; QUAD $0x62f1fe484dd16296; QUAD $0x7e7162f0fe484dd1; QUAD $0x4815916222626f48; QUAD $0x72480d916211c772; QUAD $0xd7724805916213c7; QUAD $0x96ef25480d53620a; QUAD $0x8162cdfe4075c162; QUAD $0x4815b162cafe4075; QUAD $0x72480db16207c272; QUAD $0xd2724805b16212c2; QUAD $0x96ef25480d536203; QUAD $0x5162cdfe4075c162; QUAD $0x487e7162c4fe4855; QUAD $0xc272482df162ca6f; QUAD $0x0bc2724825f16206; QUAD $0x6219c272481df162; QUAD $0x3162cacc25486573; QUAD $0x48255362c2fe483d; QUAD $0xfe483d516296d425; QUAD $0x62c2fe483d5162c1; QUAD $0x55f162c8fe4875d1; QUAD $0x4825f16202c67248; QUAD $0x72481df1620dc672; QUAD $0xce6f487e716216c6; QUAD $0x62e8c82548457362; QUAD $0xd16296ec254825d3; QUAD $0x4855d162e9fe4855; QUAD $0x626f487e7162e8fe; QUAD $0x11c0724815b16223; QUAD $0x6213c072480db162; QUAD $0x53620ad0724805b1; QUAD $0x6dc16296ef25480d; QUAD $0xfe406d8162d5fe40; QUAD $0x07c3724815b162d3; QUAD $0x6212c372480db162; QUAD $0x536203d3724805b1; QUAD $0x6dc16296ef25480d; QUAD $0xfe485d5162d5fe40; QUAD $0x62c96f487e7162c4; QUAD $0xf16206c172482df1; QUAD $0x1df1620bc1724825; QUAD $0x486d736219c17248; QUAD $0xfe483d3162cacb25; QUAD $0x96d42548255362c3; QUAD $0x5162c1fe483d5162; QUAD $0x487dd162c2fe483d; QUAD $0xc572485df162c0fe; QUAD $0x0dc5724825f16202; QUAD $0x6216c572481df162; QUAD $0x4d7362cd6f487e71; QUAD $0x4825d362e8cf2548; QUAD $0xfe485dd16296e425; QUAD $0x62e0fe485dd162e1; QUAD $0xb16224626f487e71; QUAD $0x0db16211c1724815; QUAD $0x4805b16213c17248; QUAD $0x25480d53620ad172; QUAD $0xddfe4065c16296ef; QUAD $0xb162dcfe40658162; QUAD $0x0db16207c4724815; QUAD $0x4805b16212c47248; QUAD $0x25480d536203d472; QUAD $0xddfe4065c16296ef; QUAD $0x7162c4fe48655162; QUAD $0x482df162c86f487e; QUAD $0x724825f16206c072; QUAD $0xc072481df1620bc0; QUAD $0xcaca254875736219; QUAD $0x5362c4fe483d3162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62f8fe4845d162c2; QUAD $0xf16202c4724865f1; QUAD $0x1df1620dc4724825; QUAD $0x487e716216c47248; QUAD $0xce2548557362cc6f; QUAD $0x96dc254825d362e8; QUAD $0xd162d9fe4865d162; QUAD $0x487e7162d8fe4865; QUAD $0x724815b16225626f; QUAD $0xc272480db16211c2; QUAD $0x0ad2724805b16213; QUAD $0x6296ef25480d5362; QUAD $0x5d8162e5fe405dc1; QUAD $0x724815b162e5fe40; QUAD $0xc572480db16207c5; QUAD $0x03d5724805b16212; QUAD $0x6296ef25480d5362; QUAD $0x6d5162e5fe405dc1; QUAD $0x6f487e7162c4fe48; QUAD $0x06c772482df162cf; QUAD $0x620bc7724825f162; QUAD $0x736219c772481df1; QUAD $0x3d3162cac925487d; QUAD $0x2548255362c5fe48; QUAD $0xc1fe483d516296d4; QUAD $0xd162c2fe483d5162; QUAD $0x486df162f0fe484d; QUAD $0x724825f16202c372; QUAD $0xc372481df1620dc3; QUAD $0x62cb6f487e716216; QUAD $0xd362e8cd25485d73; QUAD $0x6dd16296d4254825; QUAD $0xfe486dd162d1fe48; QUAD $0x26626f487e7162d0; QUAD $0x6211c3724815b162; QUAD $0xb16213c372480db1; QUAD $0x0d53620ad3724805; QUAD $0x4055c16296ef2548; QUAD $0xeefe40558162edfe; QUAD $0x6207c6724815b162; QUAD $0xb16212c672480db1; QUAD $0x0d536203d6724805; QUAD $0x4055c16296ef2548; QUAD $0xc4fe48755162edfe; QUAD $0xf162ce6f487e7162; QUAD $0x25f16206c672482d; QUAD $0x481df1620bc67248; QUAD $0x254845736219c672; QUAD $0xc6fe483d3162cac8; QUAD $0x6296d42548255362; QUAD $0x3d5162c1fe483d51; QUAD $0xfe4855d162c2fe48; QUAD $0x02c2724875f162e8; QUAD $0x620dc2724825f162; QUAD $0x716216c272481df1; QUAD $0x48657362ca6f487e; QUAD $0x254825d362e8cc25; QUAD $0xc9fe4875d16296cc; QUAD $0x7162c8fe4875d162; QUAD $0x15b16227626f487e; QUAD $0x480db16211c47248; QUAD $0x724805b16213c472; QUAD $0xef25480d53620ad4; QUAD $0x62f5fe404dc16296; QUAD $0x15b162f7fe404d81; QUAD $0x480db16207c77248; QUAD $0x724805b16212c772; QUAD $0xef25480d536203d7; QUAD $0x62f5fe404dc16296; QUAD $0x7e7162c4fe487d51; QUAD $0x72482df162cd6f48; QUAD $0xc5724825f16206c5; QUAD $0x19c572481df1620b; QUAD $0x62cacf25484d7362; QUAD $0x255362c7fe483d31; QUAD $0x483d516296d42548; QUAD $0xc2fe483d5162c1fe; QUAD $0xf162e0fe485dd162; QUAD $0x25f16202c172487d; QUAD $0x481df1620dc17248; QUAD $0x6f487e716216c172; QUAD $0xe8cb25486d7362c9; QUAD $0x6296c4254825d362; QUAD $0x7dd162c1fe487dd1; QUAD $0x6f487e7162c0fe48; QUAD $0xc5724815b1622862; QUAD $0x13c572480db16211; QUAD $0x620ad5724805b162; QUAD $0xc16296ef25480d53; QUAD $0x4045a162fdfe4045; QUAD $0xc07248159162f8fe; QUAD $0x12c072480d916207; QUAD $0x6203d07248059162; QUAD $0xc16296ef25480d53; QUAD $0x48455162fdfe4045; QUAD $0xcc6f487e7162c4fe; QUAD $0x6206c472482df162; QUAD $0xf1620bc4724825f1; QUAD $0x55736219c472481d; QUAD $0x483d1162cace2548; QUAD $0xd42548255362c0fe; QUAD $0x62c1fe483d516296; QUAD $0x65d162c2fe483d51; QUAD $0x724845f162d8fe48; QUAD $0xc0724825f16202c0; QUAD $0x16c072481df1620d; QUAD $0x7362c86f487e7162; QUAD $0x25d362e8ca254875; QUAD $0x4845d16296fc2548; QUAD $0xf8fe4845d162f9fe; QUAD $0x6229626f487e7162; QUAD $0xb16211c6724815b1; QUAD $0x05b16213c672480d; QUAD $0x480d53620ad67248; QUAD $0xfe403d416296ef25; QUAD $0x62c1fe403d2162c5; QUAD $0x916207c172481591; QUAD $0x05916212c172480d; QUAD $0x480d536203d17248; QUAD $0xfe403d416296ef25; QUAD $0x62c4fe484d5162c5; QUAD $0x2df162cb6f487e71; QUAD $0x4825f16206c37248; QUAD $0x72481df1620bc372; QUAD $0xcd25485d736219c3; QUAD $0x62c1fe483d1162ca; QUAD $0x516296d425482553; QUAD $0x483d5162c1fe483d; QUAD $0xd0fe486dd162c2fe; QUAD $0x6202c772484df162; QUAD $0xf1620dc7724825f1; QUAD $0x7e716216c772481d; QUAD $0x25487d7362cf6f48; QUAD $0xf4254825d362e8c9; QUAD $0x62f1fe484dd16296; QUAD $0x7e7162f0fe484dd1; QUAD $0x4815b1622a626f48; QUAD $0x72480db16211c772; QUAD $0xd7724805b16213c7; QUAD $0x96ef25480d53620a; QUAD $0x2162cdfe40354162; QUAD $0x48159162cafe4035; QUAD $0x72480d916207c272; QUAD $0xd2724805916212c2; QUAD $0x96ef25480d536203; QUAD $0x5162cdfe40354162; QUAD $0x487e7162c4fe4855; QUAD $0xc272482df162ca6f; QUAD $0x0bc2724825f16206; QUAD $0x6219c272481df162; QUAD $0x1162cacc25486573; QUAD $0x48255362c2fe483d; QUAD $0xfe483d516296d425; QUAD $0x62c2fe483d5162c1; QUAD $0x55f162c8fe4875d1; QUAD $0x4825f16202c67248; QUAD $0x72481df1620dc672; QUAD $0xce6f487e716216c6; QUAD $0x62e8c82548457362; QUAD $0xd16296ec254825d3; QUAD $0x4855d162e9fe4855; QUAD $0x626f487e7162e8fe; QUAD $0x11c072481591622b; QUAD $0x6213c072480d9162; QUAD $0x53620ad072480591; QUAD $0x2d416296ef25480d; QUAD $0xfe402d2162d5fe40; QUAD $0x07c37248159162d3; QUAD $0x6212c372480d9162; QUAD $0x536203d372480591; QUAD $0x2d416296ef25480d; QUAD $0xfe485d5162d5fe40; QUAD $0x62c96f487e7162c4; QUAD $0xf16206c172482df1; QUAD $0x1df1620bc1724825; QUAD $0x486d736219c17248; QUAD $0xfe483d1162cacb25; QUAD $0x96d42548255362c3; QUAD $0x5162c1fe483d5162; QUAD $0x487dd162c2fe483d; QUAD $0xc572485df162c0fe; QUAD $0x0dc5724825f16202; QUAD $0x6216c572481df162; QUAD $0x4d7362cd6f487e71; QUAD $0x4825d362e8cf2548; QUAD $0xfe485dd16296e425; QUAD $0x62e0fe485dd162e1; QUAD $0x91622c626f487e71; QUAD $0x0d916211c1724815; QUAD $0x4805916213c17248; QUAD $0x25480d53620ad172; QUAD $0xddfe4025416296ef; QUAD $0x9162dcfe40252162; QUAD $0x0d916207c4724815; QUAD $0x4805916212c47248; QUAD $0x25480d536203d472; QUAD $0xddfe4025416296ef; QUAD $0x7162c4fe48655162; QUAD $0x482df162c86f487e; QUAD $0x724825f16206c072; QUAD $0xc072481df1620bc0; QUAD $0xcaca254875736219; QUAD $0x5362c4fe483d1162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62f8fe4845d162c2; QUAD $0xf16202c4724865f1; QUAD $0x1df1620dc4724825; QUAD $0x487e716216c47248; QUAD $0xce2548557362cc6f; QUAD $0x96dc254825d362e8; QUAD $0xd162d9fe4865d162; QUAD $0x487e7162d8fe4865; QUAD $0x72481591622d626f; QUAD $0xc272480d916211c2; QUAD $0x0ad2724805916213; QUAD $0x6296ef25480d5362; QUAD $0x1d2162e5fe401d41; QUAD $0x7248159162e5fe40; QUAD $0xc572480d916207c5; QUAD $0x03d5724805916212; QUAD $0x6296ef25480d5362; QUAD $0x6d5162e5fe401d41; QUAD $0x6f487e7162c4fe48; QUAD $0x06c772482df162cf; QUAD $0x620bc7724825f162; QUAD $0x736219c772481df1; QUAD $0x3d1162cac925487d; QUAD $0x2548255362c5fe48; QUAD $0xc1fe483d516296d4; QUAD $0xd162c2fe483d5162; QUAD $0x486df162f0fe484d; QUAD $0x724825f16202c372; QUAD $0xc372481df1620dc3; QUAD $0x62cb6f487e716216; QUAD $0xd362e8cd25485d73; QUAD $0x6dd16296d4254825; QUAD $0xfe486dd162d1fe48; QUAD $0x2e626f487e7162d0; QUAD $0x6211c37248159162; QUAD $0x916213c372480d91; QUAD $0x0d53620ad3724805; QUAD $0x4015416296ef2548; QUAD $0xeefe40152162edfe; QUAD $0x6207c67248159162; QUAD $0x916212c672480d91; QUAD $0x0d536203d6724805; QUAD $0x4015416296ef2548; QUAD $0xc4fe48755162edfe; QUAD $0xf162ce6f487e7162; QUAD $0x25f16206c672482d; QUAD $0x481df1620bc67248; QUAD $0x254845736219c672; QUAD $0xc6fe483d1162cac8; QUAD $0x6296d42548255362; QUAD $0x3d5162c1fe483d51; QUAD $0xfe4855d162c2fe48; QUAD $0x02c2724875f162e8; QUAD $0x620dc2724825f162; QUAD $0x716216c272481df1; QUAD $0x48657362ca6f487e; QUAD $0x254825d362e8cc25; QUAD $0xc9fe4875d16296cc; QUAD $0x7162c8fe4875d162; QUAD $0x1591622f626f487e; QUAD $0x480d916211c47248; QUAD $0x724805916213c472; QUAD $0xef25480d53620ad4; QUAD $0x62f5fe400d416296; QUAD $0x159162f7fe400d21; QUAD $0x480d916207c77248; QUAD $0x724805916212c772; QUAD $0xef25480d536203d7; QUAD $0x62f5fe400d416296; QUAD $0x7e7162c4fe487d51; QUAD $0x72482df162cd6f48; QUAD $0xc5724825f16206c5; QUAD $0x19c572481df1620b; QUAD $0x62cacf25484d7362; QUAD $0x255362c7fe483d11; QUAD $0x483d516296d42548; QUAD $0xc2fe483d5162c1fe; QUAD $0xf162e0fe485dd162; QUAD $0x25f16202c172487d; QUAD $0x481df1620dc17248; QUAD $0x6f487e716216c172; QUAD $0xe8cb25486d7362c9; QUAD $0x6296c4254825d362; QUAD $0x7dd162c1fe487dd1; QUAD $0x6f487e7162c0fe48; QUAD $0xc572481591623062; QUAD $0x13c572480d916211; QUAD $0x620ad57248059162; QUAD $0x416296ef25480d53; QUAD $0x40050162fdfe4005; QUAD $0xc0724815b162f8fe; QUAD $0x12c072480db16207; QUAD $0x6203d0724805b162; QUAD $0x416296ef25480d53; QUAD $0x01ee8348fdfe4005 + JE lastLoop + ADDQ $8, R13 + MOVQ (R13), R14 + QUAD $0x7162c4fe48455162; QUAD $0x482df162cc6f487e; QUAD $0x724825f16206c472; QUAD $0xc472481df1620bc4; QUAD $0xcace254855736219; QUAD $0x5362c0fe483d3162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62d8fe4865d162c2; QUAD $0xf16202c0724845f1; QUAD $0x1df1620dc0724825; QUAD $0x487e716216c07248; QUAD $0xca2548757362c86f; QUAD $0x96fc254825d362e8; QUAD $0xd162f9fe4845d162; QUAD $0x487e7162f8fe4845; WORD $0x626f; BYTE $0x31 + TESTQ $(1<<0), R14 + JE skipNext0 + MOVQ 0*24(AX), R9 + LONG $0x487cc162; WORD $0x0410; BYTE $0x09 + +skipNext0: + QUAD $0x7162c4fe484d5162; QUAD $0x482df162cb6f487e; QUAD $0x724825f16206c372; QUAD $0xc372481df1620bc3; QUAD $0xcacd25485d736219; QUAD $0x5362c1fe483d3162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62d0fe486dd162c2; QUAD $0xf16202c772484df1; QUAD $0x1df1620dc7724825; QUAD $0x487e716216c77248; QUAD $0xc925487d7362cf6f; QUAD $0x96f4254825d362e8; QUAD $0xd162f1fe484dd162; QUAD $0x487e7162f0fe484d; WORD $0x626f; BYTE $0x32 + TESTQ $(1<<1), R14 + JE skipNext1 + MOVQ 1*24(AX), R9 + LONG $0x487cc162; WORD $0x0c10; BYTE $0x09 + +skipNext1: + QUAD $0x7162c4fe48555162; QUAD $0x482df162ca6f487e; QUAD $0x724825f16206c272; QUAD $0xc272481df1620bc2; QUAD $0xcacc254865736219; QUAD $0x5362c2fe483d3162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62c8fe4875d162c2; QUAD $0xf16202c6724855f1; QUAD $0x1df1620dc6724825; QUAD $0x487e716216c67248; QUAD $0xc82548457362ce6f; QUAD $0x96ec254825d362e8; QUAD $0xd162e9fe4855d162; QUAD $0x487e7162e8fe4855; WORD $0x626f; BYTE $0x33 + TESTQ $(1<<2), R14 + JE skipNext2 + MOVQ 2*24(AX), R9 + LONG $0x487cc162; WORD $0x1410; BYTE $0x09 + +skipNext2: + QUAD $0x7162c4fe485d5162; QUAD $0x482df162c96f487e; QUAD $0x724825f16206c172; QUAD $0xc172481df1620bc1; QUAD $0xcacb25486d736219; QUAD $0x5362c3fe483d3162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62c0fe487dd162c2; QUAD $0xf16202c572485df1; QUAD $0x1df1620dc5724825; QUAD $0x487e716216c57248; QUAD $0xcf25484d7362cd6f; QUAD $0x96e4254825d362e8; QUAD $0xd162e1fe485dd162; QUAD $0x487e7162e0fe485d; WORD $0x626f; BYTE $0x34 + TESTQ $(1<<3), R14 + JE skipNext3 + MOVQ 3*24(AX), R9 + LONG $0x487cc162; WORD $0x1c10; BYTE $0x09 + +skipNext3: + QUAD $0x7162c4fe48655162; QUAD $0x482df162c86f487e; QUAD $0x724825f16206c072; QUAD $0xc072481df1620bc0; QUAD $0xcaca254875736219; QUAD $0x5362c4fe483d3162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62f8fe4845d162c2; QUAD $0xf16202c4724865f1; QUAD $0x1df1620dc4724825; QUAD $0x487e716216c47248; QUAD $0xce2548557362cc6f; QUAD $0x96dc254825d362e8; QUAD $0xd162d9fe4865d162; QUAD $0x487e7162d8fe4865; WORD $0x626f; BYTE $0x35 + TESTQ $(1<<4), R14 + JE skipNext4 + MOVQ 4*24(AX), R9 + LONG $0x487cc162; WORD $0x2410; BYTE $0x09 + +skipNext4: + QUAD $0x7162c4fe486d5162; QUAD $0x482df162cf6f487e; QUAD $0x724825f16206c772; QUAD $0xc772481df1620bc7; QUAD $0xcac925487d736219; QUAD $0x5362c5fe483d3162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62f0fe484dd162c2; QUAD $0xf16202c372486df1; QUAD $0x1df1620dc3724825; QUAD $0x487e716216c37248; QUAD $0xcd25485d7362cb6f; QUAD $0x96d4254825d362e8; QUAD $0xd162d1fe486dd162; QUAD $0x487e7162d0fe486d; WORD $0x626f; BYTE $0x36 + TESTQ $(1<<5), R14 + JE skipNext5 + MOVQ 5*24(AX), R9 + LONG $0x487cc162; WORD $0x2c10; BYTE $0x09 + +skipNext5: + QUAD $0x7162c4fe48755162; QUAD $0x482df162ce6f487e; QUAD $0x724825f16206c672; QUAD $0xc672481df1620bc6; QUAD $0xcac8254845736219; QUAD $0x5362c6fe483d3162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62e8fe4855d162c2; QUAD $0xf16202c2724875f1; QUAD $0x1df1620dc2724825; QUAD $0x487e716216c27248; QUAD $0xcc2548657362ca6f; QUAD $0x96cc254825d362e8; QUAD $0xd162c9fe4875d162; QUAD $0x487e7162c8fe4875; WORD $0x626f; BYTE $0x37 + TESTQ $(1<<6), R14 + JE skipNext6 + MOVQ 6*24(AX), R9 + LONG $0x487cc162; WORD $0x3410; BYTE $0x09 + +skipNext6: + QUAD $0x7162c4fe487d5162; QUAD $0x482df162cd6f487e; QUAD $0x724825f16206c572; QUAD $0xc572481df1620bc5; QUAD $0xcacf25484d736219; QUAD $0x5362c7fe483d3162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62e0fe485dd162c2; QUAD $0xf16202c172487df1; QUAD $0x1df1620dc1724825; QUAD $0x487e716216c17248; QUAD $0xcb25486d7362c96f; QUAD $0x96c4254825d362e8; QUAD $0xd162c1fe487dd162; QUAD $0x487e7162c0fe487d; WORD $0x626f; BYTE $0x38 + TESTQ $(1<<7), R14 + JE skipNext7 + MOVQ 7*24(AX), R9 + LONG $0x487cc162; WORD $0x3c10; BYTE $0x09 + +skipNext7: + QUAD $0x7162c4fe48455162; QUAD $0x482df162cc6f487e; QUAD $0x724825f16206c472; QUAD $0xc472481df1620bc4; QUAD $0xcace254855736219; QUAD $0x5362c0fe483d1162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62d8fe4865d162c2; QUAD $0xf16202c0724845f1; QUAD $0x1df1620dc0724825; QUAD $0x487e716216c07248; QUAD $0xca2548757362c86f; QUAD $0x96fc254825d362e8; QUAD $0xd162f9fe4845d162; QUAD $0x487e7162f8fe4845; WORD $0x626f; BYTE $0x39 + TESTQ $(1<<8), R14 + JE skipNext8 + MOVQ 8*24(AX), R9 + LONG $0x487c4162; WORD $0x0410; BYTE $0x09 + +skipNext8: + QUAD $0x7162c4fe484d5162; QUAD $0x482df162cb6f487e; QUAD $0x724825f16206c372; QUAD $0xc372481df1620bc3; QUAD $0xcacd25485d736219; QUAD $0x5362c1fe483d1162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62d0fe486dd162c2; QUAD $0xf16202c772484df1; QUAD $0x1df1620dc7724825; QUAD $0x487e716216c77248; QUAD $0xc925487d7362cf6f; QUAD $0x96f4254825d362e8; QUAD $0xd162f1fe484dd162; QUAD $0x487e7162f0fe484d; WORD $0x626f; BYTE $0x3a + TESTQ $(1<<9), R14 + JE skipNext9 + MOVQ 9*24(AX), R9 + LONG $0x487c4162; WORD $0x0c10; BYTE $0x09 + +skipNext9: + QUAD $0x7162c4fe48555162; QUAD $0x482df162ca6f487e; QUAD $0x724825f16206c272; QUAD $0xc272481df1620bc2; QUAD $0xcacc254865736219; QUAD $0x5362c2fe483d1162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62c8fe4875d162c2; QUAD $0xf16202c6724855f1; QUAD $0x1df1620dc6724825; QUAD $0x487e716216c67248; QUAD $0xc82548457362ce6f; QUAD $0x96ec254825d362e8; QUAD $0xd162e9fe4855d162; QUAD $0x487e7162e8fe4855; WORD $0x626f; BYTE $0x3b + TESTQ $(1<<10), R14 + JE skipNext10 + MOVQ 10*24(AX), R9 + LONG $0x487c4162; WORD $0x1410; BYTE $0x09 + +skipNext10: + QUAD $0x7162c4fe485d5162; QUAD $0x482df162c96f487e; QUAD $0x724825f16206c172; QUAD $0xc172481df1620bc1; QUAD $0xcacb25486d736219; QUAD $0x5362c3fe483d1162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62c0fe487dd162c2; QUAD $0xf16202c572485df1; QUAD $0x1df1620dc5724825; QUAD $0x487e716216c57248; QUAD $0xcf25484d7362cd6f; QUAD $0x96e4254825d362e8; QUAD $0xd162e1fe485dd162; QUAD $0x487e7162e0fe485d; WORD $0x626f; BYTE $0x3c + TESTQ $(1<<11), R14 + JE skipNext11 + MOVQ 11*24(AX), R9 + LONG $0x487c4162; WORD $0x1c10; BYTE $0x09 + +skipNext11: + QUAD $0x7162c4fe48655162; QUAD $0x482df162c86f487e; QUAD $0x724825f16206c072; QUAD $0xc072481df1620bc0; QUAD $0xcaca254875736219; QUAD $0x5362c4fe483d1162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62f8fe4845d162c2; QUAD $0xf16202c4724865f1; QUAD $0x1df1620dc4724825; QUAD $0x487e716216c47248; QUAD $0xce2548557362cc6f; QUAD $0x96dc254825d362e8; QUAD $0xd162d9fe4865d162; QUAD $0x487e7162d8fe4865; WORD $0x626f; BYTE $0x3d + TESTQ $(1<<12), R14 + JE skipNext12 + MOVQ 12*24(AX), R9 + LONG $0x487c4162; WORD $0x2410; BYTE $0x09 + +skipNext12: + QUAD $0x7162c4fe486d5162; QUAD $0x482df162cf6f487e; QUAD $0x724825f16206c772; QUAD $0xc772481df1620bc7; QUAD $0xcac925487d736219; QUAD $0x5362c5fe483d1162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62f0fe484dd162c2; QUAD $0xf16202c372486df1; QUAD $0x1df1620dc3724825; QUAD $0x487e716216c37248; QUAD $0xcd25485d7362cb6f; QUAD $0x96d4254825d362e8; QUAD $0xd162d1fe486dd162; QUAD $0x487e7162d0fe486d; WORD $0x626f; BYTE $0x3e + TESTQ $(1<<13), R14 + JE skipNext13 + MOVQ 13*24(AX), R9 + LONG $0x487c4162; WORD $0x2c10; BYTE $0x09 + +skipNext13: + QUAD $0x7162c4fe48755162; QUAD $0x482df162ce6f487e; QUAD $0x724825f16206c672; QUAD $0xc672481df1620bc6; QUAD $0xcac8254845736219; QUAD $0x5362c6fe483d1162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62e8fe4855d162c2; QUAD $0xf16202c2724875f1; QUAD $0x1df1620dc2724825; QUAD $0x487e716216c27248; QUAD $0xcc2548657362ca6f; QUAD $0x96cc254825d362e8; QUAD $0xd162c9fe4875d162; QUAD $0x487e7162c8fe4875; WORD $0x626f; BYTE $0x3f + TESTQ $(1<<14), R14 + JE skipNext14 + MOVQ 14*24(AX), R9 + LONG $0x487c4162; WORD $0x3410; BYTE $0x09 + +skipNext14: + QUAD $0x7162c4fe487d5162; QUAD $0x482df162cd6f487e; QUAD $0x724825f16206c572; QUAD $0xc572481df1620bc5; QUAD $0xcacf25484d736219; QUAD $0x5362c7fe483d1162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62e0fe485dd162c2; QUAD $0xf16202c172487df1; QUAD $0x1df1620dc1724825; QUAD $0x487e716216c17248; QUAD $0xcb25486d7362c96f; QUAD $0x96c4254825d362e8; QUAD $0xd162c1fe487dd162; QUAD $0x487e7162c0fe487d; WORD $0x626f; BYTE $0x40 + TESTQ $(1<<15), R14 + JE skipNext15 + MOVQ 15*24(AX), R9 + LONG $0x487c4162; WORD $0x3c10; BYTE $0x09 + +skipNext15: + QUAD $0xd162d86f487e7162; QUAD $0x7dd16224046f487e; QUAD $0x6f487e7162c3fe49; QUAD $0x244c6f487ed162d9; QUAD $0x62cbfe4975d16201; QUAD $0x7ed162da6f487e71; QUAD $0x6dd1620224546f48; QUAD $0x6f487e7162d3fe49; QUAD $0x245c6f487ed162db; QUAD $0x62dbfe4965d16203; QUAD $0x7ed162dc6f487e71; QUAD $0x5dd1620424646f48; QUAD $0x6f487e7162e3fe49; QUAD $0x246c6f487ed162dd; QUAD $0x62ebfe4955d16205; QUAD $0x7ed162de6f487e71; QUAD $0x4dd1620624746f48; QUAD $0x6f487e7162f3fe49; QUAD $0x247c6f487ed162df; QUAD $0xc4fbfe4945d16207; LONG $0xce92fbc1 + JMP lloop + +lastLoop: + QUAD $0x7162c4fe48455162; QUAD $0x482df162cc6f487e; QUAD $0x724825f16206c472; QUAD $0xc472481df1620bc4; QUAD $0xcace254855736219; QUAD $0x5362c0fe483d3162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62d8fe4865d162c2; QUAD $0xf16202c0724845f1; QUAD $0x1df1620dc0724825; QUAD $0x487e716216c07248; QUAD $0xca2548757362c86f; QUAD $0x96fc254825d362e8; QUAD $0xd162f9fe4845d162; QUAD $0x487e7162f8fe4845; QUAD $0xfe484d516231626f; QUAD $0x62cb6f487e7162c4; QUAD $0xf16206c372482df1; QUAD $0x1df1620bc3724825; QUAD $0x485d736219c37248; QUAD $0xfe483d3162cacd25; QUAD $0x96d42548255362c1; QUAD $0x5162c1fe483d5162; QUAD $0x486dd162c2fe483d; QUAD $0xc772484df162d0fe; QUAD $0x0dc7724825f16202; QUAD $0x6216c772481df162; QUAD $0x7d7362cf6f487e71; QUAD $0x4825d362e8c92548; QUAD $0xfe484dd16296f425; QUAD $0x62f0fe484dd162f1; QUAD $0x516232626f487e71; QUAD $0x487e7162c4fe4855; QUAD $0xc272482df162ca6f; QUAD $0x0bc2724825f16206; QUAD $0x6219c272481df162; QUAD $0x3162cacc25486573; QUAD $0x48255362c2fe483d; QUAD $0xfe483d516296d425; QUAD $0x62c2fe483d5162c1; QUAD $0x55f162c8fe4875d1; QUAD $0x4825f16202c67248; QUAD $0x72481df1620dc672; QUAD $0xce6f487e716216c6; QUAD $0x62e8c82548457362; QUAD $0xd16296ec254825d3; QUAD $0x4855d162e9fe4855; QUAD $0x626f487e7162e8fe; QUAD $0x62c4fe485d516233; QUAD $0x2df162c96f487e71; QUAD $0x4825f16206c17248; QUAD $0x72481df1620bc172; QUAD $0xcb25486d736219c1; QUAD $0x62c3fe483d3162ca; QUAD $0x516296d425482553; QUAD $0x483d5162c1fe483d; QUAD $0xc0fe487dd162c2fe; QUAD $0x6202c572485df162; QUAD $0xf1620dc5724825f1; QUAD $0x7e716216c572481d; QUAD $0x25484d7362cd6f48; QUAD $0xe4254825d362e8cf; QUAD $0x62e1fe485dd16296; QUAD $0x7e7162e0fe485dd1; QUAD $0x4865516234626f48; QUAD $0xc86f487e7162c4fe; QUAD $0x6206c072482df162; QUAD $0xf1620bc0724825f1; QUAD $0x75736219c072481d; QUAD $0x483d3162caca2548; QUAD $0xd42548255362c4fe; QUAD $0x62c1fe483d516296; QUAD $0x45d162c2fe483d51; QUAD $0x724865f162f8fe48; QUAD $0xc4724825f16202c4; QUAD $0x16c472481df1620d; QUAD $0x7362cc6f487e7162; QUAD $0x25d362e8ce254855; QUAD $0x4865d16296dc2548; QUAD $0xd8fe4865d162d9fe; QUAD $0x6235626f487e7162; QUAD $0x7e7162c4fe486d51; QUAD $0x72482df162cf6f48; QUAD $0xc7724825f16206c7; QUAD $0x19c772481df1620b; QUAD $0x62cac925487d7362; QUAD $0x255362c5fe483d31; QUAD $0x483d516296d42548; QUAD $0xc2fe483d5162c1fe; QUAD $0xf162f0fe484dd162; QUAD $0x25f16202c372486d; QUAD $0x481df1620dc37248; QUAD $0x6f487e716216c372; QUAD $0xe8cd25485d7362cb; QUAD $0x6296d4254825d362; QUAD $0x6dd162d1fe486dd1; QUAD $0x6f487e7162d0fe48; QUAD $0xc4fe487551623662; QUAD $0xf162ce6f487e7162; QUAD $0x25f16206c672482d; QUAD $0x481df1620bc67248; QUAD $0x254845736219c672; QUAD $0xc6fe483d3162cac8; QUAD $0x6296d42548255362; QUAD $0x3d5162c1fe483d51; QUAD $0xfe4855d162c2fe48; QUAD $0x02c2724875f162e8; QUAD $0x620dc2724825f162; QUAD $0x716216c272481df1; QUAD $0x48657362ca6f487e; QUAD $0x254825d362e8cc25; QUAD $0xc9fe4875d16296cc; QUAD $0x7162c8fe4875d162; QUAD $0x7d516237626f487e; QUAD $0x6f487e7162c4fe48; QUAD $0x06c572482df162cd; QUAD $0x620bc5724825f162; QUAD $0x736219c572481df1; QUAD $0x3d3162cacf25484d; QUAD $0x2548255362c7fe48; QUAD $0xc1fe483d516296d4; QUAD $0xd162c2fe483d5162; QUAD $0x487df162e0fe485d; QUAD $0x724825f16202c172; QUAD $0xc172481df1620dc1; QUAD $0x62c96f487e716216; QUAD $0xd362e8cb25486d73; QUAD $0x7dd16296c4254825; QUAD $0xfe487dd162c1fe48; QUAD $0x38626f487e7162c0; QUAD $0x7162c4fe48455162; QUAD $0x482df162cc6f487e; QUAD $0x724825f16206c472; QUAD $0xc472481df1620bc4; QUAD $0xcace254855736219; QUAD $0x5362c0fe483d1162; QUAD $0x3d516296d4254825; QUAD $0xfe483d5162c1fe48; QUAD $0x62d8fe4865d162c2; QUAD $0xf16202c0724845f1; QUAD $0x1df1620dc0724825; QUAD $0x487e716216c07248; QUAD $0xca2548757362c86f; QUAD $0x96fc254825d362e8; QUAD $0xd162f9fe4845d162; QUAD $0x487e7162f8fe4845; QUAD $0xfe484d516239626f; QUAD $0x62cb6f487e7162c4; QUAD $0xf16206c372482df1; QUAD $0x1df1620bc3724825; QUAD $0x485d736219c37248; QUAD $0xfe483d1162cacd25; QUAD $0x96d42548255362c1; QUAD $0x5162c1fe483d5162; QUAD $0x486dd162c2fe483d; QUAD $0xc772484df162d0fe; QUAD $0x0dc7724825f16202; QUAD $0x6216c772481df162; QUAD $0x7d7362cf6f487e71; QUAD $0x4825d362e8c92548; QUAD $0xfe484dd16296f425; QUAD $0x62f0fe484dd162f1; QUAD $0x51623a626f487e71; QUAD $0x487e7162c4fe4855; QUAD $0xc272482df162ca6f; QUAD $0x0bc2724825f16206; QUAD $0x6219c272481df162; QUAD $0x1162cacc25486573; QUAD $0x48255362c2fe483d; QUAD $0xfe483d516296d425; QUAD $0x62c2fe483d5162c1; QUAD $0x55f162c8fe4875d1; QUAD $0x4825f16202c67248; QUAD $0x72481df1620dc672; QUAD $0xce6f487e716216c6; QUAD $0x62e8c82548457362; QUAD $0xd16296ec254825d3; QUAD $0x4855d162e9fe4855; QUAD $0x626f487e7162e8fe; QUAD $0x62c4fe485d51623b; QUAD $0x2df162c96f487e71; QUAD $0x4825f16206c17248; QUAD $0x72481df1620bc172; QUAD $0xcb25486d736219c1; QUAD $0x62c3fe483d1162ca; QUAD $0x516296d425482553; QUAD $0x483d5162c1fe483d; QUAD $0xc0fe487dd162c2fe; QUAD $0x6202c572485df162; QUAD $0xf1620dc5724825f1; QUAD $0x7e716216c572481d; QUAD $0x25484d7362cd6f48; QUAD $0xe4254825d362e8cf; QUAD $0x62e1fe485dd16296; QUAD $0x7e7162e0fe485dd1; QUAD $0x486551623c626f48; QUAD $0xc86f487e7162c4fe; QUAD $0x6206c072482df162; QUAD $0xf1620bc0724825f1; QUAD $0x75736219c072481d; QUAD $0x483d1162caca2548; QUAD $0xd42548255362c4fe; QUAD $0x62c1fe483d516296; QUAD $0x45d162c2fe483d51; QUAD $0x724865f162f8fe48; QUAD $0xc4724825f16202c4; QUAD $0x16c472481df1620d; QUAD $0x7362cc6f487e7162; QUAD $0x25d362e8ce254855; QUAD $0x4865d16296dc2548; QUAD $0xd8fe4865d162d9fe; QUAD $0x623d626f487e7162; QUAD $0x7e7162c4fe486d51; QUAD $0x72482df162cf6f48; QUAD $0xc7724825f16206c7; QUAD $0x19c772481df1620b; QUAD $0x62cac925487d7362; QUAD $0x255362c5fe483d11; QUAD $0x483d516296d42548; QUAD $0xc2fe483d5162c1fe; QUAD $0xf162f0fe484dd162; QUAD $0x25f16202c372486d; QUAD $0x481df1620dc37248; QUAD $0x6f487e716216c372; QUAD $0xe8cd25485d7362cb; QUAD $0x6296d4254825d362; QUAD $0x6dd162d1fe486dd1; QUAD $0x6f487e7162d0fe48; QUAD $0xc4fe487551623e62; QUAD $0xf162ce6f487e7162; QUAD $0x25f16206c672482d; QUAD $0x481df1620bc67248; QUAD $0x254845736219c672; QUAD $0xc6fe483d1162cac8; QUAD $0x6296d42548255362; QUAD $0x3d5162c1fe483d51; QUAD $0xfe4855d162c2fe48; QUAD $0x02c2724875f162e8; QUAD $0x620dc2724825f162; QUAD $0x716216c272481df1; QUAD $0x48657362ca6f487e; QUAD $0x254825d362e8cc25; QUAD $0xc9fe4875d16296cc; QUAD $0x7162c8fe4875d162; QUAD $0x7d51623f626f487e; QUAD $0x6f487e7162c4fe48; QUAD $0x06c572482df162cd; QUAD $0x620bc5724825f162; QUAD $0x736219c572481df1; QUAD $0x3d1162cacf25484d; QUAD $0x2548255362c7fe48; QUAD $0xc1fe483d516296d4; QUAD $0xd162c2fe483d5162; QUAD $0x487df162e0fe485d; QUAD $0x724825f16202c172; QUAD $0xc172481df1620dc1; QUAD $0x62c96f487e716216; QUAD $0xd362e8cb25486d73; QUAD $0x7dd16296c4254825; QUAD $0xfe487dd162c1fe48; QUAD $0x40626f487e7162c0; QUAD $0xd162d86f487e7162; QUAD $0x7dd16224046f487e; QUAD $0x6f487e7162c3fe49; QUAD $0x244c6f487ed162d9; QUAD $0x62cbfe4975d16201; QUAD $0x7ed162da6f487e71; QUAD $0x6dd1620224546f48; QUAD $0x6f487e7162d3fe49; QUAD $0x245c6f487ed162db; QUAD $0x62dbfe4965d16203; QUAD $0x7ed162dc6f487e71; QUAD $0x5dd1620424646f48; QUAD $0x6f487e7162e3fe49; QUAD $0x246c6f487ed162dd; QUAD $0x62ebfe4955d16205; QUAD $0x7ed162de6f487e71; QUAD $0x4dd1620624746f48; QUAD $0x6f487e7162f3fe49; QUAD $0x247c6f487ed162df; QUAD $0x62fbfe4945d16207; QUAD $0x7ef162077f487ef1; QUAD $0x487ef162014f7f48; QUAD $0x7f487ef16202577f; QUAD $0x677f487ef162035f; QUAD $0x056f7f487ef16204; QUAD $0x6206777f487ef162; LONG $0x7f487ef1; WORD $0x077f + VZEROUPPER + RET + +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x000(SB)/8, $0x0405060700010203 +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x008(SB)/8, $0x0c0d0e0f08090a0b +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x010(SB)/8, $0x0405060700010203 +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x018(SB)/8, $0x0c0d0e0f08090a0b +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x020(SB)/8, $0x0405060700010203 +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x028(SB)/8, $0x0c0d0e0f08090a0b +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x030(SB)/8, $0x0405060700010203 +DATA PSHUFFLE_BYTE_FLIP_MASK<>+0x038(SB)/8, $0x0c0d0e0f08090a0b +GLOBL PSHUFFLE_BYTE_FLIP_MASK<>(SB), 8, $64 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x000(SB)/8, $0x0000000000000000 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x008(SB)/8, $0x0000000000000001 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x010(SB)/8, $0x0000000000000008 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x018(SB)/8, $0x0000000000000009 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x020(SB)/8, $0x0000000000000004 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x028(SB)/8, $0x0000000000000005 +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x030(SB)/8, $0x000000000000000C +DATA PSHUFFLE_TRANSPOSE16_MASK1<>+0x038(SB)/8, $0x000000000000000D +GLOBL PSHUFFLE_TRANSPOSE16_MASK1<>(SB), 8, $64 +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x000(SB)/8, $0x0000000000000002 +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x008(SB)/8, $0x0000000000000003 +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x010(SB)/8, $0x000000000000000A +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x018(SB)/8, $0x000000000000000B +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x020(SB)/8, $0x0000000000000006 +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x028(SB)/8, $0x0000000000000007 +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x030(SB)/8, $0x000000000000000E +DATA PSHUFFLE_TRANSPOSE16_MASK2<>+0x038(SB)/8, $0x000000000000000F +GLOBL PSHUFFLE_TRANSPOSE16_MASK2<>(SB), 8, $64 diff --git a/vendor/github.com/minio/sha256-simd/sha256block_amd64.go b/vendor/github.com/minio/sha256-simd/sha256block_amd64.go new file mode 100644 index 0000000000..e536f54e15 --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/sha256block_amd64.go @@ -0,0 +1,31 @@ +//go:build !noasm && !appengine && gc +// +build !noasm,!appengine,gc + +/* + * Minio Cloud Storage, (C) 2016 Minio, Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package sha256 + +func blockArmSha2Go(dig *digest, p []byte) { + panic("blockArmSha2Go called unexpectedly") +} + +//go:noescape +func blockIntelSha(h *[8]uint32, message []uint8) + +func blockIntelShaGo(dig *digest, p []byte) { + blockIntelSha(&dig.h, p) +} diff --git a/vendor/github.com/minio/sha256-simd/sha256block_amd64.s b/vendor/github.com/minio/sha256-simd/sha256block_amd64.s new file mode 100644 index 0000000000..c98a1d8f0c --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/sha256block_amd64.s @@ -0,0 +1,266 @@ +//+build !noasm,!appengine,gc + +// SHA intrinsic version of SHA256 + +// Kristofer Peterson, (C) 2018. +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. +// + +#include "textflag.h" + +DATA K<>+0x00(SB)/4, $0x428a2f98 +DATA K<>+0x04(SB)/4, $0x71374491 +DATA K<>+0x08(SB)/4, $0xb5c0fbcf +DATA K<>+0x0c(SB)/4, $0xe9b5dba5 +DATA K<>+0x10(SB)/4, $0x3956c25b +DATA K<>+0x14(SB)/4, $0x59f111f1 +DATA K<>+0x18(SB)/4, $0x923f82a4 +DATA K<>+0x1c(SB)/4, $0xab1c5ed5 +DATA K<>+0x20(SB)/4, $0xd807aa98 +DATA K<>+0x24(SB)/4, $0x12835b01 +DATA K<>+0x28(SB)/4, $0x243185be +DATA K<>+0x2c(SB)/4, $0x550c7dc3 +DATA K<>+0x30(SB)/4, $0x72be5d74 +DATA K<>+0x34(SB)/4, $0x80deb1fe +DATA K<>+0x38(SB)/4, $0x9bdc06a7 +DATA K<>+0x3c(SB)/4, $0xc19bf174 +DATA K<>+0x40(SB)/4, $0xe49b69c1 +DATA K<>+0x44(SB)/4, $0xefbe4786 +DATA K<>+0x48(SB)/4, $0x0fc19dc6 +DATA K<>+0x4c(SB)/4, $0x240ca1cc +DATA K<>+0x50(SB)/4, $0x2de92c6f +DATA K<>+0x54(SB)/4, $0x4a7484aa +DATA K<>+0x58(SB)/4, $0x5cb0a9dc +DATA K<>+0x5c(SB)/4, $0x76f988da +DATA K<>+0x60(SB)/4, $0x983e5152 +DATA K<>+0x64(SB)/4, $0xa831c66d +DATA K<>+0x68(SB)/4, $0xb00327c8 +DATA K<>+0x6c(SB)/4, $0xbf597fc7 +DATA K<>+0x70(SB)/4, $0xc6e00bf3 +DATA K<>+0x74(SB)/4, $0xd5a79147 +DATA K<>+0x78(SB)/4, $0x06ca6351 +DATA K<>+0x7c(SB)/4, $0x14292967 +DATA K<>+0x80(SB)/4, $0x27b70a85 +DATA K<>+0x84(SB)/4, $0x2e1b2138 +DATA K<>+0x88(SB)/4, $0x4d2c6dfc +DATA K<>+0x8c(SB)/4, $0x53380d13 +DATA K<>+0x90(SB)/4, $0x650a7354 +DATA K<>+0x94(SB)/4, $0x766a0abb +DATA K<>+0x98(SB)/4, $0x81c2c92e +DATA K<>+0x9c(SB)/4, $0x92722c85 +DATA K<>+0xa0(SB)/4, $0xa2bfe8a1 +DATA K<>+0xa4(SB)/4, $0xa81a664b +DATA K<>+0xa8(SB)/4, $0xc24b8b70 +DATA K<>+0xac(SB)/4, $0xc76c51a3 +DATA K<>+0xb0(SB)/4, $0xd192e819 +DATA K<>+0xb4(SB)/4, $0xd6990624 +DATA K<>+0xb8(SB)/4, $0xf40e3585 +DATA K<>+0xbc(SB)/4, $0x106aa070 +DATA K<>+0xc0(SB)/4, $0x19a4c116 +DATA K<>+0xc4(SB)/4, $0x1e376c08 +DATA K<>+0xc8(SB)/4, $0x2748774c +DATA K<>+0xcc(SB)/4, $0x34b0bcb5 +DATA K<>+0xd0(SB)/4, $0x391c0cb3 +DATA K<>+0xd4(SB)/4, $0x4ed8aa4a +DATA K<>+0xd8(SB)/4, $0x5b9cca4f +DATA K<>+0xdc(SB)/4, $0x682e6ff3 +DATA K<>+0xe0(SB)/4, $0x748f82ee +DATA K<>+0xe4(SB)/4, $0x78a5636f +DATA K<>+0xe8(SB)/4, $0x84c87814 +DATA K<>+0xec(SB)/4, $0x8cc70208 +DATA K<>+0xf0(SB)/4, $0x90befffa +DATA K<>+0xf4(SB)/4, $0xa4506ceb +DATA K<>+0xf8(SB)/4, $0xbef9a3f7 +DATA K<>+0xfc(SB)/4, $0xc67178f2 +GLOBL K<>(SB), RODATA|NOPTR, $256 + +DATA SHUF_MASK<>+0x00(SB)/8, $0x0405060700010203 +DATA SHUF_MASK<>+0x08(SB)/8, $0x0c0d0e0f08090a0b +GLOBL SHUF_MASK<>(SB), RODATA|NOPTR, $16 + +// Register Usage +// BX base address of constant table (constant) +// DX hash_state (constant) +// SI hash_data.data +// DI hash_data.data + hash_data.length - 64 (constant) +// X0 scratch +// X1 scratch +// X2 working hash state // ABEF +// X3 working hash state // CDGH +// X4 first 16 bytes of block +// X5 second 16 bytes of block +// X6 third 16 bytes of block +// X7 fourth 16 bytes of block +// X12 saved hash state // ABEF +// X13 saved hash state // CDGH +// X15 data shuffle mask (constant) + +TEXT ·blockIntelSha(SB), NOSPLIT, $0-32 + MOVQ h+0(FP), DX + MOVQ message_base+8(FP), SI + MOVQ message_len+16(FP), DI + LEAQ -64(SI)(DI*1), DI + MOVOU (DX), X2 + MOVOU 16(DX), X1 + MOVO X2, X3 + PUNPCKLLQ X1, X2 + PUNPCKHLQ X1, X3 + PSHUFD $0x27, X2, X2 + PSHUFD $0x27, X3, X3 + MOVO SHUF_MASK<>(SB), X15 + LEAQ K<>(SB), BX + + JMP TEST + +LOOP: + MOVO X2, X12 + MOVO X3, X13 + + // load block and shuffle + MOVOU (SI), X4 + MOVOU 16(SI), X5 + MOVOU 32(SI), X6 + MOVOU 48(SI), X7 + PSHUFB X15, X4 + PSHUFB X15, X5 + PSHUFB X15, X6 + PSHUFB X15, X7 + +#define ROUND456 \ + PADDL X5, X0 \ + LONG $0xdacb380f \ // SHA256RNDS2 XMM3, XMM2 + MOVO X5, X1 \ + LONG $0x0f3a0f66; WORD $0x04cc \ // PALIGNR XMM1, XMM4, 4 + PADDL X1, X6 \ + LONG $0xf5cd380f \ // SHA256MSG2 XMM6, XMM5 + PSHUFD $0x4e, X0, X0 \ + LONG $0xd3cb380f \ // SHA256RNDS2 XMM2, XMM3 + LONG $0xe5cc380f // SHA256MSG1 XMM4, XMM5 + +#define ROUND567 \ + PADDL X6, X0 \ + LONG $0xdacb380f \ // SHA256RNDS2 XMM3, XMM2 + MOVO X6, X1 \ + LONG $0x0f3a0f66; WORD $0x04cd \ // PALIGNR XMM1, XMM5, 4 + PADDL X1, X7 \ + LONG $0xfecd380f \ // SHA256MSG2 XMM7, XMM6 + PSHUFD $0x4e, X0, X0 \ + LONG $0xd3cb380f \ // SHA256RNDS2 XMM2, XMM3 + LONG $0xeecc380f // SHA256MSG1 XMM5, XMM6 + +#define ROUND674 \ + PADDL X7, X0 \ + LONG $0xdacb380f \ // SHA256RNDS2 XMM3, XMM2 + MOVO X7, X1 \ + LONG $0x0f3a0f66; WORD $0x04ce \ // PALIGNR XMM1, XMM6, 4 + PADDL X1, X4 \ + LONG $0xe7cd380f \ // SHA256MSG2 XMM4, XMM7 + PSHUFD $0x4e, X0, X0 \ + LONG $0xd3cb380f \ // SHA256RNDS2 XMM2, XMM3 + LONG $0xf7cc380f // SHA256MSG1 XMM6, XMM7 + +#define ROUND745 \ + PADDL X4, X0 \ + LONG $0xdacb380f \ // SHA256RNDS2 XMM3, XMM2 + MOVO X4, X1 \ + LONG $0x0f3a0f66; WORD $0x04cf \ // PALIGNR XMM1, XMM7, 4 + PADDL X1, X5 \ + LONG $0xeccd380f \ // SHA256MSG2 XMM5, XMM4 + PSHUFD $0x4e, X0, X0 \ + LONG $0xd3cb380f \ // SHA256RNDS2 XMM2, XMM3 + LONG $0xfccc380f // SHA256MSG1 XMM7, XMM4 + + // rounds 0-3 + MOVO (BX), X0 + PADDL X4, X0 + LONG $0xdacb380f // SHA256RNDS2 XMM3, XMM2 + PSHUFD $0x4e, X0, X0 + LONG $0xd3cb380f // SHA256RNDS2 XMM2, XMM3 + + // rounds 4-7 + MOVO 1*16(BX), X0 + PADDL X5, X0 + LONG $0xdacb380f // SHA256RNDS2 XMM3, XMM2 + PSHUFD $0x4e, X0, X0 + LONG $0xd3cb380f // SHA256RNDS2 XMM2, XMM3 + LONG $0xe5cc380f // SHA256MSG1 XMM4, XMM5 + + // rounds 8-11 + MOVO 2*16(BX), X0 + PADDL X6, X0 + LONG $0xdacb380f // SHA256RNDS2 XMM3, XMM2 + PSHUFD $0x4e, X0, X0 + LONG $0xd3cb380f // SHA256RNDS2 XMM2, XMM3 + LONG $0xeecc380f // SHA256MSG1 XMM5, XMM6 + + MOVO 3*16(BX), X0; ROUND674 // rounds 12-15 + MOVO 4*16(BX), X0; ROUND745 // rounds 16-19 + MOVO 5*16(BX), X0; ROUND456 // rounds 20-23 + MOVO 6*16(BX), X0; ROUND567 // rounds 24-27 + MOVO 7*16(BX), X0; ROUND674 // rounds 28-31 + MOVO 8*16(BX), X0; ROUND745 // rounds 32-35 + MOVO 9*16(BX), X0; ROUND456 // rounds 36-39 + MOVO 10*16(BX), X0; ROUND567 // rounds 40-43 + MOVO 11*16(BX), X0; ROUND674 // rounds 44-47 + MOVO 12*16(BX), X0; ROUND745 // rounds 48-51 + + // rounds 52-55 + MOVO 13*16(BX), X0 + PADDL X5, X0 + LONG $0xdacb380f // SHA256RNDS2 XMM3, XMM2 + MOVO X5, X1 + LONG $0x0f3a0f66; WORD $0x04cc // PALIGNR XMM1, XMM4, 4 + PADDL X1, X6 + LONG $0xf5cd380f // SHA256MSG2 XMM6, XMM5 + PSHUFD $0x4e, X0, X0 + LONG $0xd3cb380f // SHA256RNDS2 XMM2, XMM3 + + // rounds 56-59 + MOVO 14*16(BX), X0 + PADDL X6, X0 + LONG $0xdacb380f // SHA256RNDS2 XMM3, XMM2 + MOVO X6, X1 + LONG $0x0f3a0f66; WORD $0x04cd // PALIGNR XMM1, XMM5, 4 + PADDL X1, X7 + LONG $0xfecd380f // SHA256MSG2 XMM7, XMM6 + PSHUFD $0x4e, X0, X0 + LONG $0xd3cb380f // SHA256RNDS2 XMM2, XMM3 + + // rounds 60-63 + MOVO 15*16(BX), X0 + PADDL X7, X0 + LONG $0xdacb380f // SHA256RNDS2 XMM3, XMM2 + PSHUFD $0x4e, X0, X0 + LONG $0xd3cb380f // SHA256RNDS2 XMM2, XMM3 + + PADDL X12, X2 + PADDL X13, X3 + + ADDQ $64, SI + +TEST: + CMPQ SI, DI + JBE LOOP + + PSHUFD $0x4e, X3, X0 + LONG $0x0e3a0f66; WORD $0xf0c2 // PBLENDW XMM0, XMM2, 0xf0 + PSHUFD $0x4e, X2, X1 + LONG $0x0e3a0f66; WORD $0x0fcb // PBLENDW XMM1, XMM3, 0x0f + PSHUFD $0x1b, X0, X0 + PSHUFD $0x1b, X1, X1 + + MOVOU X0, (DX) + MOVOU X1, 16(DX) + + RET diff --git a/vendor/github.com/minio/sha256-simd/sha256block_arm64.go b/vendor/github.com/minio/sha256-simd/sha256block_arm64.go new file mode 100644 index 0000000000..d4369e24ae --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/sha256block_arm64.go @@ -0,0 +1,37 @@ +//go:build !noasm && !appengine && gc +// +build !noasm,!appengine,gc + +/* + * Minio Cloud Storage, (C) 2016 Minio, Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package sha256 + +func blockIntelShaGo(dig *digest, p []byte) { + panic("blockIntelShaGo called unexpectedly") +} + +//go:noescape +func blockArmSha2(h []uint32, message []uint8) + +func blockArmSha2Go(dig *digest, p []byte) { + + h := []uint32{dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4], dig.h[5], dig.h[6], dig.h[7]} + + blockArmSha2(h[:], p[:]) + + dig.h[0], dig.h[1], dig.h[2], dig.h[3], dig.h[4], dig.h[5], dig.h[6], dig.h[7] = h[0], h[1], h[2], h[3], h[4], + h[5], h[6], h[7] +} diff --git a/vendor/github.com/minio/sha256-simd/sha256block_arm64.s b/vendor/github.com/minio/sha256-simd/sha256block_arm64.s new file mode 100644 index 0000000000..7ab88b1637 --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/sha256block_arm64.s @@ -0,0 +1,192 @@ +//+build !noasm,!appengine,gc + +// ARM64 version of SHA256 + +// +// Minio Cloud Storage, (C) 2016 Minio, Inc. +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. +// + +// +// Based on implementation as found in https://github.com/jocover/sha256-armv8 +// +// Use github.com/minio/asm2plan9s on this file to assemble ARM instructions to +// their Plan9 equivalents +// + +TEXT ·blockArmSha2(SB), 7, $0 + MOVD h+0(FP), R0 + MOVD message+24(FP), R1 + MOVD message_len+32(FP), R2 // length of message + SUBS $64, R2 + BMI complete + + // Load constants table pointer + MOVD $·constants(SB), R3 + + // Cache constants table in registers v16 - v31 + WORD $0x4cdf2870 // ld1 {v16.4s-v19.4s}, [x3], #64 + WORD $0x4cdf7800 // ld1 {v0.4s}, [x0], #16 + WORD $0x4cdf2874 // ld1 {v20.4s-v23.4s}, [x3], #64 + + WORD $0x4c407801 // ld1 {v1.4s}, [x0] + WORD $0x4cdf2878 // ld1 {v24.4s-v27.4s}, [x3], #64 + WORD $0xd1004000 // sub x0, x0, #0x10 + WORD $0x4cdf287c // ld1 {v28.4s-v31.4s}, [x3], #64 + +loop: + // Main loop + WORD $0x4cdf2025 // ld1 {v5.16b-v8.16b}, [x1], #64 + WORD $0x4ea01c02 // mov v2.16b, v0.16b + WORD $0x4ea11c23 // mov v3.16b, v1.16b + WORD $0x6e2008a5 // rev32 v5.16b, v5.16b + WORD $0x6e2008c6 // rev32 v6.16b, v6.16b + WORD $0x4eb084a9 // add v9.4s, v5.4s, v16.4s + WORD $0x6e2008e7 // rev32 v7.16b, v7.16b + WORD $0x4eb184ca // add v10.4s, v6.4s, v17.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e094062 // sha256h q2, q3, v9.4s + WORD $0x5e095083 // sha256h2 q3, q4, v9.4s + WORD $0x5e2828c5 // sha256su0 v5.4s, v6.4s + WORD $0x6e200908 // rev32 v8.16b, v8.16b + WORD $0x4eb284e9 // add v9.4s, v7.4s, v18.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e0a4062 // sha256h q2, q3, v10.4s + WORD $0x5e0a5083 // sha256h2 q3, q4, v10.4s + WORD $0x5e2828e6 // sha256su0 v6.4s, v7.4s + WORD $0x5e0860e5 // sha256su1 v5.4s, v7.4s, v8.4s + WORD $0x4eb3850a // add v10.4s, v8.4s, v19.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e094062 // sha256h q2, q3, v9.4s + WORD $0x5e095083 // sha256h2 q3, q4, v9.4s + WORD $0x5e282907 // sha256su0 v7.4s, v8.4s + WORD $0x5e056106 // sha256su1 v6.4s, v8.4s, v5.4s + WORD $0x4eb484a9 // add v9.4s, v5.4s, v20.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e0a4062 // sha256h q2, q3, v10.4s + WORD $0x5e0a5083 // sha256h2 q3, q4, v10.4s + WORD $0x5e2828a8 // sha256su0 v8.4s, v5.4s + WORD $0x5e0660a7 // sha256su1 v7.4s, v5.4s, v6.4s + WORD $0x4eb584ca // add v10.4s, v6.4s, v21.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e094062 // sha256h q2, q3, v9.4s + WORD $0x5e095083 // sha256h2 q3, q4, v9.4s + WORD $0x5e2828c5 // sha256su0 v5.4s, v6.4s + WORD $0x5e0760c8 // sha256su1 v8.4s, v6.4s, v7.4s + WORD $0x4eb684e9 // add v9.4s, v7.4s, v22.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e0a4062 // sha256h q2, q3, v10.4s + WORD $0x5e0a5083 // sha256h2 q3, q4, v10.4s + WORD $0x5e2828e6 // sha256su0 v6.4s, v7.4s + WORD $0x5e0860e5 // sha256su1 v5.4s, v7.4s, v8.4s + WORD $0x4eb7850a // add v10.4s, v8.4s, v23.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e094062 // sha256h q2, q3, v9.4s + WORD $0x5e095083 // sha256h2 q3, q4, v9.4s + WORD $0x5e282907 // sha256su0 v7.4s, v8.4s + WORD $0x5e056106 // sha256su1 v6.4s, v8.4s, v5.4s + WORD $0x4eb884a9 // add v9.4s, v5.4s, v24.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e0a4062 // sha256h q2, q3, v10.4s + WORD $0x5e0a5083 // sha256h2 q3, q4, v10.4s + WORD $0x5e2828a8 // sha256su0 v8.4s, v5.4s + WORD $0x5e0660a7 // sha256su1 v7.4s, v5.4s, v6.4s + WORD $0x4eb984ca // add v10.4s, v6.4s, v25.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e094062 // sha256h q2, q3, v9.4s + WORD $0x5e095083 // sha256h2 q3, q4, v9.4s + WORD $0x5e2828c5 // sha256su0 v5.4s, v6.4s + WORD $0x5e0760c8 // sha256su1 v8.4s, v6.4s, v7.4s + WORD $0x4eba84e9 // add v9.4s, v7.4s, v26.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e0a4062 // sha256h q2, q3, v10.4s + WORD $0x5e0a5083 // sha256h2 q3, q4, v10.4s + WORD $0x5e2828e6 // sha256su0 v6.4s, v7.4s + WORD $0x5e0860e5 // sha256su1 v5.4s, v7.4s, v8.4s + WORD $0x4ebb850a // add v10.4s, v8.4s, v27.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e094062 // sha256h q2, q3, v9.4s + WORD $0x5e095083 // sha256h2 q3, q4, v9.4s + WORD $0x5e282907 // sha256su0 v7.4s, v8.4s + WORD $0x5e056106 // sha256su1 v6.4s, v8.4s, v5.4s + WORD $0x4ebc84a9 // add v9.4s, v5.4s, v28.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e0a4062 // sha256h q2, q3, v10.4s + WORD $0x5e0a5083 // sha256h2 q3, q4, v10.4s + WORD $0x5e2828a8 // sha256su0 v8.4s, v5.4s + WORD $0x5e0660a7 // sha256su1 v7.4s, v5.4s, v6.4s + WORD $0x4ebd84ca // add v10.4s, v6.4s, v29.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e094062 // sha256h q2, q3, v9.4s + WORD $0x5e095083 // sha256h2 q3, q4, v9.4s + WORD $0x5e0760c8 // sha256su1 v8.4s, v6.4s, v7.4s + WORD $0x4ebe84e9 // add v9.4s, v7.4s, v30.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e0a4062 // sha256h q2, q3, v10.4s + WORD $0x5e0a5083 // sha256h2 q3, q4, v10.4s + WORD $0x4ebf850a // add v10.4s, v8.4s, v31.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e094062 // sha256h q2, q3, v9.4s + WORD $0x5e095083 // sha256h2 q3, q4, v9.4s + WORD $0x4ea21c44 // mov v4.16b, v2.16b + WORD $0x5e0a4062 // sha256h q2, q3, v10.4s + WORD $0x5e0a5083 // sha256h2 q3, q4, v10.4s + WORD $0x4ea38421 // add v1.4s, v1.4s, v3.4s + WORD $0x4ea28400 // add v0.4s, v0.4s, v2.4s + + SUBS $64, R2 + BPL loop + + // Store result + WORD $0x4c00a800 // st1 {v0.4s, v1.4s}, [x0] + +complete: + RET + +// Constants table +DATA ·constants+0x0(SB)/8, $0x71374491428a2f98 +DATA ·constants+0x8(SB)/8, $0xe9b5dba5b5c0fbcf +DATA ·constants+0x10(SB)/8, $0x59f111f13956c25b +DATA ·constants+0x18(SB)/8, $0xab1c5ed5923f82a4 +DATA ·constants+0x20(SB)/8, $0x12835b01d807aa98 +DATA ·constants+0x28(SB)/8, $0x550c7dc3243185be +DATA ·constants+0x30(SB)/8, $0x80deb1fe72be5d74 +DATA ·constants+0x38(SB)/8, $0xc19bf1749bdc06a7 +DATA ·constants+0x40(SB)/8, $0xefbe4786e49b69c1 +DATA ·constants+0x48(SB)/8, $0x240ca1cc0fc19dc6 +DATA ·constants+0x50(SB)/8, $0x4a7484aa2de92c6f +DATA ·constants+0x58(SB)/8, $0x76f988da5cb0a9dc +DATA ·constants+0x60(SB)/8, $0xa831c66d983e5152 +DATA ·constants+0x68(SB)/8, $0xbf597fc7b00327c8 +DATA ·constants+0x70(SB)/8, $0xd5a79147c6e00bf3 +DATA ·constants+0x78(SB)/8, $0x1429296706ca6351 +DATA ·constants+0x80(SB)/8, $0x2e1b213827b70a85 +DATA ·constants+0x88(SB)/8, $0x53380d134d2c6dfc +DATA ·constants+0x90(SB)/8, $0x766a0abb650a7354 +DATA ·constants+0x98(SB)/8, $0x92722c8581c2c92e +DATA ·constants+0xa0(SB)/8, $0xa81a664ba2bfe8a1 +DATA ·constants+0xa8(SB)/8, $0xc76c51a3c24b8b70 +DATA ·constants+0xb0(SB)/8, $0xd6990624d192e819 +DATA ·constants+0xb8(SB)/8, $0x106aa070f40e3585 +DATA ·constants+0xc0(SB)/8, $0x1e376c0819a4c116 +DATA ·constants+0xc8(SB)/8, $0x34b0bcb52748774c +DATA ·constants+0xd0(SB)/8, $0x4ed8aa4a391c0cb3 +DATA ·constants+0xd8(SB)/8, $0x682e6ff35b9cca4f +DATA ·constants+0xe0(SB)/8, $0x78a5636f748f82ee +DATA ·constants+0xe8(SB)/8, $0x8cc7020884c87814 +DATA ·constants+0xf0(SB)/8, $0xa4506ceb90befffa +DATA ·constants+0xf8(SB)/8, $0xc67178f2bef9a3f7 + +GLOBL ·constants(SB), 8, $256 + diff --git a/vendor/github.com/minio/sha256-simd/sha256block_other.go b/vendor/github.com/minio/sha256-simd/sha256block_other.go new file mode 100644 index 0000000000..94d7eb0b4e --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/sha256block_other.go @@ -0,0 +1,29 @@ +//go:build appengine || noasm || (!amd64 && !arm64) || !gc +// +build appengine noasm !amd64,!arm64 !gc + +/* + * Minio Cloud Storage, (C) 2019 Minio, Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package sha256 + +func blockIntelShaGo(dig *digest, p []byte) { + panic("blockIntelShaGo called unexpectedly") + +} + +func blockArmSha2Go(dig *digest, p []byte) { + panic("blockArmSha2Go called unexpectedly") +} diff --git a/vendor/github.com/minio/sha256-simd/test-architectures.sh b/vendor/github.com/minio/sha256-simd/test-architectures.sh new file mode 100644 index 0000000000..50150eaabe --- /dev/null +++ b/vendor/github.com/minio/sha256-simd/test-architectures.sh @@ -0,0 +1,15 @@ +#!/bin/sh + +set -e + +go tool dist list | while IFS=/ read os arch; do + echo "Checking $os/$arch..." + echo " normal" + GOARCH=$arch GOOS=$os go build -o /dev/null ./... + echo " noasm" + GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null ./... + echo " appengine" + GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null ./... + echo " noasm,appengine" + GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null ./... +done diff --git a/vendor/github.com/prometheus/client_golang/api/prometheus/v1/api.go b/vendor/github.com/prometheus/client_golang/api/prometheus/v1/api.go index f74139c71f..1cfe8d863c 100644 --- a/vendor/github.com/prometheus/client_golang/api/prometheus/v1/api.go +++ b/vendor/github.com/prometheus/client_golang/api/prometheus/v1/api.go @@ -35,11 +35,15 @@ import ( ) func init() { - json.RegisterTypeEncoderFunc("model.SamplePair", marshalPointJSON, marshalPointJSONIsEmpty) - json.RegisterTypeDecoderFunc("model.SamplePair", unMarshalPointJSON) + json.RegisterTypeEncoderFunc("model.SamplePair", marshalSamplePairJSON, marshalJSONIsEmpty) + json.RegisterTypeDecoderFunc("model.SamplePair", unmarshalSamplePairJSON) + json.RegisterTypeEncoderFunc("model.SampleHistogramPair", marshalSampleHistogramPairJSON, marshalJSONIsEmpty) + json.RegisterTypeDecoderFunc("model.SampleHistogramPair", unmarshalSampleHistogramPairJSON) + json.RegisterTypeEncoderFunc("model.SampleStream", marshalSampleStreamJSON, marshalJSONIsEmpty) // Only needed for benchmark. + json.RegisterTypeDecoderFunc("model.SampleStream", unmarshalSampleStreamJSON) // Only needed for benchmark. } -func unMarshalPointJSON(ptr unsafe.Pointer, iter *json.Iterator) { +func unmarshalSamplePairJSON(ptr unsafe.Pointer, iter *json.Iterator) { p := (*model.SamplePair)(ptr) if !iter.ReadArray() { iter.ReportError("unmarshal model.SamplePair", "SamplePair must be [timestamp, value]") @@ -68,12 +72,165 @@ func unMarshalPointJSON(ptr unsafe.Pointer, iter *json.Iterator) { } } -func marshalPointJSON(ptr unsafe.Pointer, stream *json.Stream) { +func marshalSamplePairJSON(ptr unsafe.Pointer, stream *json.Stream) { p := *((*model.SamplePair)(ptr)) stream.WriteArrayStart() + marshalTimestamp(p.Timestamp, stream) + stream.WriteMore() + marshalFloat(float64(p.Value), stream) + stream.WriteArrayEnd() +} + +func unmarshalSampleHistogramPairJSON(ptr unsafe.Pointer, iter *json.Iterator) { + p := (*model.SampleHistogramPair)(ptr) + if !iter.ReadArray() { + iter.ReportError("unmarshal model.SampleHistogramPair", "SampleHistogramPair must be [timestamp, {histogram}]") + return + } + t := iter.ReadNumber() + if err := p.Timestamp.UnmarshalJSON([]byte(t)); err != nil { + iter.ReportError("unmarshal model.SampleHistogramPair", err.Error()) + return + } + if !iter.ReadArray() { + iter.ReportError("unmarshal model.SampleHistogramPair", "SamplePair missing histogram") + return + } + h := &model.SampleHistogram{} + p.Histogram = h + for key := iter.ReadObject(); key != ""; key = iter.ReadObject() { + switch key { + case "count": + f, err := strconv.ParseFloat(iter.ReadString(), 64) + if err != nil { + iter.ReportError("unmarshal model.SampleHistogramPair", "count of histogram is not a float") + return + } + h.Count = model.FloatString(f) + case "sum": + f, err := strconv.ParseFloat(iter.ReadString(), 64) + if err != nil { + iter.ReportError("unmarshal model.SampleHistogramPair", "sum of histogram is not a float") + return + } + h.Sum = model.FloatString(f) + case "buckets": + for iter.ReadArray() { + b, err := unmarshalHistogramBucket(iter) + if err != nil { + iter.ReportError("unmarshal model.HistogramBucket", err.Error()) + return + } + h.Buckets = append(h.Buckets, b) + } + default: + iter.ReportError("unmarshal model.SampleHistogramPair", fmt.Sprint("unexpected key in histogram:", key)) + return + } + } + if iter.ReadArray() { + iter.ReportError("unmarshal model.SampleHistogramPair", "SampleHistogramPair has too many values, must be [timestamp, {histogram}]") + return + } +} + +func marshalSampleHistogramPairJSON(ptr unsafe.Pointer, stream *json.Stream) { + p := *((*model.SampleHistogramPair)(ptr)) + stream.WriteArrayStart() + marshalTimestamp(p.Timestamp, stream) + stream.WriteMore() + marshalHistogram(*p.Histogram, stream) + stream.WriteArrayEnd() +} + +func unmarshalSampleStreamJSON(ptr unsafe.Pointer, iter *json.Iterator) { + ss := (*model.SampleStream)(ptr) + for key := iter.ReadObject(); key != ""; key = iter.ReadObject() { + switch key { + case "metric": + metricString := iter.ReadAny().ToString() + if err := json.UnmarshalFromString(metricString, &ss.Metric); err != nil { + iter.ReportError("unmarshal model.SampleStream", err.Error()) + return + } + case "values": + for iter.ReadArray() { + v := model.SamplePair{} + unmarshalSamplePairJSON(unsafe.Pointer(&v), iter) + ss.Values = append(ss.Values, v) + } + case "histograms": + for iter.ReadArray() { + h := model.SampleHistogramPair{} + unmarshalSampleHistogramPairJSON(unsafe.Pointer(&h), iter) + ss.Histograms = append(ss.Histograms, h) + } + default: + iter.ReportError("unmarshal model.SampleStream", fmt.Sprint("unexpected key:", key)) + return + } + } +} + +func marshalSampleStreamJSON(ptr unsafe.Pointer, stream *json.Stream) { + ss := *((*model.SampleStream)(ptr)) + stream.WriteObjectStart() + stream.WriteObjectField(`metric`) + m, err := json.ConfigCompatibleWithStandardLibrary.Marshal(ss.Metric) + if err != nil { + stream.Error = err + return + } + stream.SetBuffer(append(stream.Buffer(), m...)) + if len(ss.Values) > 0 { + stream.WriteMore() + stream.WriteObjectField(`values`) + stream.WriteArrayStart() + for i, v := range ss.Values { + if i > 0 { + stream.WriteMore() + } + marshalSamplePairJSON(unsafe.Pointer(&v), stream) + } + stream.WriteArrayEnd() + } + if len(ss.Histograms) > 0 { + stream.WriteMore() + stream.WriteObjectField(`histograms`) + stream.WriteArrayStart() + for i, h := range ss.Histograms { + if i > 0 { + stream.WriteMore() + } + marshalSampleHistogramPairJSON(unsafe.Pointer(&h), stream) + } + stream.WriteArrayEnd() + } + stream.WriteObjectEnd() +} + +func marshalFloat(v float64, stream *json.Stream) { + stream.WriteRaw(`"`) + // Taken from https://github.com/json-iterator/go/blob/master/stream_float.go#L71 as a workaround + // to https://github.com/json-iterator/go/issues/365 (json-iterator, to follow json standard, doesn't allow inf/nan). + buf := stream.Buffer() + abs := math.Abs(v) + fmt := byte('f') + // Note: Must use float32 comparisons for underlying float32 value to get precise cutoffs right. + if abs != 0 { + if abs < 1e-6 || abs >= 1e21 { + fmt = 'e' + } + } + buf = strconv.AppendFloat(buf, v, fmt, -1, 64) + stream.SetBuffer(buf) + stream.WriteRaw(`"`) +} + +func marshalTimestamp(timestamp model.Time, stream *json.Stream) { + t := int64(timestamp) // Write out the timestamp as a float divided by 1000. // This is ~3x faster than converting to a float. - t := int64(p.Timestamp) if t < 0 { stream.WriteRaw(`-`) t = -t @@ -90,28 +247,113 @@ func marshalPointJSON(ptr unsafe.Pointer, stream *json.Stream) { } stream.WriteInt64(fraction) } - stream.WriteMore() - stream.WriteRaw(`"`) +} - // Taken from https://github.com/json-iterator/go/blob/master/stream_float.go#L71 as a workaround - // to https://github.com/json-iterator/go/issues/365 (jsoniter, to follow json standard, doesn't allow inf/nan) - buf := stream.Buffer() - abs := math.Abs(float64(p.Value)) - fmt := byte('f') - // Note: Must use float32 comparisons for underlying float32 value to get precise cutoffs right. - if abs != 0 { - if abs < 1e-6 || abs >= 1e21 { - fmt = 'e' - } +func unmarshalHistogramBucket(iter *json.Iterator) (*model.HistogramBucket, error) { + b := model.HistogramBucket{} + if !iter.ReadArray() { + return nil, errors.New("HistogramBucket must be [boundaries, lower, upper, count]") } - buf = strconv.AppendFloat(buf, float64(p.Value), fmt, -1, 64) - stream.SetBuffer(buf) + boundaries, err := iter.ReadNumber().Int64() + if err != nil { + return nil, err + } + b.Boundaries = int32(boundaries) + if !iter.ReadArray() { + return nil, errors.New("HistogramBucket must be [boundaries, lower, upper, count]") + } + f, err := strconv.ParseFloat(iter.ReadString(), 64) + if err != nil { + return nil, err + } + b.Lower = model.FloatString(f) + if !iter.ReadArray() { + return nil, errors.New("HistogramBucket must be [boundaries, lower, upper, count]") + } + f, err = strconv.ParseFloat(iter.ReadString(), 64) + if err != nil { + return nil, err + } + b.Upper = model.FloatString(f) + if !iter.ReadArray() { + return nil, errors.New("HistogramBucket must be [boundaries, lower, upper, count]") + } + f, err = strconv.ParseFloat(iter.ReadString(), 64) + if err != nil { + return nil, err + } + b.Count = model.FloatString(f) + if iter.ReadArray() { + return nil, errors.New("HistogramBucket has too many values, must be [boundaries, lower, upper, count]") + } + return &b, nil +} - stream.WriteRaw(`"`) +// marshalHistogramBucket writes something like: [ 3, "-0.25", "0.25", "3"] +// See marshalHistogram to understand what the numbers mean +func marshalHistogramBucket(b model.HistogramBucket, stream *json.Stream) { + stream.WriteArrayStart() + stream.WriteInt32(b.Boundaries) + stream.WriteMore() + marshalFloat(float64(b.Lower), stream) + stream.WriteMore() + marshalFloat(float64(b.Upper), stream) + stream.WriteMore() + marshalFloat(float64(b.Count), stream) stream.WriteArrayEnd() } -func marshalPointJSONIsEmpty(ptr unsafe.Pointer) bool { +// marshalHistogram writes something like: +// +// { +// "count": "42", +// "sum": "34593.34", +// "buckets": [ +// [ 3, "-0.25", "0.25", "3"], +// [ 0, "0.25", "0.5", "12"], +// [ 0, "0.5", "1", "21"], +// [ 0, "2", "4", "6"] +// ] +// } +// +// The 1st element in each bucket array determines if the boundaries are +// inclusive (AKA closed) or exclusive (AKA open): +// +// 0: lower exclusive, upper inclusive +// 1: lower inclusive, upper exclusive +// 2: both exclusive +// 3: both inclusive +// +// The 2nd and 3rd elements are the lower and upper boundary. The 4th element is +// the bucket count. +func marshalHistogram(h model.SampleHistogram, stream *json.Stream) { + stream.WriteObjectStart() + stream.WriteObjectField(`count`) + marshalFloat(float64(h.Count), stream) + stream.WriteMore() + stream.WriteObjectField(`sum`) + marshalFloat(float64(h.Sum), stream) + + bucketFound := false + for _, bucket := range h.Buckets { + if bucket.Count == 0 { + continue // No need to expose empty buckets in JSON. + } + stream.WriteMore() + if !bucketFound { + stream.WriteObjectField(`buckets`) + stream.WriteArrayStart() + } + bucketFound = true + marshalHistogramBucket(*bucket, stream) + } + if bucketFound { + stream.WriteArrayEnd() + } + stream.WriteObjectEnd() +} + +func marshalJSONIsEmpty(ptr unsafe.Pointer) bool { return false } @@ -650,7 +892,8 @@ func (h *httpAPI) Alerts(ctx context.Context) (AlertsResult, error) { } var res AlertsResult - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) AlertManagers(ctx context.Context) (AlertManagersResult, error) { @@ -667,7 +910,8 @@ func (h *httpAPI) AlertManagers(ctx context.Context) (AlertManagersResult, error } var res AlertManagersResult - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) CleanTombstones(ctx context.Context) error { @@ -696,7 +940,8 @@ func (h *httpAPI) Config(ctx context.Context) (ConfigResult, error) { } var res ConfigResult - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) DeleteSeries(ctx context.Context, matches []string, startTime, endTime time.Time) error { @@ -707,8 +952,12 @@ func (h *httpAPI) DeleteSeries(ctx context.Context, matches []string, startTime, q.Add("match[]", m) } - q.Set("start", formatTime(startTime)) - q.Set("end", formatTime(endTime)) + if !startTime.IsZero() { + q.Set("start", formatTime(startTime)) + } + if !endTime.IsZero() { + q.Set("end", formatTime(endTime)) + } u.RawQuery = q.Encode() @@ -735,7 +984,8 @@ func (h *httpAPI) Flags(ctx context.Context) (FlagsResult, error) { } var res FlagsResult - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) Buildinfo(ctx context.Context) (BuildinfoResult, error) { @@ -752,7 +1002,8 @@ func (h *httpAPI) Buildinfo(ctx context.Context) (BuildinfoResult, error) { } var res BuildinfoResult - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) Runtimeinfo(ctx context.Context) (RuntimeinfoResult, error) { @@ -769,37 +1020,41 @@ func (h *httpAPI) Runtimeinfo(ctx context.Context) (RuntimeinfoResult, error) { } var res RuntimeinfoResult - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) LabelNames(ctx context.Context, matches []string, startTime, endTime time.Time) ([]string, Warnings, error) { u := h.client.URL(epLabels, nil) q := u.Query() - q.Set("start", formatTime(startTime)) - q.Set("end", formatTime(endTime)) + if !startTime.IsZero() { + q.Set("start", formatTime(startTime)) + } + if !endTime.IsZero() { + q.Set("end", formatTime(endTime)) + } for _, m := range matches { q.Add("match[]", m) } - u.RawQuery = q.Encode() - - req, err := http.NewRequest(http.MethodGet, u.String(), nil) - if err != nil { - return nil, nil, err - } - _, body, w, err := h.client.Do(ctx, req) + _, body, w, err := h.client.DoGetFallback(ctx, u, q) if err != nil { return nil, w, err } var labelNames []string - return labelNames, w, json.Unmarshal(body, &labelNames) + err = json.Unmarshal(body, &labelNames) + return labelNames, w, err } func (h *httpAPI) LabelValues(ctx context.Context, label string, matches []string, startTime, endTime time.Time) (model.LabelValues, Warnings, error) { u := h.client.URL(epLabelValues, map[string]string{"name": label}) q := u.Query() - q.Set("start", formatTime(startTime)) - q.Set("end", formatTime(endTime)) + if !startTime.IsZero() { + q.Set("start", formatTime(startTime)) + } + if !endTime.IsZero() { + q.Set("end", formatTime(endTime)) + } for _, m := range matches { q.Add("match[]", m) } @@ -815,7 +1070,8 @@ func (h *httpAPI) LabelValues(ctx context.Context, label string, matches []strin return nil, w, err } var labelValues model.LabelValues - return labelValues, w, json.Unmarshal(body, &labelValues) + err = json.Unmarshal(body, &labelValues) + return labelValues, w, err } type apiOptions struct { @@ -897,23 +1153,21 @@ func (h *httpAPI) Series(ctx context.Context, matches []string, startTime, endTi q.Add("match[]", m) } - q.Set("start", formatTime(startTime)) - q.Set("end", formatTime(endTime)) - - u.RawQuery = q.Encode() - - req, err := http.NewRequest(http.MethodGet, u.String(), nil) - if err != nil { - return nil, nil, err + if !startTime.IsZero() { + q.Set("start", formatTime(startTime)) + } + if !endTime.IsZero() { + q.Set("end", formatTime(endTime)) } - _, body, warnings, err := h.client.Do(ctx, req) + _, body, warnings, err := h.client.DoGetFallback(ctx, u, q) if err != nil { return nil, warnings, err } var mset []model.LabelSet - return mset, warnings, json.Unmarshal(body, &mset) + err = json.Unmarshal(body, &mset) + return mset, warnings, err } func (h *httpAPI) Snapshot(ctx context.Context, skipHead bool) (SnapshotResult, error) { @@ -935,7 +1189,8 @@ func (h *httpAPI) Snapshot(ctx context.Context, skipHead bool) (SnapshotResult, } var res SnapshotResult - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) Rules(ctx context.Context) (RulesResult, error) { @@ -952,7 +1207,8 @@ func (h *httpAPI) Rules(ctx context.Context) (RulesResult, error) { } var res RulesResult - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) Targets(ctx context.Context) (TargetsResult, error) { @@ -969,7 +1225,8 @@ func (h *httpAPI) Targets(ctx context.Context) (TargetsResult, error) { } var res TargetsResult - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) TargetsMetadata(ctx context.Context, matchTarget, metric, limit string) ([]MetricMetadata, error) { @@ -993,7 +1250,8 @@ func (h *httpAPI) TargetsMetadata(ctx context.Context, matchTarget, metric, limi } var res []MetricMetadata - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) Metadata(ctx context.Context, metric, limit string) (map[string][]Metadata, error) { @@ -1016,7 +1274,8 @@ func (h *httpAPI) Metadata(ctx context.Context, metric, limit string) (map[strin } var res map[string][]Metadata - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) TSDB(ctx context.Context) (TSDBResult, error) { @@ -1033,7 +1292,8 @@ func (h *httpAPI) TSDB(ctx context.Context) (TSDBResult, error) { } var res TSDBResult - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) WalReplay(ctx context.Context) (WalReplayStatus, error) { @@ -1050,7 +1310,8 @@ func (h *httpAPI) WalReplay(ctx context.Context) (WalReplayStatus, error) { } var res WalReplayStatus - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } func (h *httpAPI) QueryExemplars(ctx context.Context, query string, startTime, endTime time.Time) ([]ExemplarQueryResult, error) { @@ -1058,22 +1319,21 @@ func (h *httpAPI) QueryExemplars(ctx context.Context, query string, startTime, e q := u.Query() q.Set("query", query) - q.Set("start", formatTime(startTime)) - q.Set("end", formatTime(endTime)) - u.RawQuery = q.Encode() - - req, err := http.NewRequest(http.MethodGet, u.String(), nil) - if err != nil { - return nil, err + if !startTime.IsZero() { + q.Set("start", formatTime(startTime)) + } + if !endTime.IsZero() { + q.Set("end", formatTime(endTime)) } - _, body, _, err := h.client.Do(ctx, req) + _, body, _, err := h.client.DoGetFallback(ctx, u, q) if err != nil { return nil, err } var res []ExemplarQueryResult - return res, json.Unmarshal(body, &res) + err = json.Unmarshal(body, &res) + return res, err } // Warnings is an array of non critical errors diff --git a/vendor/github.com/prometheus/client_golang/prometheus/collectors/go_collector_latest.go b/vendor/github.com/prometheus/client_golang/prometheus/collectors/go_collector_latest.go index 246c5ea943..2f5616894e 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/collectors/go_collector_latest.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/collectors/go_collector_latest.go @@ -28,6 +28,8 @@ var ( MetricsAll = GoRuntimeMetricsRule{regexp.MustCompile("/.*")} // MetricsGC allows only GC metrics to be collected from Go runtime. // e.g. go_gc_cycles_automatic_gc_cycles_total + // NOTE: This does not include new class of "/cpu/classes/gc/..." metrics. + // Use custom metric rule to access those. MetricsGC = GoRuntimeMetricsRule{regexp.MustCompile(`^/gc/.*`)} // MetricsMemory allows only memory metrics to be collected from Go runtime. // e.g. go_memory_classes_heap_free_bytes diff --git a/vendor/github.com/prometheus/client_golang/prometheus/counter.go b/vendor/github.com/prometheus/client_golang/prometheus/counter.go index a912b75a05..62de4dc59a 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/counter.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/counter.go @@ -59,6 +59,18 @@ type ExemplarAdder interface { // CounterOpts is an alias for Opts. See there for doc comments. type CounterOpts Opts +// CounterVecOpts bundles the options to create a CounterVec metric. +// It is mandatory to set CounterOpts, see there for mandatory fields. VariableLabels +// is optional and can safely be left to its default value. +type CounterVecOpts struct { + CounterOpts + + // VariableLabels are used to partition the metric vector by the given set + // of labels. Each label value will be constrained with the optional Contraint + // function, if provided. + VariableLabels ConstrainableLabels +} + // NewCounter creates a new Counter based on the provided CounterOpts. // // The returned implementation also implements ExemplarAdder. It is safe to @@ -174,16 +186,24 @@ type CounterVec struct { // NewCounterVec creates a new CounterVec based on the provided CounterOpts and // partitioned by the given label names. func NewCounterVec(opts CounterOpts, labelNames []string) *CounterVec { - desc := NewDesc( + return V2.NewCounterVec(CounterVecOpts{ + CounterOpts: opts, + VariableLabels: UnconstrainedLabels(labelNames), + }) +} + +// NewCounterVec creates a new CounterVec based on the provided CounterVecOpts. +func (v2) NewCounterVec(opts CounterVecOpts) *CounterVec { + desc := V2.NewDesc( BuildFQName(opts.Namespace, opts.Subsystem, opts.Name), opts.Help, - labelNames, + opts.VariableLabels, opts.ConstLabels, ) return &CounterVec{ MetricVec: NewMetricVec(desc, func(lvs ...string) Metric { if len(lvs) != len(desc.variableLabels) { - panic(makeInconsistentCardinalityError(desc.fqName, desc.variableLabels, lvs)) + panic(makeInconsistentCardinalityError(desc.fqName, desc.variableLabels.labelNames(), lvs)) } result := &counter{desc: desc, labelPairs: MakeLabelPairs(desc, lvs), now: time.Now} result.init(result) // Init self-collection. diff --git a/vendor/github.com/prometheus/client_golang/prometheus/desc.go b/vendor/github.com/prometheus/client_golang/prometheus/desc.go index 8bc5e44e2f..deedc2dfbe 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/desc.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/desc.go @@ -14,20 +14,16 @@ package prometheus import ( - "errors" "fmt" "sort" "strings" "github.com/cespare/xxhash/v2" - - "github.com/prometheus/client_golang/prometheus/internal" - - //nolint:staticcheck // Ignore SA1019. Need to keep deprecated package for compatibility. - "github.com/golang/protobuf/proto" + dto "github.com/prometheus/client_model/go" "github.com/prometheus/common/model" + "google.golang.org/protobuf/proto" - dto "github.com/prometheus/client_model/go" + "github.com/prometheus/client_golang/prometheus/internal" ) // Desc is the descriptor used by every Prometheus Metric. It is essentially @@ -54,9 +50,9 @@ type Desc struct { // constLabelPairs contains precalculated DTO label pairs based on // the constant labels. constLabelPairs []*dto.LabelPair - // variableLabels contains names of labels for which the metric - // maintains variable values. - variableLabels []string + // variableLabels contains names of labels and normalization function for + // which the metric maintains variable values. + variableLabels ConstrainedLabels // id is a hash of the values of the ConstLabels and fqName. This // must be unique among all registered descriptors and can therefore be // used as an identifier of the descriptor. @@ -80,10 +76,24 @@ type Desc struct { // For constLabels, the label values are constant. Therefore, they are fully // specified in the Desc. See the Collector example for a usage pattern. func NewDesc(fqName, help string, variableLabels []string, constLabels Labels) *Desc { + return V2.NewDesc(fqName, help, UnconstrainedLabels(variableLabels), constLabels) +} + +// NewDesc allocates and initializes a new Desc. Errors are recorded in the Desc +// and will be reported on registration time. variableLabels and constLabels can +// be nil if no such labels should be set. fqName must not be empty. +// +// variableLabels only contain the label names and normalization functions. Their +// label values are variable and therefore not part of the Desc. (They are managed +// within the Metric.) +// +// For constLabels, the label values are constant. Therefore, they are fully +// specified in the Desc. See the Collector example for a usage pattern. +func (v2) NewDesc(fqName, help string, variableLabels ConstrainableLabels, constLabels Labels) *Desc { d := &Desc{ fqName: fqName, help: help, - variableLabels: variableLabels, + variableLabels: variableLabels.constrainedLabels(), } if !model.IsValidMetricName(model.LabelValue(fqName)) { d.err = fmt.Errorf("%q is not a valid metric name", fqName) @@ -93,7 +103,7 @@ func NewDesc(fqName, help string, variableLabels []string, constLabels Labels) * // their sorted label names) plus the fqName (at position 0). labelValues := make([]string, 1, len(constLabels)+1) labelValues[0] = fqName - labelNames := make([]string, 0, len(constLabels)+len(variableLabels)) + labelNames := make([]string, 0, len(constLabels)+len(d.variableLabels)) labelNameSet := map[string]struct{}{} // First add only the const label names and sort them... for labelName := range constLabels { @@ -118,16 +128,16 @@ func NewDesc(fqName, help string, variableLabels []string, constLabels Labels) * // Now add the variable label names, but prefix them with something that // cannot be in a regular label name. That prevents matching the label // dimension with a different mix between preset and variable labels. - for _, labelName := range variableLabels { - if !checkLabelName(labelName) { - d.err = fmt.Errorf("%q is not a valid label name for metric %q", labelName, fqName) + for _, label := range d.variableLabels { + if !checkLabelName(label.Name) { + d.err = fmt.Errorf("%q is not a valid label name for metric %q", label.Name, fqName) return d } - labelNames = append(labelNames, "$"+labelName) - labelNameSet[labelName] = struct{}{} + labelNames = append(labelNames, "$"+label.Name) + labelNameSet[label.Name] = struct{}{} } if len(labelNames) != len(labelNameSet) { - d.err = errors.New("duplicate label names") + d.err = fmt.Errorf("duplicate label names in constant and variable labels for metric %q", fqName) return d } diff --git a/vendor/github.com/prometheus/client_golang/prometheus/doc.go b/vendor/github.com/prometheus/client_golang/prometheus/doc.go index 811072cbd5..962608f02c 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/doc.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/doc.go @@ -37,35 +37,35 @@ // // type metrics struct { // cpuTemp prometheus.Gauge -// hdFailures *prometheus.CounterVec +// hdFailures *prometheus.CounterVec // } // // func NewMetrics(reg prometheus.Registerer) *metrics { -// m := &metrics{ -// cpuTemp: prometheus.NewGauge(prometheus.GaugeOpts{ -// Name: "cpu_temperature_celsius", -// Help: "Current temperature of the CPU.", -// }), -// hdFailures: prometheus.NewCounterVec( -// prometheus.CounterOpts{ -// Name: "hd_errors_total", -// Help: "Number of hard-disk errors.", -// }, -// []string{"device"}, -// ), -// } -// reg.MustRegister(m.cpuTemp) -// reg.MustRegister(m.hdFailures) -// return m +// m := &metrics{ +// cpuTemp: prometheus.NewGauge(prometheus.GaugeOpts{ +// Name: "cpu_temperature_celsius", +// Help: "Current temperature of the CPU.", +// }), +// hdFailures: prometheus.NewCounterVec( +// prometheus.CounterOpts{ +// Name: "hd_errors_total", +// Help: "Number of hard-disk errors.", +// }, +// []string{"device"}, +// ), +// } +// reg.MustRegister(m.cpuTemp) +// reg.MustRegister(m.hdFailures) +// return m // } // // func main() { -// // Create a non-global registry. -// reg := prometheus.NewRegistry() +// // Create a non-global registry. +// reg := prometheus.NewRegistry() // -// // Create new metrics and register them using the custom registry. -// m := NewMetrics(reg) -// // Set values for the new created metrics. +// // Create new metrics and register them using the custom registry. +// m := NewMetrics(reg) +// // Set values for the new created metrics. // m.cpuTemp.Set(65.3) // m.hdFailures.With(prometheus.Labels{"device":"/dev/sda"}).Inc() // diff --git a/vendor/github.com/prometheus/client_golang/prometheus/gauge.go b/vendor/github.com/prometheus/client_golang/prometheus/gauge.go index 21271a5bb4..f1ea6c76f7 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/gauge.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/gauge.go @@ -55,6 +55,18 @@ type Gauge interface { // GaugeOpts is an alias for Opts. See there for doc comments. type GaugeOpts Opts +// GaugeVecOpts bundles the options to create a GaugeVec metric. +// It is mandatory to set GaugeOpts, see there for mandatory fields. VariableLabels +// is optional and can safely be left to its default value. +type GaugeVecOpts struct { + GaugeOpts + + // VariableLabels are used to partition the metric vector by the given set + // of labels. Each label value will be constrained with the optional Contraint + // function, if provided. + VariableLabels ConstrainableLabels +} + // NewGauge creates a new Gauge based on the provided GaugeOpts. // // The returned implementation is optimized for a fast Set method. If you have a @@ -138,16 +150,24 @@ type GaugeVec struct { // NewGaugeVec creates a new GaugeVec based on the provided GaugeOpts and // partitioned by the given label names. func NewGaugeVec(opts GaugeOpts, labelNames []string) *GaugeVec { - desc := NewDesc( + return V2.NewGaugeVec(GaugeVecOpts{ + GaugeOpts: opts, + VariableLabels: UnconstrainedLabels(labelNames), + }) +} + +// NewGaugeVec creates a new GaugeVec based on the provided GaugeVecOpts. +func (v2) NewGaugeVec(opts GaugeVecOpts) *GaugeVec { + desc := V2.NewDesc( BuildFQName(opts.Namespace, opts.Subsystem, opts.Name), opts.Help, - labelNames, + opts.VariableLabels, opts.ConstLabels, ) return &GaugeVec{ MetricVec: NewMetricVec(desc, func(lvs ...string) Metric { if len(lvs) != len(desc.variableLabels) { - panic(makeInconsistentCardinalityError(desc.fqName, desc.variableLabels, lvs)) + panic(makeInconsistentCardinalityError(desc.fqName, desc.variableLabels.labelNames(), lvs)) } result := &gauge{desc: desc, labelPairs: MakeLabelPairs(desc, lvs)} result.init(result) // Init self-collection. diff --git a/vendor/github.com/prometheus/client_golang/prometheus/go_collector_latest.go b/vendor/github.com/prometheus/client_golang/prometheus/go_collector_latest.go index 3a2d55e84b..2d8d9f64f4 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/go_collector_latest.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/go_collector_latest.go @@ -23,11 +23,10 @@ import ( "strings" "sync" - //nolint:staticcheck // Ignore SA1019. Need to keep deprecated package for compatibility. - "github.com/golang/protobuf/proto" - dto "github.com/prometheus/client_model/go" - "github.com/prometheus/client_golang/prometheus/internal" + + dto "github.com/prometheus/client_model/go" + "google.golang.org/protobuf/proto" ) const ( diff --git a/vendor/github.com/prometheus/client_golang/prometheus/histogram.go b/vendor/github.com/prometheus/client_golang/prometheus/histogram.go index 4c873a01c3..8d818afe90 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/histogram.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/histogram.go @@ -22,10 +22,9 @@ import ( "sync/atomic" "time" - //nolint:staticcheck // Ignore SA1019. Need to keep deprecated package for compatibility. - "github.com/golang/protobuf/proto" - dto "github.com/prometheus/client_model/go" + + "google.golang.org/protobuf/proto" ) // nativeHistogramBounds for the frac of observed values. Only relevant for @@ -402,7 +401,7 @@ type HistogramOpts struct { // Histogram by a Prometheus server with that feature enabled (requires // Prometheus v2.40+). Sparse buckets are exponential buckets covering // the whole float64 range (with the exception of the “zero” bucket, see - // SparseBucketsZeroThreshold below). From any one bucket to the next, + // NativeHistogramZeroThreshold below). From any one bucket to the next, // the width of the bucket grows by a constant // factor. NativeHistogramBucketFactor provides an upper bound for this // factor (exception see below). The smaller @@ -433,7 +432,7 @@ type HistogramOpts struct { // bucket. For best results, this should be close to a bucket // boundary. This is usually the case if picking a power of two. If // NativeHistogramZeroThreshold is left at zero, - // DefSparseBucketsZeroThreshold is used as the threshold. To configure + // DefNativeHistogramZeroThreshold is used as the threshold. To configure // a zero bucket with an actual threshold of zero (i.e. only // observations of precisely zero will go into the zero bucket), set // NativeHistogramZeroThreshold to the NativeHistogramZeroThresholdZero @@ -469,6 +468,18 @@ type HistogramOpts struct { NativeHistogramMaxZeroThreshold float64 } +// HistogramVecOpts bundles the options to create a HistogramVec metric. +// It is mandatory to set HistogramOpts, see there for mandatory fields. VariableLabels +// is optional and can safely be left to its default value. +type HistogramVecOpts struct { + HistogramOpts + + // VariableLabels are used to partition the metric vector by the given set + // of labels. Each label value will be constrained with the optional Contraint + // function, if provided. + VariableLabels ConstrainableLabels +} + // NewHistogram creates a new Histogram based on the provided HistogramOpts. It // panics if the buckets in HistogramOpts are not in strictly increasing order. // @@ -489,11 +500,11 @@ func NewHistogram(opts HistogramOpts) Histogram { func newHistogram(desc *Desc, opts HistogramOpts, labelValues ...string) Histogram { if len(desc.variableLabels) != len(labelValues) { - panic(makeInconsistentCardinalityError(desc.fqName, desc.variableLabels, labelValues)) + panic(makeInconsistentCardinalityError(desc.fqName, desc.variableLabels.labelNames(), labelValues)) } for _, n := range desc.variableLabels { - if n == bucketLabel { + if n.Name == bucketLabel { panic(errBucketLabelNotAllowed) } } @@ -544,16 +555,12 @@ func newHistogram(desc *Desc, opts HistogramOpts, labelValues ...string) Histogr } // Finally we know the final length of h.upperBounds and can make buckets // for both counts as well as exemplars: - h.counts[0] = &histogramCounts{ - buckets: make([]uint64, len(h.upperBounds)), - nativeHistogramZeroThresholdBits: math.Float64bits(h.nativeHistogramZeroThreshold), - nativeHistogramSchema: h.nativeHistogramSchema, - } - h.counts[1] = &histogramCounts{ - buckets: make([]uint64, len(h.upperBounds)), - nativeHistogramZeroThresholdBits: math.Float64bits(h.nativeHistogramZeroThreshold), - nativeHistogramSchema: h.nativeHistogramSchema, - } + h.counts[0] = &histogramCounts{buckets: make([]uint64, len(h.upperBounds))} + atomic.StoreUint64(&h.counts[0].nativeHistogramZeroThresholdBits, math.Float64bits(h.nativeHistogramZeroThreshold)) + atomic.StoreInt32(&h.counts[0].nativeHistogramSchema, h.nativeHistogramSchema) + h.counts[1] = &histogramCounts{buckets: make([]uint64, len(h.upperBounds))} + atomic.StoreUint64(&h.counts[1].nativeHistogramZeroThresholdBits, math.Float64bits(h.nativeHistogramZeroThreshold)) + atomic.StoreInt32(&h.counts[1].nativeHistogramSchema, h.nativeHistogramSchema) h.exemplars = make([]atomic.Value, len(h.upperBounds)+1) h.init(h) // Init self-collection. @@ -632,8 +639,8 @@ func (hc *histogramCounts) observe(v float64, bucket int, doSparse bool) { if frac == 0.5 { key-- } - div := 1 << -schema - key = (key + div - 1) / div + offset := (1 << -schema) - 1 + key = (key + offset) >> -schema } if isInf { key++ @@ -810,7 +817,7 @@ func (h *histogram) observe(v float64, bucket int) { } } -// limitSparsebuckets applies a strategy to limit the number of populated sparse +// limitBuckets applies a strategy to limit the number of populated sparse // buckets. It's generally best effort, and there are situations where the // number can go higher (if even the lowest resolution isn't enough to reduce // the number sufficiently, or if the provided counts aren't fully updated yet @@ -1034,15 +1041,23 @@ type HistogramVec struct { // NewHistogramVec creates a new HistogramVec based on the provided HistogramOpts and // partitioned by the given label names. func NewHistogramVec(opts HistogramOpts, labelNames []string) *HistogramVec { - desc := NewDesc( + return V2.NewHistogramVec(HistogramVecOpts{ + HistogramOpts: opts, + VariableLabels: UnconstrainedLabels(labelNames), + }) +} + +// NewHistogramVec creates a new HistogramVec based on the provided HistogramVecOpts. +func (v2) NewHistogramVec(opts HistogramVecOpts) *HistogramVec { + desc := V2.NewDesc( BuildFQName(opts.Namespace, opts.Subsystem, opts.Name), opts.Help, - labelNames, + opts.VariableLabels, opts.ConstLabels, ) return &HistogramVec{ MetricVec: NewMetricVec(desc, func(lvs ...string) Metric { - return newHistogram(desc, opts, lvs...) + return newHistogram(desc, opts.HistogramOpts, lvs...) }), } } diff --git a/vendor/github.com/prometheus/client_golang/prometheus/labels.go b/vendor/github.com/prometheus/client_golang/prometheus/labels.go index c1b8fad36a..63ff8683ce 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/labels.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/labels.go @@ -32,6 +32,78 @@ import ( // create a Desc. type Labels map[string]string +// ConstrainedLabels represents a label name and its constrain function +// to normalize label values. This type is commonly used when constructing +// metric vector Collectors. +type ConstrainedLabel struct { + Name string + Constraint func(string) string +} + +func (cl ConstrainedLabel) Constrain(v string) string { + if cl.Constraint == nil { + return v + } + return cl.Constraint(v) +} + +// ConstrainableLabels is an interface that allows creating of labels that can +// be optionally constrained. +// +// prometheus.V2().NewCounterVec(CounterVecOpts{ +// CounterOpts: {...}, // Usual CounterOpts fields +// VariableLabels: []ConstrainedLabels{ +// {Name: "A"}, +// {Name: "B", Constraint: func(v string) string { ... }}, +// }, +// }) +type ConstrainableLabels interface { + constrainedLabels() ConstrainedLabels + labelNames() []string +} + +// ConstrainedLabels represents a collection of label name -> constrain function +// to normalize label values. This type is commonly used when constructing +// metric vector Collectors. +type ConstrainedLabels []ConstrainedLabel + +func (cls ConstrainedLabels) constrainedLabels() ConstrainedLabels { + return cls +} + +func (cls ConstrainedLabels) labelNames() []string { + names := make([]string, len(cls)) + for i, label := range cls { + names[i] = label.Name + } + return names +} + +// UnconstrainedLabels represents collection of label without any constraint on +// their value. Thus, it is simply a collection of label names. +// +// UnconstrainedLabels([]string{ "A", "B" }) +// +// is equivalent to +// +// ConstrainedLabels { +// { Name: "A" }, +// { Name: "B" }, +// } +type UnconstrainedLabels []string + +func (uls UnconstrainedLabels) constrainedLabels() ConstrainedLabels { + constrainedLabels := make([]ConstrainedLabel, len(uls)) + for i, l := range uls { + constrainedLabels[i] = ConstrainedLabel{Name: l} + } + return constrainedLabels +} + +func (uls UnconstrainedLabels) labelNames() []string { + return uls +} + // reservedLabelPrefix is a prefix which is not legal in user-supplied // label names. const reservedLabelPrefix = "__" diff --git a/vendor/github.com/prometheus/client_golang/prometheus/metric.go b/vendor/github.com/prometheus/client_golang/prometheus/metric.go index b5119c5041..07bbc9d768 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/metric.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/metric.go @@ -20,11 +20,9 @@ import ( "strings" "time" - //nolint:staticcheck // Ignore SA1019. Need to keep deprecated package for compatibility. - "github.com/golang/protobuf/proto" - "github.com/prometheus/common/model" - dto "github.com/prometheus/client_model/go" + "github.com/prometheus/common/model" + "google.golang.org/protobuf/proto" ) var separatorByteSlice = []byte{model.SeparatorByte} // For convenient use with xxhash. diff --git a/vendor/github.com/prometheus/client_golang/prometheus/promauto/auto.go b/vendor/github.com/prometheus/client_golang/prometheus/promauto/auto.go index 8031e87042..fa90115921 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/promauto/auto.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/promauto/auto.go @@ -28,30 +28,30 @@ // package main // // import ( -// "math/rand" -// "net/http" +// "math/rand" +// "net/http" // -// "github.com/prometheus/client_golang/prometheus" -// "github.com/prometheus/client_golang/prometheus/promauto" -// "github.com/prometheus/client_golang/prometheus/promhttp" +// "github.com/prometheus/client_golang/prometheus" +// "github.com/prometheus/client_golang/prometheus/promauto" +// "github.com/prometheus/client_golang/prometheus/promhttp" // ) // // var histogram = promauto.NewHistogram(prometheus.HistogramOpts{ -// Name: "random_numbers", -// Help: "A histogram of normally distributed random numbers.", -// Buckets: prometheus.LinearBuckets(-3, .1, 61), +// Name: "random_numbers", +// Help: "A histogram of normally distributed random numbers.", +// Buckets: prometheus.LinearBuckets(-3, .1, 61), // }) // // func Random() { -// for { -// histogram.Observe(rand.NormFloat64()) -// } +// for { +// histogram.Observe(rand.NormFloat64()) +// } // } // // func main() { -// go Random() -// http.Handle("/metrics", promhttp.Handler()) -// http.ListenAndServe(":1971", nil) +// go Random() +// http.Handle("/metrics", promhttp.Handler()) +// http.ListenAndServe(":1971", nil) // } // // Prometheus's version of a minimal hello-world program: diff --git a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go index a4cc9810b0..09b8d2fbea 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go @@ -37,6 +37,7 @@ import ( "fmt" "io" "net/http" + "strconv" "strings" "sync" "time" @@ -47,9 +48,10 @@ import ( ) const ( - contentTypeHeader = "Content-Type" - contentEncodingHeader = "Content-Encoding" - acceptEncodingHeader = "Accept-Encoding" + contentTypeHeader = "Content-Type" + contentEncodingHeader = "Content-Encoding" + acceptEncodingHeader = "Accept-Encoding" + processStartTimeHeader = "Process-Start-Time-Unix" ) var gzipPool = sync.Pool{ @@ -121,6 +123,9 @@ func HandlerForTransactional(reg prometheus.TransactionalGatherer, opts HandlerO } h := http.HandlerFunc(func(rsp http.ResponseWriter, req *http.Request) { + if !opts.ProcessStartTime.IsZero() { + rsp.Header().Set(processStartTimeHeader, strconv.FormatInt(opts.ProcessStartTime.Unix(), 10)) + } if inFlightSem != nil { select { case inFlightSem <- struct{}{}: // All good, carry on. @@ -366,6 +371,14 @@ type HandlerOpts struct { // (which changes the identity of the resulting series on the Prometheus // server). EnableOpenMetrics bool + // ProcessStartTime allows setting process start timevalue that will be exposed + // with "Process-Start-Time-Unix" response header along with the metrics + // payload. This allow callers to have efficient transformations to cumulative + // counters (e.g. OpenTelemetry) or generally _created timestamp estimation per + // scrape target. + // NOTE: This feature is experimental and not covered by OpenMetrics or Prometheus + // exposition format. + ProcessStartTime time.Time } // gzipAccepted returns whether the client will accept gzip-encoded content. diff --git a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/instrument_client.go b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/instrument_client.go index 2108678162..d3482c40ca 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/instrument_client.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/instrument_client.go @@ -68,16 +68,17 @@ func InstrumentRoundTripperCounter(counter *prometheus.CounterVec, next http.Rou o.apply(rtOpts) } - code, method := checkLabels(counter) + // Curry the counter with dynamic labels before checking the remaining labels. + code, method := checkLabels(counter.MustCurryWith(rtOpts.emptyDynamicLabels())) return func(r *http.Request) (*http.Response, error) { resp, err := next.RoundTrip(r) if err == nil { - addWithExemplar( - counter.With(labels(code, method, r.Method, resp.StatusCode, rtOpts.extraMethods...)), - 1, - rtOpts.getExemplarFn(r.Context()), - ) + l := labels(code, method, r.Method, resp.StatusCode, rtOpts.extraMethods...) + for label, resolve := range rtOpts.extraLabelsFromCtx { + l[label] = resolve(resp.Request.Context()) + } + addWithExemplar(counter.With(l), 1, rtOpts.getExemplarFn(r.Context())) } return resp, err } @@ -110,17 +111,18 @@ func InstrumentRoundTripperDuration(obs prometheus.ObserverVec, next http.RoundT o.apply(rtOpts) } - code, method := checkLabels(obs) + // Curry the observer with dynamic labels before checking the remaining labels. + code, method := checkLabels(obs.MustCurryWith(rtOpts.emptyDynamicLabels())) return func(r *http.Request) (*http.Response, error) { start := time.Now() resp, err := next.RoundTrip(r) if err == nil { - observeWithExemplar( - obs.With(labels(code, method, r.Method, resp.StatusCode, rtOpts.extraMethods...)), - time.Since(start).Seconds(), - rtOpts.getExemplarFn(r.Context()), - ) + l := labels(code, method, r.Method, resp.StatusCode, rtOpts.extraMethods...) + for label, resolve := range rtOpts.extraLabelsFromCtx { + l[label] = resolve(resp.Request.Context()) + } + observeWithExemplar(obs.With(l), time.Since(start).Seconds(), rtOpts.getExemplarFn(r.Context())) } return resp, err } diff --git a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/instrument_server.go b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/instrument_server.go index cca67a78a9..3793036ad0 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/instrument_server.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/instrument_server.go @@ -87,7 +87,8 @@ func InstrumentHandlerDuration(obs prometheus.ObserverVec, next http.Handler, op o.apply(hOpts) } - code, method := checkLabels(obs) + // Curry the observer with dynamic labels before checking the remaining labels. + code, method := checkLabels(obs.MustCurryWith(hOpts.emptyDynamicLabels())) if code { return func(w http.ResponseWriter, r *http.Request) { @@ -95,23 +96,22 @@ func InstrumentHandlerDuration(obs prometheus.ObserverVec, next http.Handler, op d := newDelegator(w, nil) next.ServeHTTP(d, r) - observeWithExemplar( - obs.With(labels(code, method, r.Method, d.Status(), hOpts.extraMethods...)), - time.Since(now).Seconds(), - hOpts.getExemplarFn(r.Context()), - ) + l := labels(code, method, r.Method, d.Status(), hOpts.extraMethods...) + for label, resolve := range hOpts.extraLabelsFromCtx { + l[label] = resolve(r.Context()) + } + observeWithExemplar(obs.With(l), time.Since(now).Seconds(), hOpts.getExemplarFn(r.Context())) } } return func(w http.ResponseWriter, r *http.Request) { now := time.Now() next.ServeHTTP(w, r) - - observeWithExemplar( - obs.With(labels(code, method, r.Method, 0, hOpts.extraMethods...)), - time.Since(now).Seconds(), - hOpts.getExemplarFn(r.Context()), - ) + l := labels(code, method, r.Method, 0, hOpts.extraMethods...) + for label, resolve := range hOpts.extraLabelsFromCtx { + l[label] = resolve(r.Context()) + } + observeWithExemplar(obs.With(l), time.Since(now).Seconds(), hOpts.getExemplarFn(r.Context())) } } @@ -138,28 +138,30 @@ func InstrumentHandlerCounter(counter *prometheus.CounterVec, next http.Handler, o.apply(hOpts) } - code, method := checkLabels(counter) + // Curry the counter with dynamic labels before checking the remaining labels. + code, method := checkLabels(counter.MustCurryWith(hOpts.emptyDynamicLabels())) if code { return func(w http.ResponseWriter, r *http.Request) { d := newDelegator(w, nil) next.ServeHTTP(d, r) - addWithExemplar( - counter.With(labels(code, method, r.Method, d.Status(), hOpts.extraMethods...)), - 1, - hOpts.getExemplarFn(r.Context()), - ) + l := labels(code, method, r.Method, d.Status(), hOpts.extraMethods...) + for label, resolve := range hOpts.extraLabelsFromCtx { + l[label] = resolve(r.Context()) + } + addWithExemplar(counter.With(l), 1, hOpts.getExemplarFn(r.Context())) } } return func(w http.ResponseWriter, r *http.Request) { next.ServeHTTP(w, r) - addWithExemplar( - counter.With(labels(code, method, r.Method, 0, hOpts.extraMethods...)), - 1, - hOpts.getExemplarFn(r.Context()), - ) + + l := labels(code, method, r.Method, 0, hOpts.extraMethods...) + for label, resolve := range hOpts.extraLabelsFromCtx { + l[label] = resolve(r.Context()) + } + addWithExemplar(counter.With(l), 1, hOpts.getExemplarFn(r.Context())) } } @@ -191,16 +193,17 @@ func InstrumentHandlerTimeToWriteHeader(obs prometheus.ObserverVec, next http.Ha o.apply(hOpts) } - code, method := checkLabels(obs) + // Curry the observer with dynamic labels before checking the remaining labels. + code, method := checkLabels(obs.MustCurryWith(hOpts.emptyDynamicLabels())) return func(w http.ResponseWriter, r *http.Request) { now := time.Now() d := newDelegator(w, func(status int) { - observeWithExemplar( - obs.With(labels(code, method, r.Method, status, hOpts.extraMethods...)), - time.Since(now).Seconds(), - hOpts.getExemplarFn(r.Context()), - ) + l := labels(code, method, r.Method, status, hOpts.extraMethods...) + for label, resolve := range hOpts.extraLabelsFromCtx { + l[label] = resolve(r.Context()) + } + observeWithExemplar(obs.With(l), time.Since(now).Seconds(), hOpts.getExemplarFn(r.Context())) }) next.ServeHTTP(d, r) } @@ -231,28 +234,32 @@ func InstrumentHandlerRequestSize(obs prometheus.ObserverVec, next http.Handler, o.apply(hOpts) } - code, method := checkLabels(obs) + // Curry the observer with dynamic labels before checking the remaining labels. + code, method := checkLabels(obs.MustCurryWith(hOpts.emptyDynamicLabels())) + if code { return func(w http.ResponseWriter, r *http.Request) { d := newDelegator(w, nil) next.ServeHTTP(d, r) size := computeApproximateRequestSize(r) - observeWithExemplar( - obs.With(labels(code, method, r.Method, d.Status(), hOpts.extraMethods...)), - float64(size), - hOpts.getExemplarFn(r.Context()), - ) + + l := labels(code, method, r.Method, d.Status(), hOpts.extraMethods...) + for label, resolve := range hOpts.extraLabelsFromCtx { + l[label] = resolve(r.Context()) + } + observeWithExemplar(obs.With(l), float64(size), hOpts.getExemplarFn(r.Context())) } } return func(w http.ResponseWriter, r *http.Request) { next.ServeHTTP(w, r) size := computeApproximateRequestSize(r) - observeWithExemplar( - obs.With(labels(code, method, r.Method, 0, hOpts.extraMethods...)), - float64(size), - hOpts.getExemplarFn(r.Context()), - ) + + l := labels(code, method, r.Method, 0, hOpts.extraMethods...) + for label, resolve := range hOpts.extraLabelsFromCtx { + l[label] = resolve(r.Context()) + } + observeWithExemplar(obs.With(l), float64(size), hOpts.getExemplarFn(r.Context())) } } @@ -281,16 +288,18 @@ func InstrumentHandlerResponseSize(obs prometheus.ObserverVec, next http.Handler o.apply(hOpts) } - code, method := checkLabels(obs) + // Curry the observer with dynamic labels before checking the remaining labels. + code, method := checkLabels(obs.MustCurryWith(hOpts.emptyDynamicLabels())) return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { d := newDelegator(w, nil) next.ServeHTTP(d, r) - observeWithExemplar( - obs.With(labels(code, method, r.Method, d.Status(), hOpts.extraMethods...)), - float64(d.Written()), - hOpts.getExemplarFn(r.Context()), - ) + + l := labels(code, method, r.Method, d.Status(), hOpts.extraMethods...) + for label, resolve := range hOpts.extraLabelsFromCtx { + l[label] = resolve(r.Context()) + } + observeWithExemplar(obs.With(l), float64(d.Written()), hOpts.getExemplarFn(r.Context())) }) } diff --git a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/option.go b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/option.go index c590d912c9..5d4383aa14 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/option.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/option.go @@ -24,14 +24,32 @@ type Option interface { apply(*options) } +// LabelValueFromCtx are used to compute the label value from request context. +// Context can be filled with values from request through middleware. +type LabelValueFromCtx func(ctx context.Context) string + // options store options for both a handler or round tripper. type options struct { - extraMethods []string - getExemplarFn func(requestCtx context.Context) prometheus.Labels + extraMethods []string + getExemplarFn func(requestCtx context.Context) prometheus.Labels + extraLabelsFromCtx map[string]LabelValueFromCtx } func defaultOptions() *options { - return &options{getExemplarFn: func(ctx context.Context) prometheus.Labels { return nil }} + return &options{ + getExemplarFn: func(ctx context.Context) prometheus.Labels { return nil }, + extraLabelsFromCtx: map[string]LabelValueFromCtx{}, + } +} + +func (o *options) emptyDynamicLabels() prometheus.Labels { + labels := prometheus.Labels{} + + for label := range o.extraLabelsFromCtx { + labels[label] = "" + } + + return labels } type optionApplyFunc func(*options) @@ -48,11 +66,19 @@ func WithExtraMethods(methods ...string) Option { }) } -// WithExemplarFromContext adds allows to put a hook to all counter and histogram metrics. -// If the hook function returns non-nil labels, exemplars will be added for that request, otherwise metric -// will get instrumented without exemplar. +// WithExemplarFromContext allows to inject function that will get exemplar from context that will be put to counter and histogram metrics. +// If the function returns nil labels or the metric does not support exemplars, no exemplar will be added (noop), but +// metric will continue to observe/increment. func WithExemplarFromContext(getExemplarFn func(requestCtx context.Context) prometheus.Labels) Option { return optionApplyFunc(func(o *options) { o.getExemplarFn = getExemplarFn }) } + +// WithLabelFromCtx registers a label for dynamic resolution with access to context. +// See the example for ExampleInstrumentHandlerWithLabelResolver for example usage +func WithLabelFromCtx(name string, valueFn LabelValueFromCtx) Option { + return optionApplyFunc(func(o *options) { + o.extraLabelsFromCtx[name] = valueFn + }) +} diff --git a/vendor/github.com/prometheus/client_golang/prometheus/registry.go b/vendor/github.com/prometheus/client_golang/prometheus/registry.go index 09e34d307c..44da9433be 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/registry.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/registry.go @@ -21,18 +21,17 @@ import ( "path/filepath" "runtime" "sort" + "strconv" "strings" "sync" "unicode/utf8" - "github.com/cespare/xxhash/v2" - //nolint:staticcheck // Ignore SA1019. Need to keep deprecated package for compatibility. - "github.com/golang/protobuf/proto" - "github.com/prometheus/common/expfmt" + "github.com/prometheus/client_golang/prometheus/internal" + "github.com/cespare/xxhash/v2" dto "github.com/prometheus/client_model/go" - - "github.com/prometheus/client_golang/prometheus/internal" + "github.com/prometheus/common/expfmt" + "google.golang.org/protobuf/proto" ) const ( @@ -933,6 +932,10 @@ func checkMetricConsistency( h.WriteString(lp.GetValue()) h.Write(separatorByteSlice) } + if dtoMetric.TimestampMs != nil { + h.WriteString(strconv.FormatInt(*(dtoMetric.TimestampMs), 10)) + h.Write(separatorByteSlice) + } hSum := h.Sum64() if _, exists := metricHashes[hSum]; exists { return fmt.Errorf( @@ -962,7 +965,7 @@ func checkDescConsistency( copy(lpsFromDesc, desc.constLabelPairs) for _, l := range desc.variableLabels { lpsFromDesc = append(lpsFromDesc, &dto.LabelPair{ - Name: proto.String(l), + Name: proto.String(l.Name), }) } if len(lpsFromDesc) != len(dtoMetric.Label) { diff --git a/vendor/github.com/prometheus/client_golang/prometheus/summary.go b/vendor/github.com/prometheus/client_golang/prometheus/summary.go index 7bc448a893..dd359264e5 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/summary.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/summary.go @@ -22,11 +22,10 @@ import ( "sync/atomic" "time" - "github.com/beorn7/perks/quantile" - //nolint:staticcheck // Ignore SA1019. Need to keep deprecated package for compatibility. - "github.com/golang/protobuf/proto" - dto "github.com/prometheus/client_model/go" + + "github.com/beorn7/perks/quantile" + "google.golang.org/protobuf/proto" ) // quantileLabel is used for the label that defines the quantile in a @@ -148,6 +147,18 @@ type SummaryOpts struct { BufCap uint32 } +// SummaryVecOpts bundles the options to create a SummaryVec metric. +// It is mandatory to set SummaryOpts, see there for mandatory fields. VariableLabels +// is optional and can safely be left to its default value. +type SummaryVecOpts struct { + SummaryOpts + + // VariableLabels are used to partition the metric vector by the given set + // of labels. Each label value will be constrained with the optional Contraint + // function, if provided. + VariableLabels ConstrainableLabels +} + // Problem with the sliding-window decay algorithm... The Merge method of // perk/quantile is actually not working as advertised - and it might be // unfixable, as the underlying algorithm is apparently not capable of merging @@ -178,11 +189,11 @@ func NewSummary(opts SummaryOpts) Summary { func newSummary(desc *Desc, opts SummaryOpts, labelValues ...string) Summary { if len(desc.variableLabels) != len(labelValues) { - panic(makeInconsistentCardinalityError(desc.fqName, desc.variableLabels, labelValues)) + panic(makeInconsistentCardinalityError(desc.fqName, desc.variableLabels.labelNames(), labelValues)) } for _, n := range desc.variableLabels { - if n == quantileLabel { + if n.Name == quantileLabel { panic(errQuantileLabelNotAllowed) } } @@ -530,20 +541,28 @@ type SummaryVec struct { // it is handled by the Prometheus server internally, “quantile” is an illegal // label name. NewSummaryVec will panic if this label name is used. func NewSummaryVec(opts SummaryOpts, labelNames []string) *SummaryVec { - for _, ln := range labelNames { + return V2.NewSummaryVec(SummaryVecOpts{ + SummaryOpts: opts, + VariableLabels: UnconstrainedLabels(labelNames), + }) +} + +// NewSummaryVec creates a new SummaryVec based on the provided SummaryVecOpts. +func (v2) NewSummaryVec(opts SummaryVecOpts) *SummaryVec { + for _, ln := range opts.VariableLabels.labelNames() { if ln == quantileLabel { panic(errQuantileLabelNotAllowed) } } - desc := NewDesc( + desc := V2.NewDesc( BuildFQName(opts.Namespace, opts.Subsystem, opts.Name), opts.Help, - labelNames, + opts.VariableLabels, opts.ConstLabels, ) return &SummaryVec{ MetricVec: NewMetricVec(desc, func(lvs ...string) Metric { - return newSummary(desc, opts, lvs...) + return newSummary(desc, opts.SummaryOpts, lvs...) }), } } diff --git a/vendor/github.com/prometheus/client_golang/prometheus/testutil/promlint/promlint.go b/vendor/github.com/prometheus/client_golang/prometheus/testutil/promlint/promlint.go index a20f159b78..c8864b6c3f 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/testutil/promlint/promlint.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/testutil/promlint/promlint.go @@ -287,17 +287,15 @@ func lintUnitAbbreviations(mf *dto.MetricFamily) []Problem { func metricUnits(m string) (unit, base string, ok bool) { ss := strings.Split(m, "_") - for unit, base := range units { - // Also check for "no prefix". - for _, p := range append(unitPrefixes, "") { - for _, s := range ss { - // Attempt to explicitly match a known unit with a known prefix, - // as some words may look like "units" when matching suffix. - // - // As an example, "thermometers" should not match "meters", but - // "kilometers" should. - if s == p+unit { - return p + unit, base, true + for _, s := range ss { + if base, found := units[s]; found { + return s, base, true + } + + for _, p := range unitPrefixes { + if strings.HasPrefix(s, p) { + if base, found := units[s[len(p):]]; found { + return s, base, true } } } diff --git a/vendor/github.com/prometheus/client_golang/prometheus/testutil/testutil.go b/vendor/github.com/prometheus/client_golang/prometheus/testutil/testutil.go index 91b83b5285..82d4a5436b 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/testutil/testutil.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/testutil/testutil.go @@ -238,6 +238,7 @@ func convertReaderToMetricFamily(reader io.Reader) ([]*dto.MetricFamily, error) func compareMetricFamilies(got, expected []*dto.MetricFamily, metricNames ...string) error { if metricNames != nil { got = filterMetrics(got, metricNames) + expected = filterMetrics(expected, metricNames) } return compare(got, expected) diff --git a/vendor/github.com/prometheus/client_golang/prometheus/timer.go b/vendor/github.com/prometheus/client_golang/prometheus/timer.go index f28a76f3a6..52344fef53 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/timer.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/timer.go @@ -23,7 +23,9 @@ type Timer struct { } // NewTimer creates a new Timer. The provided Observer is used to observe a -// duration in seconds. Timer is usually used to time a function call in the +// duration in seconds. If the Observer implements ExemplarObserver, passing exemplar +// later on will be also supported. +// Timer is usually used to time a function call in the // following way: // // func TimeMe() { @@ -31,6 +33,14 @@ type Timer struct { // defer timer.ObserveDuration() // // Do actual work. // } +// +// or +// +// func TimeMeWithExemplar() { +// timer := NewTimer(myHistogram) +// defer timer.ObserveDurationWithExemplar(exemplar) +// // Do actual work. +// } func NewTimer(o Observer) *Timer { return &Timer{ begin: time.Now(), @@ -53,3 +63,19 @@ func (t *Timer) ObserveDuration() time.Duration { } return d } + +// ObserveDurationWithExemplar is like ObserveDuration, but it will also +// observe exemplar with the duration unless exemplar is nil or provided Observer can't +// be casted to ExemplarObserver. +func (t *Timer) ObserveDurationWithExemplar(exemplar Labels) time.Duration { + d := time.Since(t.begin) + eo, ok := t.observer.(ExemplarObserver) + if ok && exemplar != nil { + eo.ObserveWithExemplar(d.Seconds(), exemplar) + return d + } + if t.observer != nil { + t.observer.Observe(d.Seconds()) + } + return d +} diff --git a/vendor/github.com/prometheus/client_golang/prometheus/value.go b/vendor/github.com/prometheus/client_golang/prometheus/value.go index 2d3abc1cbd..5f6bb80014 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/value.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/value.go @@ -19,13 +19,11 @@ import ( "time" "unicode/utf8" - //nolint:staticcheck // Ignore SA1019. Need to keep deprecated package for compatibility. - "github.com/golang/protobuf/proto" - "google.golang.org/protobuf/types/known/timestamppb" - "github.com/prometheus/client_golang/prometheus/internal" dto "github.com/prometheus/client_model/go" + "google.golang.org/protobuf/proto" + "google.golang.org/protobuf/types/known/timestamppb" ) // ValueType is an enumeration of metric types that represent a simple value. @@ -188,9 +186,9 @@ func MakeLabelPairs(desc *Desc, labelValues []string) []*dto.LabelPair { return desc.constLabelPairs } labelPairs := make([]*dto.LabelPair, 0, totalLen) - for i, n := range desc.variableLabels { + for i, l := range desc.variableLabels { labelPairs = append(labelPairs, &dto.LabelPair{ - Name: proto.String(n), + Name: proto.String(l.Name), Value: proto.String(labelValues[i]), }) } diff --git a/vendor/github.com/prometheus/client_golang/prometheus/vec.go b/vendor/github.com/prometheus/client_golang/prometheus/vec.go index 7ae322590c..f0d0015a0f 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/vec.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/vec.go @@ -20,6 +20,24 @@ import ( "github.com/prometheus/common/model" ) +var labelsPool = &sync.Pool{ + New: func() interface{} { + return make(Labels) + }, +} + +func getLabelsFromPool() Labels { + return labelsPool.Get().(Labels) +} + +func putLabelsToPool(labels Labels) { + for k := range labels { + delete(labels, k) + } + + labelsPool.Put(labels) +} + // MetricVec is a Collector to bundle metrics of the same name that differ in // their label values. MetricVec is not used directly but as a building block // for implementations of vectors of a given metric type, like GaugeVec, @@ -72,6 +90,7 @@ func NewMetricVec(desc *Desc, newMetric func(lvs ...string) Metric) *MetricVec { // with a performance overhead (for creating and processing the Labels map). // See also the CounterVec example. func (m *MetricVec) DeleteLabelValues(lvs ...string) bool { + lvs = constrainLabelValues(m.desc, lvs, m.curry) h, err := m.hashLabelValues(lvs) if err != nil { return false @@ -91,6 +110,9 @@ func (m *MetricVec) DeleteLabelValues(lvs ...string) bool { // This method is used for the same purpose as DeleteLabelValues(...string). See // there for pros and cons of the two methods. func (m *MetricVec) Delete(labels Labels) bool { + labels = constrainLabels(m.desc, labels) + defer putLabelsToPool(labels) + h, err := m.hashLabels(labels) if err != nil { return false @@ -106,6 +128,9 @@ func (m *MetricVec) Delete(labels Labels) bool { // Note that curried labels will never be matched if deleting from the curried vector. // To match curried labels with DeletePartialMatch, it must be called on the base vector. func (m *MetricVec) DeletePartialMatch(labels Labels) int { + labels = constrainLabels(m.desc, labels) + defer putLabelsToPool(labels) + return m.metricMap.deleteByLabels(labels, m.curry) } @@ -145,10 +170,10 @@ func (m *MetricVec) CurryWith(labels Labels) (*MetricVec, error) { iCurry int ) for i, label := range m.desc.variableLabels { - val, ok := labels[label] + val, ok := labels[label.Name] if iCurry < len(oldCurry) && oldCurry[iCurry].index == i { if ok { - return nil, fmt.Errorf("label name %q is already curried", label) + return nil, fmt.Errorf("label name %q is already curried", label.Name) } newCurry = append(newCurry, oldCurry[iCurry]) iCurry++ @@ -156,7 +181,7 @@ func (m *MetricVec) CurryWith(labels Labels) (*MetricVec, error) { if !ok { continue // Label stays uncurried. } - newCurry = append(newCurry, curriedLabelValue{i, val}) + newCurry = append(newCurry, curriedLabelValue{i, label.Constrain(val)}) } } if l := len(oldCurry) + len(labels) - len(newCurry); l > 0 { @@ -199,6 +224,7 @@ func (m *MetricVec) CurryWith(labels Labels) (*MetricVec, error) { // a wrapper around MetricVec, implementing a vector for a specific Metric // implementation, for example GaugeVec. func (m *MetricVec) GetMetricWithLabelValues(lvs ...string) (Metric, error) { + lvs = constrainLabelValues(m.desc, lvs, m.curry) h, err := m.hashLabelValues(lvs) if err != nil { return nil, err @@ -224,6 +250,9 @@ func (m *MetricVec) GetMetricWithLabelValues(lvs ...string) (Metric, error) { // around MetricVec, implementing a vector for a specific Metric implementation, // for example GaugeVec. func (m *MetricVec) GetMetricWith(labels Labels) (Metric, error) { + labels = constrainLabels(m.desc, labels) + defer putLabelsToPool(labels) + h, err := m.hashLabels(labels) if err != nil { return nil, err @@ -266,16 +295,16 @@ func (m *MetricVec) hashLabels(labels Labels) (uint64, error) { iCurry int ) for i, label := range m.desc.variableLabels { - val, ok := labels[label] + val, ok := labels[label.Name] if iCurry < len(curry) && curry[iCurry].index == i { if ok { - return 0, fmt.Errorf("label name %q is already curried", label) + return 0, fmt.Errorf("label name %q is already curried", label.Name) } h = m.hashAdd(h, curry[iCurry].value) iCurry++ } else { if !ok { - return 0, fmt.Errorf("label name %q missing in label map", label) + return 0, fmt.Errorf("label name %q missing in label map", label.Name) } h = m.hashAdd(h, val) } @@ -453,7 +482,7 @@ func valueMatchesVariableOrCurriedValue(targetValue string, index int, values [] func matchPartialLabels(desc *Desc, values []string, labels Labels, curry []curriedLabelValue) bool { for l, v := range labels { // Check if the target label exists in our metrics and get the index. - varLabelIndex, validLabel := indexOf(l, desc.variableLabels) + varLabelIndex, validLabel := indexOf(l, desc.variableLabels.labelNames()) if validLabel { // Check the value of that label against the target value. // We don't consider curried values in partial matches. @@ -605,7 +634,7 @@ func matchLabels(desc *Desc, values []string, labels Labels, curry []curriedLabe iCurry++ continue } - if values[i] != labels[k] { + if values[i] != labels[k.Name] { return false } } @@ -621,7 +650,7 @@ func extractLabelValues(desc *Desc, labels Labels, curry []curriedLabelValue) [] iCurry++ continue } - labelValues[i] = labels[k] + labelValues[i] = labels[k.Name] } return labelValues } @@ -640,3 +669,35 @@ func inlineLabelValues(lvs []string, curry []curriedLabelValue) []string { } return labelValues } + +func constrainLabels(desc *Desc, labels Labels) Labels { + constrainedLabels := getLabelsFromPool() + for l, v := range labels { + if i, ok := indexOf(l, desc.variableLabels.labelNames()); ok { + v = desc.variableLabels[i].Constrain(v) + } + + constrainedLabels[l] = v + } + + return constrainedLabels +} + +func constrainLabelValues(desc *Desc, lvs []string, curry []curriedLabelValue) []string { + constrainedValues := make([]string, len(lvs)) + var iCurry, iLVs int + for i := 0; i < len(lvs)+len(curry); i++ { + if iCurry < len(curry) && curry[iCurry].index == i { + iCurry++ + continue + } + + if i < len(desc.variableLabels) { + constrainedValues[iLVs] = desc.variableLabels[i].Constrain(lvs[iLVs]) + } else { + constrainedValues[iLVs] = lvs[iLVs] + } + iLVs++ + } + return constrainedValues +} diff --git a/vendor/github.com/prometheus/client_golang/prometheus/vnext.go b/vendor/github.com/prometheus/client_golang/prometheus/vnext.go new file mode 100644 index 0000000000..42bc3a8f06 --- /dev/null +++ b/vendor/github.com/prometheus/client_golang/prometheus/vnext.go @@ -0,0 +1,23 @@ +// Copyright 2022 The Prometheus Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package prometheus + +type v2 struct{} + +// V2 is a struct that can be referenced to access experimental API that might +// be present in v2 of client golang someday. It offers extended functionality +// of v1 with slightly changed API. It is acceptable to use some pieces from v1 +// and e.g `prometheus.NewGauge` and some from v2 e.g. `prometheus.V2.NewDesc` +// in the same codebase. +var V2 = v2{} diff --git a/vendor/github.com/prometheus/client_golang/prometheus/wrap.go b/vendor/github.com/prometheus/client_golang/prometheus/wrap.go index 1498ee144c..25da157f15 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/wrap.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/wrap.go @@ -17,12 +17,10 @@ import ( "fmt" "sort" - //nolint:staticcheck // Ignore SA1019. Need to keep deprecated package for compatibility. - "github.com/golang/protobuf/proto" + "github.com/prometheus/client_golang/prometheus/internal" dto "github.com/prometheus/client_model/go" - - "github.com/prometheus/client_golang/prometheus/internal" + "google.golang.org/protobuf/proto" ) // WrapRegistererWith returns a Registerer wrapping the provided @@ -206,7 +204,7 @@ func wrapDesc(desc *Desc, prefix string, labels Labels) *Desc { constLabels[ln] = lv } // NewDesc will do remaining validations. - newDesc := NewDesc(prefix+desc.fqName, desc.help, desc.variableLabels, constLabels) + newDesc := V2.NewDesc(prefix+desc.fqName, desc.help, desc.variableLabels, constLabels) // Propagate errors if there was any. This will override any errer // created by NewDesc above, i.e. earlier errors get precedence. if desc.err != nil { diff --git a/vendor/github.com/prometheus/client_model/go/metrics.pb.go b/vendor/github.com/prometheus/client_model/go/metrics.pb.go index 35904ea198..2b5bca4b99 100644 --- a/vendor/github.com/prometheus/client_model/go/metrics.pb.go +++ b/vendor/github.com/prometheus/client_model/go/metrics.pb.go @@ -1,25 +1,38 @@ +// Copyright 2013 Prometheus Team +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + // Code generated by protoc-gen-go. DO NOT EDIT. +// versions: +// protoc-gen-go v1.30.0 +// protoc v3.20.3 // source: io/prometheus/client/metrics.proto package io_prometheus_client import ( - fmt "fmt" - proto "github.com/golang/protobuf/proto" - timestamp "github.com/golang/protobuf/ptypes/timestamp" - math "math" + protoreflect "google.golang.org/protobuf/reflect/protoreflect" + protoimpl "google.golang.org/protobuf/runtime/protoimpl" + timestamppb "google.golang.org/protobuf/types/known/timestamppb" + reflect "reflect" + sync "sync" ) -// Reference imports to suppress errors if they are not otherwise used. -var _ = proto.Marshal -var _ = fmt.Errorf -var _ = math.Inf - -// This is a compile-time assertion to ensure that this generated file -// is compatible with the proto package it is being compiled against. -// A compilation error at this line likely means your copy of the -// proto package needs to be updated. -const _ = proto.ProtoPackageIsVersion3 // please upgrade the proto package +const ( + // Verify that this generated code is sufficiently up-to-date. + _ = protoimpl.EnforceVersion(20 - protoimpl.MinVersion) + // Verify that runtime/protoimpl is sufficiently up-to-date. + _ = protoimpl.EnforceVersion(protoimpl.MaxVersion - 20) +) type MetricType int32 @@ -38,23 +51,25 @@ const ( MetricType_GAUGE_HISTOGRAM MetricType = 5 ) -var MetricType_name = map[int32]string{ - 0: "COUNTER", - 1: "GAUGE", - 2: "SUMMARY", - 3: "UNTYPED", - 4: "HISTOGRAM", - 5: "GAUGE_HISTOGRAM", -} - -var MetricType_value = map[string]int32{ - "COUNTER": 0, - "GAUGE": 1, - "SUMMARY": 2, - "UNTYPED": 3, - "HISTOGRAM": 4, - "GAUGE_HISTOGRAM": 5, -} +// Enum value maps for MetricType. +var ( + MetricType_name = map[int32]string{ + 0: "COUNTER", + 1: "GAUGE", + 2: "SUMMARY", + 3: "UNTYPED", + 4: "HISTOGRAM", + 5: "GAUGE_HISTOGRAM", + } + MetricType_value = map[string]int32{ + "COUNTER": 0, + "GAUGE": 1, + "SUMMARY": 2, + "UNTYPED": 3, + "HISTOGRAM": 4, + "GAUGE_HISTOGRAM": 5, + } +) func (x MetricType) Enum() *MetricType { p := new(MetricType) @@ -63,449 +78,519 @@ func (x MetricType) Enum() *MetricType { } func (x MetricType) String() string { - return proto.EnumName(MetricType_name, int32(x)) + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) } -func (x *MetricType) UnmarshalJSON(data []byte) error { - value, err := proto.UnmarshalJSONEnum(MetricType_value, data, "MetricType") +func (MetricType) Descriptor() protoreflect.EnumDescriptor { + return file_io_prometheus_client_metrics_proto_enumTypes[0].Descriptor() +} + +func (MetricType) Type() protoreflect.EnumType { + return &file_io_prometheus_client_metrics_proto_enumTypes[0] +} + +func (x MetricType) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *MetricType) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) if err != nil { return err } - *x = MetricType(value) + *x = MetricType(num) return nil } +// Deprecated: Use MetricType.Descriptor instead. func (MetricType) EnumDescriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{0} + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{0} } type LabelPair struct { - Name *string `protobuf:"bytes,1,opt,name=name" json:"name,omitempty"` - Value *string `protobuf:"bytes,2,opt,name=value" json:"value,omitempty"` - XXX_NoUnkeyedLiteral struct{} `json:"-"` - XXX_unrecognized []byte `json:"-"` - XXX_sizecache int32 `json:"-"` -} + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields -func (m *LabelPair) Reset() { *m = LabelPair{} } -func (m *LabelPair) String() string { return proto.CompactTextString(m) } -func (*LabelPair) ProtoMessage() {} -func (*LabelPair) Descriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{0} + Name *string `protobuf:"bytes,1,opt,name=name" json:"name,omitempty"` + Value *string `protobuf:"bytes,2,opt,name=value" json:"value,omitempty"` } -func (m *LabelPair) XXX_Unmarshal(b []byte) error { - return xxx_messageInfo_LabelPair.Unmarshal(m, b) -} -func (m *LabelPair) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { - return xxx_messageInfo_LabelPair.Marshal(b, m, deterministic) -} -func (m *LabelPair) XXX_Merge(src proto.Message) { - xxx_messageInfo_LabelPair.Merge(m, src) +func (x *LabelPair) Reset() { + *x = LabelPair{} + if protoimpl.UnsafeEnabled { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[0] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } } -func (m *LabelPair) XXX_Size() int { - return xxx_messageInfo_LabelPair.Size(m) + +func (x *LabelPair) String() string { + return protoimpl.X.MessageStringOf(x) } -func (m *LabelPair) XXX_DiscardUnknown() { - xxx_messageInfo_LabelPair.DiscardUnknown(m) + +func (*LabelPair) ProtoMessage() {} + +func (x *LabelPair) ProtoReflect() protoreflect.Message { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[0] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -var xxx_messageInfo_LabelPair proto.InternalMessageInfo +// Deprecated: Use LabelPair.ProtoReflect.Descriptor instead. +func (*LabelPair) Descriptor() ([]byte, []int) { + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{0} +} -func (m *LabelPair) GetName() string { - if m != nil && m.Name != nil { - return *m.Name +func (x *LabelPair) GetName() string { + if x != nil && x.Name != nil { + return *x.Name } return "" } -func (m *LabelPair) GetValue() string { - if m != nil && m.Value != nil { - return *m.Value +func (x *LabelPair) GetValue() string { + if x != nil && x.Value != nil { + return *x.Value } return "" } type Gauge struct { - Value *float64 `protobuf:"fixed64,1,opt,name=value" json:"value,omitempty"` - XXX_NoUnkeyedLiteral struct{} `json:"-"` - XXX_unrecognized []byte `json:"-"` - XXX_sizecache int32 `json:"-"` -} + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields -func (m *Gauge) Reset() { *m = Gauge{} } -func (m *Gauge) String() string { return proto.CompactTextString(m) } -func (*Gauge) ProtoMessage() {} -func (*Gauge) Descriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{1} + Value *float64 `protobuf:"fixed64,1,opt,name=value" json:"value,omitempty"` } -func (m *Gauge) XXX_Unmarshal(b []byte) error { - return xxx_messageInfo_Gauge.Unmarshal(m, b) -} -func (m *Gauge) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { - return xxx_messageInfo_Gauge.Marshal(b, m, deterministic) -} -func (m *Gauge) XXX_Merge(src proto.Message) { - xxx_messageInfo_Gauge.Merge(m, src) +func (x *Gauge) Reset() { + *x = Gauge{} + if protoimpl.UnsafeEnabled { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } } -func (m *Gauge) XXX_Size() int { - return xxx_messageInfo_Gauge.Size(m) + +func (x *Gauge) String() string { + return protoimpl.X.MessageStringOf(x) } -func (m *Gauge) XXX_DiscardUnknown() { - xxx_messageInfo_Gauge.DiscardUnknown(m) + +func (*Gauge) ProtoMessage() {} + +func (x *Gauge) ProtoReflect() protoreflect.Message { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[1] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -var xxx_messageInfo_Gauge proto.InternalMessageInfo +// Deprecated: Use Gauge.ProtoReflect.Descriptor instead. +func (*Gauge) Descriptor() ([]byte, []int) { + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{1} +} -func (m *Gauge) GetValue() float64 { - if m != nil && m.Value != nil { - return *m.Value +func (x *Gauge) GetValue() float64 { + if x != nil && x.Value != nil { + return *x.Value } return 0 } type Counter struct { - Value *float64 `protobuf:"fixed64,1,opt,name=value" json:"value,omitempty"` - Exemplar *Exemplar `protobuf:"bytes,2,opt,name=exemplar" json:"exemplar,omitempty"` - XXX_NoUnkeyedLiteral struct{} `json:"-"` - XXX_unrecognized []byte `json:"-"` - XXX_sizecache int32 `json:"-"` -} + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields -func (m *Counter) Reset() { *m = Counter{} } -func (m *Counter) String() string { return proto.CompactTextString(m) } -func (*Counter) ProtoMessage() {} -func (*Counter) Descriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{2} + Value *float64 `protobuf:"fixed64,1,opt,name=value" json:"value,omitempty"` + Exemplar *Exemplar `protobuf:"bytes,2,opt,name=exemplar" json:"exemplar,omitempty"` } -func (m *Counter) XXX_Unmarshal(b []byte) error { - return xxx_messageInfo_Counter.Unmarshal(m, b) -} -func (m *Counter) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { - return xxx_messageInfo_Counter.Marshal(b, m, deterministic) -} -func (m *Counter) XXX_Merge(src proto.Message) { - xxx_messageInfo_Counter.Merge(m, src) +func (x *Counter) Reset() { + *x = Counter{} + if protoimpl.UnsafeEnabled { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } } -func (m *Counter) XXX_Size() int { - return xxx_messageInfo_Counter.Size(m) + +func (x *Counter) String() string { + return protoimpl.X.MessageStringOf(x) } -func (m *Counter) XXX_DiscardUnknown() { - xxx_messageInfo_Counter.DiscardUnknown(m) + +func (*Counter) ProtoMessage() {} + +func (x *Counter) ProtoReflect() protoreflect.Message { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[2] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -var xxx_messageInfo_Counter proto.InternalMessageInfo +// Deprecated: Use Counter.ProtoReflect.Descriptor instead. +func (*Counter) Descriptor() ([]byte, []int) { + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{2} +} -func (m *Counter) GetValue() float64 { - if m != nil && m.Value != nil { - return *m.Value +func (x *Counter) GetValue() float64 { + if x != nil && x.Value != nil { + return *x.Value } return 0 } -func (m *Counter) GetExemplar() *Exemplar { - if m != nil { - return m.Exemplar +func (x *Counter) GetExemplar() *Exemplar { + if x != nil { + return x.Exemplar } return nil } type Quantile struct { - Quantile *float64 `protobuf:"fixed64,1,opt,name=quantile" json:"quantile,omitempty"` - Value *float64 `protobuf:"fixed64,2,opt,name=value" json:"value,omitempty"` - XXX_NoUnkeyedLiteral struct{} `json:"-"` - XXX_unrecognized []byte `json:"-"` - XXX_sizecache int32 `json:"-"` -} + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields -func (m *Quantile) Reset() { *m = Quantile{} } -func (m *Quantile) String() string { return proto.CompactTextString(m) } -func (*Quantile) ProtoMessage() {} -func (*Quantile) Descriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{3} + Quantile *float64 `protobuf:"fixed64,1,opt,name=quantile" json:"quantile,omitempty"` + Value *float64 `protobuf:"fixed64,2,opt,name=value" json:"value,omitempty"` } -func (m *Quantile) XXX_Unmarshal(b []byte) error { - return xxx_messageInfo_Quantile.Unmarshal(m, b) -} -func (m *Quantile) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { - return xxx_messageInfo_Quantile.Marshal(b, m, deterministic) -} -func (m *Quantile) XXX_Merge(src proto.Message) { - xxx_messageInfo_Quantile.Merge(m, src) +func (x *Quantile) Reset() { + *x = Quantile{} + if protoimpl.UnsafeEnabled { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[3] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } } -func (m *Quantile) XXX_Size() int { - return xxx_messageInfo_Quantile.Size(m) + +func (x *Quantile) String() string { + return protoimpl.X.MessageStringOf(x) } -func (m *Quantile) XXX_DiscardUnknown() { - xxx_messageInfo_Quantile.DiscardUnknown(m) + +func (*Quantile) ProtoMessage() {} + +func (x *Quantile) ProtoReflect() protoreflect.Message { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[3] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -var xxx_messageInfo_Quantile proto.InternalMessageInfo +// Deprecated: Use Quantile.ProtoReflect.Descriptor instead. +func (*Quantile) Descriptor() ([]byte, []int) { + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{3} +} -func (m *Quantile) GetQuantile() float64 { - if m != nil && m.Quantile != nil { - return *m.Quantile +func (x *Quantile) GetQuantile() float64 { + if x != nil && x.Quantile != nil { + return *x.Quantile } return 0 } -func (m *Quantile) GetValue() float64 { - if m != nil && m.Value != nil { - return *m.Value +func (x *Quantile) GetValue() float64 { + if x != nil && x.Value != nil { + return *x.Value } return 0 } type Summary struct { - SampleCount *uint64 `protobuf:"varint,1,opt,name=sample_count,json=sampleCount" json:"sample_count,omitempty"` - SampleSum *float64 `protobuf:"fixed64,2,opt,name=sample_sum,json=sampleSum" json:"sample_sum,omitempty"` - Quantile []*Quantile `protobuf:"bytes,3,rep,name=quantile" json:"quantile,omitempty"` - XXX_NoUnkeyedLiteral struct{} `json:"-"` - XXX_unrecognized []byte `json:"-"` - XXX_sizecache int32 `json:"-"` -} + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields -func (m *Summary) Reset() { *m = Summary{} } -func (m *Summary) String() string { return proto.CompactTextString(m) } -func (*Summary) ProtoMessage() {} -func (*Summary) Descriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{4} + SampleCount *uint64 `protobuf:"varint,1,opt,name=sample_count,json=sampleCount" json:"sample_count,omitempty"` + SampleSum *float64 `protobuf:"fixed64,2,opt,name=sample_sum,json=sampleSum" json:"sample_sum,omitempty"` + Quantile []*Quantile `protobuf:"bytes,3,rep,name=quantile" json:"quantile,omitempty"` } -func (m *Summary) XXX_Unmarshal(b []byte) error { - return xxx_messageInfo_Summary.Unmarshal(m, b) -} -func (m *Summary) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { - return xxx_messageInfo_Summary.Marshal(b, m, deterministic) -} -func (m *Summary) XXX_Merge(src proto.Message) { - xxx_messageInfo_Summary.Merge(m, src) +func (x *Summary) Reset() { + *x = Summary{} + if protoimpl.UnsafeEnabled { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[4] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } } -func (m *Summary) XXX_Size() int { - return xxx_messageInfo_Summary.Size(m) + +func (x *Summary) String() string { + return protoimpl.X.MessageStringOf(x) } -func (m *Summary) XXX_DiscardUnknown() { - xxx_messageInfo_Summary.DiscardUnknown(m) + +func (*Summary) ProtoMessage() {} + +func (x *Summary) ProtoReflect() protoreflect.Message { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[4] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -var xxx_messageInfo_Summary proto.InternalMessageInfo +// Deprecated: Use Summary.ProtoReflect.Descriptor instead. +func (*Summary) Descriptor() ([]byte, []int) { + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{4} +} -func (m *Summary) GetSampleCount() uint64 { - if m != nil && m.SampleCount != nil { - return *m.SampleCount +func (x *Summary) GetSampleCount() uint64 { + if x != nil && x.SampleCount != nil { + return *x.SampleCount } return 0 } -func (m *Summary) GetSampleSum() float64 { - if m != nil && m.SampleSum != nil { - return *m.SampleSum +func (x *Summary) GetSampleSum() float64 { + if x != nil && x.SampleSum != nil { + return *x.SampleSum } return 0 } -func (m *Summary) GetQuantile() []*Quantile { - if m != nil { - return m.Quantile +func (x *Summary) GetQuantile() []*Quantile { + if x != nil { + return x.Quantile } return nil } type Untyped struct { - Value *float64 `protobuf:"fixed64,1,opt,name=value" json:"value,omitempty"` - XXX_NoUnkeyedLiteral struct{} `json:"-"` - XXX_unrecognized []byte `json:"-"` - XXX_sizecache int32 `json:"-"` -} + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields -func (m *Untyped) Reset() { *m = Untyped{} } -func (m *Untyped) String() string { return proto.CompactTextString(m) } -func (*Untyped) ProtoMessage() {} -func (*Untyped) Descriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{5} + Value *float64 `protobuf:"fixed64,1,opt,name=value" json:"value,omitempty"` } -func (m *Untyped) XXX_Unmarshal(b []byte) error { - return xxx_messageInfo_Untyped.Unmarshal(m, b) -} -func (m *Untyped) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { - return xxx_messageInfo_Untyped.Marshal(b, m, deterministic) -} -func (m *Untyped) XXX_Merge(src proto.Message) { - xxx_messageInfo_Untyped.Merge(m, src) +func (x *Untyped) Reset() { + *x = Untyped{} + if protoimpl.UnsafeEnabled { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[5] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } } -func (m *Untyped) XXX_Size() int { - return xxx_messageInfo_Untyped.Size(m) + +func (x *Untyped) String() string { + return protoimpl.X.MessageStringOf(x) } -func (m *Untyped) XXX_DiscardUnknown() { - xxx_messageInfo_Untyped.DiscardUnknown(m) + +func (*Untyped) ProtoMessage() {} + +func (x *Untyped) ProtoReflect() protoreflect.Message { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[5] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -var xxx_messageInfo_Untyped proto.InternalMessageInfo +// Deprecated: Use Untyped.ProtoReflect.Descriptor instead. +func (*Untyped) Descriptor() ([]byte, []int) { + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{5} +} -func (m *Untyped) GetValue() float64 { - if m != nil && m.Value != nil { - return *m.Value +func (x *Untyped) GetValue() float64 { + if x != nil && x.Value != nil { + return *x.Value } return 0 } type Histogram struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + SampleCount *uint64 `protobuf:"varint,1,opt,name=sample_count,json=sampleCount" json:"sample_count,omitempty"` - SampleCountFloat *float64 `protobuf:"fixed64,4,opt,name=sample_count_float,json=sampleCountFloat" json:"sample_count_float,omitempty"` + SampleCountFloat *float64 `protobuf:"fixed64,4,opt,name=sample_count_float,json=sampleCountFloat" json:"sample_count_float,omitempty"` // Overrides sample_count if > 0. SampleSum *float64 `protobuf:"fixed64,2,opt,name=sample_sum,json=sampleSum" json:"sample_sum,omitempty"` // Buckets for the conventional histogram. - Bucket []*Bucket `protobuf:"bytes,3,rep,name=bucket" json:"bucket,omitempty"` + Bucket []*Bucket `protobuf:"bytes,3,rep,name=bucket" json:"bucket,omitempty"` // Ordered in increasing order of upper_bound, +Inf bucket is optional. // schema defines the bucket schema. Currently, valid numbers are -4 <= n <= 8. // They are all for base-2 bucket schemas, where 1 is a bucket boundary in each case, and // then each power of two is divided into 2^n logarithmic buckets. // Or in other words, each bucket boundary is the previous boundary times 2^(2^-n). // In the future, more bucket schemas may be added using numbers < -4 or > 8. Schema *int32 `protobuf:"zigzag32,5,opt,name=schema" json:"schema,omitempty"` - ZeroThreshold *float64 `protobuf:"fixed64,6,opt,name=zero_threshold,json=zeroThreshold" json:"zero_threshold,omitempty"` - ZeroCount *uint64 `protobuf:"varint,7,opt,name=zero_count,json=zeroCount" json:"zero_count,omitempty"` - ZeroCountFloat *float64 `protobuf:"fixed64,8,opt,name=zero_count_float,json=zeroCountFloat" json:"zero_count_float,omitempty"` + ZeroThreshold *float64 `protobuf:"fixed64,6,opt,name=zero_threshold,json=zeroThreshold" json:"zero_threshold,omitempty"` // Breadth of the zero bucket. + ZeroCount *uint64 `protobuf:"varint,7,opt,name=zero_count,json=zeroCount" json:"zero_count,omitempty"` // Count in zero bucket. + ZeroCountFloat *float64 `protobuf:"fixed64,8,opt,name=zero_count_float,json=zeroCountFloat" json:"zero_count_float,omitempty"` // Overrides sb_zero_count if > 0. // Negative buckets for the native histogram. NegativeSpan []*BucketSpan `protobuf:"bytes,9,rep,name=negative_span,json=negativeSpan" json:"negative_span,omitempty"` // Use either "negative_delta" or "negative_count", the former for // regular histograms with integer counts, the latter for float // histograms. - NegativeDelta []int64 `protobuf:"zigzag64,10,rep,name=negative_delta,json=negativeDelta" json:"negative_delta,omitempty"` - NegativeCount []float64 `protobuf:"fixed64,11,rep,name=negative_count,json=negativeCount" json:"negative_count,omitempty"` + NegativeDelta []int64 `protobuf:"zigzag64,10,rep,name=negative_delta,json=negativeDelta" json:"negative_delta,omitempty"` // Count delta of each bucket compared to previous one (or to zero for 1st bucket). + NegativeCount []float64 `protobuf:"fixed64,11,rep,name=negative_count,json=negativeCount" json:"negative_count,omitempty"` // Absolute count of each bucket. // Positive buckets for the native histogram. PositiveSpan []*BucketSpan `protobuf:"bytes,12,rep,name=positive_span,json=positiveSpan" json:"positive_span,omitempty"` // Use either "positive_delta" or "positive_count", the former for // regular histograms with integer counts, the latter for float // histograms. - PositiveDelta []int64 `protobuf:"zigzag64,13,rep,name=positive_delta,json=positiveDelta" json:"positive_delta,omitempty"` - PositiveCount []float64 `protobuf:"fixed64,14,rep,name=positive_count,json=positiveCount" json:"positive_count,omitempty"` - XXX_NoUnkeyedLiteral struct{} `json:"-"` - XXX_unrecognized []byte `json:"-"` - XXX_sizecache int32 `json:"-"` + PositiveDelta []int64 `protobuf:"zigzag64,13,rep,name=positive_delta,json=positiveDelta" json:"positive_delta,omitempty"` // Count delta of each bucket compared to previous one (or to zero for 1st bucket). + PositiveCount []float64 `protobuf:"fixed64,14,rep,name=positive_count,json=positiveCount" json:"positive_count,omitempty"` // Absolute count of each bucket. } -func (m *Histogram) Reset() { *m = Histogram{} } -func (m *Histogram) String() string { return proto.CompactTextString(m) } -func (*Histogram) ProtoMessage() {} -func (*Histogram) Descriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{6} +func (x *Histogram) Reset() { + *x = Histogram{} + if protoimpl.UnsafeEnabled { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[6] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } } -func (m *Histogram) XXX_Unmarshal(b []byte) error { - return xxx_messageInfo_Histogram.Unmarshal(m, b) +func (x *Histogram) String() string { + return protoimpl.X.MessageStringOf(x) } -func (m *Histogram) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { - return xxx_messageInfo_Histogram.Marshal(b, m, deterministic) -} -func (m *Histogram) XXX_Merge(src proto.Message) { - xxx_messageInfo_Histogram.Merge(m, src) -} -func (m *Histogram) XXX_Size() int { - return xxx_messageInfo_Histogram.Size(m) -} -func (m *Histogram) XXX_DiscardUnknown() { - xxx_messageInfo_Histogram.DiscardUnknown(m) + +func (*Histogram) ProtoMessage() {} + +func (x *Histogram) ProtoReflect() protoreflect.Message { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[6] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -var xxx_messageInfo_Histogram proto.InternalMessageInfo +// Deprecated: Use Histogram.ProtoReflect.Descriptor instead. +func (*Histogram) Descriptor() ([]byte, []int) { + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{6} +} -func (m *Histogram) GetSampleCount() uint64 { - if m != nil && m.SampleCount != nil { - return *m.SampleCount +func (x *Histogram) GetSampleCount() uint64 { + if x != nil && x.SampleCount != nil { + return *x.SampleCount } return 0 } -func (m *Histogram) GetSampleCountFloat() float64 { - if m != nil && m.SampleCountFloat != nil { - return *m.SampleCountFloat +func (x *Histogram) GetSampleCountFloat() float64 { + if x != nil && x.SampleCountFloat != nil { + return *x.SampleCountFloat } return 0 } -func (m *Histogram) GetSampleSum() float64 { - if m != nil && m.SampleSum != nil { - return *m.SampleSum +func (x *Histogram) GetSampleSum() float64 { + if x != nil && x.SampleSum != nil { + return *x.SampleSum } return 0 } -func (m *Histogram) GetBucket() []*Bucket { - if m != nil { - return m.Bucket +func (x *Histogram) GetBucket() []*Bucket { + if x != nil { + return x.Bucket } return nil } -func (m *Histogram) GetSchema() int32 { - if m != nil && m.Schema != nil { - return *m.Schema +func (x *Histogram) GetSchema() int32 { + if x != nil && x.Schema != nil { + return *x.Schema } return 0 } -func (m *Histogram) GetZeroThreshold() float64 { - if m != nil && m.ZeroThreshold != nil { - return *m.ZeroThreshold +func (x *Histogram) GetZeroThreshold() float64 { + if x != nil && x.ZeroThreshold != nil { + return *x.ZeroThreshold } return 0 } -func (m *Histogram) GetZeroCount() uint64 { - if m != nil && m.ZeroCount != nil { - return *m.ZeroCount +func (x *Histogram) GetZeroCount() uint64 { + if x != nil && x.ZeroCount != nil { + return *x.ZeroCount } return 0 } -func (m *Histogram) GetZeroCountFloat() float64 { - if m != nil && m.ZeroCountFloat != nil { - return *m.ZeroCountFloat +func (x *Histogram) GetZeroCountFloat() float64 { + if x != nil && x.ZeroCountFloat != nil { + return *x.ZeroCountFloat } return 0 } -func (m *Histogram) GetNegativeSpan() []*BucketSpan { - if m != nil { - return m.NegativeSpan +func (x *Histogram) GetNegativeSpan() []*BucketSpan { + if x != nil { + return x.NegativeSpan } return nil } -func (m *Histogram) GetNegativeDelta() []int64 { - if m != nil { - return m.NegativeDelta +func (x *Histogram) GetNegativeDelta() []int64 { + if x != nil { + return x.NegativeDelta } return nil } -func (m *Histogram) GetNegativeCount() []float64 { - if m != nil { - return m.NegativeCount +func (x *Histogram) GetNegativeCount() []float64 { + if x != nil { + return x.NegativeCount } return nil } -func (m *Histogram) GetPositiveSpan() []*BucketSpan { - if m != nil { - return m.PositiveSpan +func (x *Histogram) GetPositiveSpan() []*BucketSpan { + if x != nil { + return x.PositiveSpan } return nil } -func (m *Histogram) GetPositiveDelta() []int64 { - if m != nil { - return m.PositiveDelta +func (x *Histogram) GetPositiveDelta() []int64 { + if x != nil { + return x.PositiveDelta } return nil } -func (m *Histogram) GetPositiveCount() []float64 { - if m != nil { - return m.PositiveCount +func (x *Histogram) GetPositiveCount() []float64 { + if x != nil { + return x.PositiveCount } return nil } @@ -513,64 +598,72 @@ func (m *Histogram) GetPositiveCount() []float64 { // A Bucket of a conventional histogram, each of which is treated as // an individual counter-like time series by Prometheus. type Bucket struct { - CumulativeCount *uint64 `protobuf:"varint,1,opt,name=cumulative_count,json=cumulativeCount" json:"cumulative_count,omitempty"` - CumulativeCountFloat *float64 `protobuf:"fixed64,4,opt,name=cumulative_count_float,json=cumulativeCountFloat" json:"cumulative_count_float,omitempty"` - UpperBound *float64 `protobuf:"fixed64,2,opt,name=upper_bound,json=upperBound" json:"upper_bound,omitempty"` + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + CumulativeCount *uint64 `protobuf:"varint,1,opt,name=cumulative_count,json=cumulativeCount" json:"cumulative_count,omitempty"` // Cumulative in increasing order. + CumulativeCountFloat *float64 `protobuf:"fixed64,4,opt,name=cumulative_count_float,json=cumulativeCountFloat" json:"cumulative_count_float,omitempty"` // Overrides cumulative_count if > 0. + UpperBound *float64 `protobuf:"fixed64,2,opt,name=upper_bound,json=upperBound" json:"upper_bound,omitempty"` // Inclusive. Exemplar *Exemplar `protobuf:"bytes,3,opt,name=exemplar" json:"exemplar,omitempty"` - XXX_NoUnkeyedLiteral struct{} `json:"-"` - XXX_unrecognized []byte `json:"-"` - XXX_sizecache int32 `json:"-"` } -func (m *Bucket) Reset() { *m = Bucket{} } -func (m *Bucket) String() string { return proto.CompactTextString(m) } -func (*Bucket) ProtoMessage() {} -func (*Bucket) Descriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{7} +func (x *Bucket) Reset() { + *x = Bucket{} + if protoimpl.UnsafeEnabled { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[7] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } } -func (m *Bucket) XXX_Unmarshal(b []byte) error { - return xxx_messageInfo_Bucket.Unmarshal(m, b) -} -func (m *Bucket) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { - return xxx_messageInfo_Bucket.Marshal(b, m, deterministic) -} -func (m *Bucket) XXX_Merge(src proto.Message) { - xxx_messageInfo_Bucket.Merge(m, src) -} -func (m *Bucket) XXX_Size() int { - return xxx_messageInfo_Bucket.Size(m) +func (x *Bucket) String() string { + return protoimpl.X.MessageStringOf(x) } -func (m *Bucket) XXX_DiscardUnknown() { - xxx_messageInfo_Bucket.DiscardUnknown(m) + +func (*Bucket) ProtoMessage() {} + +func (x *Bucket) ProtoReflect() protoreflect.Message { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[7] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -var xxx_messageInfo_Bucket proto.InternalMessageInfo +// Deprecated: Use Bucket.ProtoReflect.Descriptor instead. +func (*Bucket) Descriptor() ([]byte, []int) { + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{7} +} -func (m *Bucket) GetCumulativeCount() uint64 { - if m != nil && m.CumulativeCount != nil { - return *m.CumulativeCount +func (x *Bucket) GetCumulativeCount() uint64 { + if x != nil && x.CumulativeCount != nil { + return *x.CumulativeCount } return 0 } -func (m *Bucket) GetCumulativeCountFloat() float64 { - if m != nil && m.CumulativeCountFloat != nil { - return *m.CumulativeCountFloat +func (x *Bucket) GetCumulativeCountFloat() float64 { + if x != nil && x.CumulativeCountFloat != nil { + return *x.CumulativeCountFloat } return 0 } -func (m *Bucket) GetUpperBound() float64 { - if m != nil && m.UpperBound != nil { - return *m.UpperBound +func (x *Bucket) GetUpperBound() float64 { + if x != nil && x.UpperBound != nil { + return *x.UpperBound } return 0 } -func (m *Bucket) GetExemplar() *Exemplar { - if m != nil { - return m.Exemplar +func (x *Bucket) GetExemplar() *Exemplar { + if x != nil { + return x.Exemplar } return nil } @@ -582,333 +675,658 @@ func (m *Bucket) GetExemplar() *Exemplar { // structured here (with all the buckets in a single array separate // from the Spans). type BucketSpan struct { - Offset *int32 `protobuf:"zigzag32,1,opt,name=offset" json:"offset,omitempty"` - Length *uint32 `protobuf:"varint,2,opt,name=length" json:"length,omitempty"` - XXX_NoUnkeyedLiteral struct{} `json:"-"` - XXX_unrecognized []byte `json:"-"` - XXX_sizecache int32 `json:"-"` -} + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields -func (m *BucketSpan) Reset() { *m = BucketSpan{} } -func (m *BucketSpan) String() string { return proto.CompactTextString(m) } -func (*BucketSpan) ProtoMessage() {} -func (*BucketSpan) Descriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{8} + Offset *int32 `protobuf:"zigzag32,1,opt,name=offset" json:"offset,omitempty"` // Gap to previous span, or starting point for 1st span (which can be negative). + Length *uint32 `protobuf:"varint,2,opt,name=length" json:"length,omitempty"` // Length of consecutive buckets. } -func (m *BucketSpan) XXX_Unmarshal(b []byte) error { - return xxx_messageInfo_BucketSpan.Unmarshal(m, b) -} -func (m *BucketSpan) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { - return xxx_messageInfo_BucketSpan.Marshal(b, m, deterministic) -} -func (m *BucketSpan) XXX_Merge(src proto.Message) { - xxx_messageInfo_BucketSpan.Merge(m, src) +func (x *BucketSpan) Reset() { + *x = BucketSpan{} + if protoimpl.UnsafeEnabled { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[8] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } } -func (m *BucketSpan) XXX_Size() int { - return xxx_messageInfo_BucketSpan.Size(m) + +func (x *BucketSpan) String() string { + return protoimpl.X.MessageStringOf(x) } -func (m *BucketSpan) XXX_DiscardUnknown() { - xxx_messageInfo_BucketSpan.DiscardUnknown(m) + +func (*BucketSpan) ProtoMessage() {} + +func (x *BucketSpan) ProtoReflect() protoreflect.Message { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[8] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -var xxx_messageInfo_BucketSpan proto.InternalMessageInfo +// Deprecated: Use BucketSpan.ProtoReflect.Descriptor instead. +func (*BucketSpan) Descriptor() ([]byte, []int) { + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{8} +} -func (m *BucketSpan) GetOffset() int32 { - if m != nil && m.Offset != nil { - return *m.Offset +func (x *BucketSpan) GetOffset() int32 { + if x != nil && x.Offset != nil { + return *x.Offset } return 0 } -func (m *BucketSpan) GetLength() uint32 { - if m != nil && m.Length != nil { - return *m.Length +func (x *BucketSpan) GetLength() uint32 { + if x != nil && x.Length != nil { + return *x.Length } return 0 } type Exemplar struct { - Label []*LabelPair `protobuf:"bytes,1,rep,name=label" json:"label,omitempty"` - Value *float64 `protobuf:"fixed64,2,opt,name=value" json:"value,omitempty"` - Timestamp *timestamp.Timestamp `protobuf:"bytes,3,opt,name=timestamp" json:"timestamp,omitempty"` - XXX_NoUnkeyedLiteral struct{} `json:"-"` - XXX_unrecognized []byte `json:"-"` - XXX_sizecache int32 `json:"-"` -} + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields -func (m *Exemplar) Reset() { *m = Exemplar{} } -func (m *Exemplar) String() string { return proto.CompactTextString(m) } -func (*Exemplar) ProtoMessage() {} -func (*Exemplar) Descriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{9} + Label []*LabelPair `protobuf:"bytes,1,rep,name=label" json:"label,omitempty"` + Value *float64 `protobuf:"fixed64,2,opt,name=value" json:"value,omitempty"` + Timestamp *timestamppb.Timestamp `protobuf:"bytes,3,opt,name=timestamp" json:"timestamp,omitempty"` // OpenMetrics-style. } -func (m *Exemplar) XXX_Unmarshal(b []byte) error { - return xxx_messageInfo_Exemplar.Unmarshal(m, b) -} -func (m *Exemplar) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { - return xxx_messageInfo_Exemplar.Marshal(b, m, deterministic) -} -func (m *Exemplar) XXX_Merge(src proto.Message) { - xxx_messageInfo_Exemplar.Merge(m, src) +func (x *Exemplar) Reset() { + *x = Exemplar{} + if protoimpl.UnsafeEnabled { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[9] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } } -func (m *Exemplar) XXX_Size() int { - return xxx_messageInfo_Exemplar.Size(m) + +func (x *Exemplar) String() string { + return protoimpl.X.MessageStringOf(x) } -func (m *Exemplar) XXX_DiscardUnknown() { - xxx_messageInfo_Exemplar.DiscardUnknown(m) + +func (*Exemplar) ProtoMessage() {} + +func (x *Exemplar) ProtoReflect() protoreflect.Message { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[9] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -var xxx_messageInfo_Exemplar proto.InternalMessageInfo +// Deprecated: Use Exemplar.ProtoReflect.Descriptor instead. +func (*Exemplar) Descriptor() ([]byte, []int) { + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{9} +} -func (m *Exemplar) GetLabel() []*LabelPair { - if m != nil { - return m.Label +func (x *Exemplar) GetLabel() []*LabelPair { + if x != nil { + return x.Label } return nil } -func (m *Exemplar) GetValue() float64 { - if m != nil && m.Value != nil { - return *m.Value +func (x *Exemplar) GetValue() float64 { + if x != nil && x.Value != nil { + return *x.Value } return 0 } -func (m *Exemplar) GetTimestamp() *timestamp.Timestamp { - if m != nil { - return m.Timestamp +func (x *Exemplar) GetTimestamp() *timestamppb.Timestamp { + if x != nil { + return x.Timestamp } return nil } type Metric struct { - Label []*LabelPair `protobuf:"bytes,1,rep,name=label" json:"label,omitempty"` - Gauge *Gauge `protobuf:"bytes,2,opt,name=gauge" json:"gauge,omitempty"` - Counter *Counter `protobuf:"bytes,3,opt,name=counter" json:"counter,omitempty"` - Summary *Summary `protobuf:"bytes,4,opt,name=summary" json:"summary,omitempty"` - Untyped *Untyped `protobuf:"bytes,5,opt,name=untyped" json:"untyped,omitempty"` - Histogram *Histogram `protobuf:"bytes,7,opt,name=histogram" json:"histogram,omitempty"` - TimestampMs *int64 `protobuf:"varint,6,opt,name=timestamp_ms,json=timestampMs" json:"timestamp_ms,omitempty"` - XXX_NoUnkeyedLiteral struct{} `json:"-"` - XXX_unrecognized []byte `json:"-"` - XXX_sizecache int32 `json:"-"` -} - -func (m *Metric) Reset() { *m = Metric{} } -func (m *Metric) String() string { return proto.CompactTextString(m) } -func (*Metric) ProtoMessage() {} -func (*Metric) Descriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{10} + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + Label []*LabelPair `protobuf:"bytes,1,rep,name=label" json:"label,omitempty"` + Gauge *Gauge `protobuf:"bytes,2,opt,name=gauge" json:"gauge,omitempty"` + Counter *Counter `protobuf:"bytes,3,opt,name=counter" json:"counter,omitempty"` + Summary *Summary `protobuf:"bytes,4,opt,name=summary" json:"summary,omitempty"` + Untyped *Untyped `protobuf:"bytes,5,opt,name=untyped" json:"untyped,omitempty"` + Histogram *Histogram `protobuf:"bytes,7,opt,name=histogram" json:"histogram,omitempty"` + TimestampMs *int64 `protobuf:"varint,6,opt,name=timestamp_ms,json=timestampMs" json:"timestamp_ms,omitempty"` +} + +func (x *Metric) Reset() { + *x = Metric{} + if protoimpl.UnsafeEnabled { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[10] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } } -func (m *Metric) XXX_Unmarshal(b []byte) error { - return xxx_messageInfo_Metric.Unmarshal(m, b) +func (x *Metric) String() string { + return protoimpl.X.MessageStringOf(x) } -func (m *Metric) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { - return xxx_messageInfo_Metric.Marshal(b, m, deterministic) -} -func (m *Metric) XXX_Merge(src proto.Message) { - xxx_messageInfo_Metric.Merge(m, src) -} -func (m *Metric) XXX_Size() int { - return xxx_messageInfo_Metric.Size(m) -} -func (m *Metric) XXX_DiscardUnknown() { - xxx_messageInfo_Metric.DiscardUnknown(m) + +func (*Metric) ProtoMessage() {} + +func (x *Metric) ProtoReflect() protoreflect.Message { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[10] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -var xxx_messageInfo_Metric proto.InternalMessageInfo +// Deprecated: Use Metric.ProtoReflect.Descriptor instead. +func (*Metric) Descriptor() ([]byte, []int) { + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{10} +} -func (m *Metric) GetLabel() []*LabelPair { - if m != nil { - return m.Label +func (x *Metric) GetLabel() []*LabelPair { + if x != nil { + return x.Label } return nil } -func (m *Metric) GetGauge() *Gauge { - if m != nil { - return m.Gauge +func (x *Metric) GetGauge() *Gauge { + if x != nil { + return x.Gauge } return nil } -func (m *Metric) GetCounter() *Counter { - if m != nil { - return m.Counter +func (x *Metric) GetCounter() *Counter { + if x != nil { + return x.Counter } return nil } -func (m *Metric) GetSummary() *Summary { - if m != nil { - return m.Summary +func (x *Metric) GetSummary() *Summary { + if x != nil { + return x.Summary } return nil } -func (m *Metric) GetUntyped() *Untyped { - if m != nil { - return m.Untyped +func (x *Metric) GetUntyped() *Untyped { + if x != nil { + return x.Untyped } return nil } -func (m *Metric) GetHistogram() *Histogram { - if m != nil { - return m.Histogram +func (x *Metric) GetHistogram() *Histogram { + if x != nil { + return x.Histogram } return nil } -func (m *Metric) GetTimestampMs() int64 { - if m != nil && m.TimestampMs != nil { - return *m.TimestampMs +func (x *Metric) GetTimestampMs() int64 { + if x != nil && x.TimestampMs != nil { + return *x.TimestampMs } return 0 } type MetricFamily struct { - Name *string `protobuf:"bytes,1,opt,name=name" json:"name,omitempty"` - Help *string `protobuf:"bytes,2,opt,name=help" json:"help,omitempty"` - Type *MetricType `protobuf:"varint,3,opt,name=type,enum=io.prometheus.client.MetricType" json:"type,omitempty"` - Metric []*Metric `protobuf:"bytes,4,rep,name=metric" json:"metric,omitempty"` - XXX_NoUnkeyedLiteral struct{} `json:"-"` - XXX_unrecognized []byte `json:"-"` - XXX_sizecache int32 `json:"-"` -} - -func (m *MetricFamily) Reset() { *m = MetricFamily{} } -func (m *MetricFamily) String() string { return proto.CompactTextString(m) } -func (*MetricFamily) ProtoMessage() {} -func (*MetricFamily) Descriptor() ([]byte, []int) { - return fileDescriptor_d1e5ddb18987a258, []int{11} + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + Name *string `protobuf:"bytes,1,opt,name=name" json:"name,omitempty"` + Help *string `protobuf:"bytes,2,opt,name=help" json:"help,omitempty"` + Type *MetricType `protobuf:"varint,3,opt,name=type,enum=io.prometheus.client.MetricType" json:"type,omitempty"` + Metric []*Metric `protobuf:"bytes,4,rep,name=metric" json:"metric,omitempty"` +} + +func (x *MetricFamily) Reset() { + *x = MetricFamily{} + if protoimpl.UnsafeEnabled { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[11] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } } -func (m *MetricFamily) XXX_Unmarshal(b []byte) error { - return xxx_messageInfo_MetricFamily.Unmarshal(m, b) -} -func (m *MetricFamily) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { - return xxx_messageInfo_MetricFamily.Marshal(b, m, deterministic) -} -func (m *MetricFamily) XXX_Merge(src proto.Message) { - xxx_messageInfo_MetricFamily.Merge(m, src) -} -func (m *MetricFamily) XXX_Size() int { - return xxx_messageInfo_MetricFamily.Size(m) +func (x *MetricFamily) String() string { + return protoimpl.X.MessageStringOf(x) } -func (m *MetricFamily) XXX_DiscardUnknown() { - xxx_messageInfo_MetricFamily.DiscardUnknown(m) + +func (*MetricFamily) ProtoMessage() {} + +func (x *MetricFamily) ProtoReflect() protoreflect.Message { + mi := &file_io_prometheus_client_metrics_proto_msgTypes[11] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) } -var xxx_messageInfo_MetricFamily proto.InternalMessageInfo +// Deprecated: Use MetricFamily.ProtoReflect.Descriptor instead. +func (*MetricFamily) Descriptor() ([]byte, []int) { + return file_io_prometheus_client_metrics_proto_rawDescGZIP(), []int{11} +} -func (m *MetricFamily) GetName() string { - if m != nil && m.Name != nil { - return *m.Name +func (x *MetricFamily) GetName() string { + if x != nil && x.Name != nil { + return *x.Name } return "" } -func (m *MetricFamily) GetHelp() string { - if m != nil && m.Help != nil { - return *m.Help +func (x *MetricFamily) GetHelp() string { + if x != nil && x.Help != nil { + return *x.Help } return "" } -func (m *MetricFamily) GetType() MetricType { - if m != nil && m.Type != nil { - return *m.Type +func (x *MetricFamily) GetType() MetricType { + if x != nil && x.Type != nil { + return *x.Type } return MetricType_COUNTER } -func (m *MetricFamily) GetMetric() []*Metric { - if m != nil { - return m.Metric +func (x *MetricFamily) GetMetric() []*Metric { + if x != nil { + return x.Metric } return nil } -func init() { - proto.RegisterEnum("io.prometheus.client.MetricType", MetricType_name, MetricType_value) - proto.RegisterType((*LabelPair)(nil), "io.prometheus.client.LabelPair") - proto.RegisterType((*Gauge)(nil), "io.prometheus.client.Gauge") - proto.RegisterType((*Counter)(nil), "io.prometheus.client.Counter") - proto.RegisterType((*Quantile)(nil), "io.prometheus.client.Quantile") - proto.RegisterType((*Summary)(nil), "io.prometheus.client.Summary") - proto.RegisterType((*Untyped)(nil), "io.prometheus.client.Untyped") - proto.RegisterType((*Histogram)(nil), "io.prometheus.client.Histogram") - proto.RegisterType((*Bucket)(nil), "io.prometheus.client.Bucket") - proto.RegisterType((*BucketSpan)(nil), "io.prometheus.client.BucketSpan") - proto.RegisterType((*Exemplar)(nil), "io.prometheus.client.Exemplar") - proto.RegisterType((*Metric)(nil), "io.prometheus.client.Metric") - proto.RegisterType((*MetricFamily)(nil), "io.prometheus.client.MetricFamily") -} - -func init() { - proto.RegisterFile("io/prometheus/client/metrics.proto", fileDescriptor_d1e5ddb18987a258) -} - -var fileDescriptor_d1e5ddb18987a258 = []byte{ - // 896 bytes of a gzipped FileDescriptorProto - 0x1f, 0x8b, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0xff, 0x9c, 0x56, 0xdd, 0x8e, 0xdb, 0x44, - 0x18, 0xc5, 0x9b, 0x5f, 0x7f, 0xd9, 0x6c, 0xd3, 0x61, 0x55, 0x59, 0x0b, 0xcb, 0x06, 0x4b, 0x48, - 0x0b, 0x42, 0x8e, 0x40, 0x5b, 0x81, 0x0a, 0x5c, 0xec, 0xb6, 0xe9, 0x16, 0x89, 0xb4, 0x65, 0x92, - 0x5c, 0x14, 0x2e, 0xac, 0x49, 0x32, 0xeb, 0x58, 0x78, 0x3c, 0xc6, 0x1e, 0x57, 0x2c, 0x2f, 0xc0, - 0x35, 0xaf, 0xc0, 0xc3, 0xf0, 0x22, 0x3c, 0x08, 0x68, 0xfe, 0xec, 0xdd, 0xe2, 0x94, 0xd2, 0x3b, - 0x7f, 0x67, 0xce, 0xf7, 0xcd, 0x39, 0xe3, 0xc9, 0x71, 0xc0, 0x8f, 0xf9, 0x24, 0xcb, 0x39, 0xa3, - 0x62, 0x4b, 0xcb, 0x62, 0xb2, 0x4e, 0x62, 0x9a, 0x8a, 0x09, 0xa3, 0x22, 0x8f, 0xd7, 0x45, 0x90, - 0xe5, 0x5c, 0x70, 0x74, 0x18, 0xf3, 0xa0, 0xe6, 0x04, 0x9a, 0x73, 0x74, 0x12, 0x71, 0x1e, 0x25, - 0x74, 0xa2, 0x38, 0xab, 0xf2, 0x6a, 0x22, 0x62, 0x46, 0x0b, 0x41, 0x58, 0xa6, 0xdb, 0xfc, 0xfb, - 0xe0, 0x7e, 0x47, 0x56, 0x34, 0x79, 0x4e, 0xe2, 0x1c, 0x21, 0x68, 0xa7, 0x84, 0x51, 0xcf, 0x19, - 0x3b, 0xa7, 0x2e, 0x56, 0xcf, 0xe8, 0x10, 0x3a, 0x2f, 0x49, 0x52, 0x52, 0x6f, 0x4f, 0x81, 0xba, - 0xf0, 0x8f, 0xa1, 0x73, 0x49, 0xca, 0xe8, 0xc6, 0xb2, 0xec, 0x71, 0xec, 0xf2, 0x8f, 0xd0, 0x7b, - 0xc8, 0xcb, 0x54, 0xd0, 0xbc, 0x99, 0x80, 0x1e, 0x40, 0x9f, 0xfe, 0x42, 0x59, 0x96, 0x90, 0x5c, - 0x0d, 0x1e, 0x7c, 0xfe, 0x41, 0xd0, 0x64, 0x20, 0x98, 0x1a, 0x16, 0xae, 0xf8, 0xfe, 0xd7, 0xd0, - 0xff, 0xbe, 0x24, 0xa9, 0x88, 0x13, 0x8a, 0x8e, 0xa0, 0xff, 0xb3, 0x79, 0x36, 0x1b, 0x54, 0xf5, - 0x6d, 0xe5, 0x95, 0xb4, 0xdf, 0x1c, 0xe8, 0xcd, 0x4b, 0xc6, 0x48, 0x7e, 0x8d, 0x3e, 0x84, 0xfd, - 0x82, 0xb0, 0x2c, 0xa1, 0xe1, 0x5a, 0xaa, 0x55, 0x13, 0xda, 0x78, 0xa0, 0x31, 0x65, 0x00, 0x1d, - 0x03, 0x18, 0x4a, 0x51, 0x32, 0x33, 0xc9, 0xd5, 0xc8, 0xbc, 0x64, 0xd2, 0x47, 0xb5, 0x7f, 0x6b, - 0xdc, 0xda, 0xed, 0xc3, 0x2a, 0xae, 0xf5, 0xf9, 0x27, 0xd0, 0x5b, 0xa6, 0xe2, 0x3a, 0xa3, 0x9b, - 0x1d, 0xa7, 0xf8, 0x57, 0x1b, 0xdc, 0x27, 0x71, 0x21, 0x78, 0x94, 0x13, 0xf6, 0x26, 0x62, 0x3f, - 0x05, 0x74, 0x93, 0x12, 0x5e, 0x25, 0x9c, 0x08, 0xaf, 0xad, 0x66, 0x8e, 0x6e, 0x10, 0x1f, 0x4b, - 0xfc, 0xbf, 0xac, 0x9d, 0x41, 0x77, 0x55, 0xae, 0x7f, 0xa2, 0xc2, 0x18, 0x7b, 0xbf, 0xd9, 0xd8, - 0x85, 0xe2, 0x60, 0xc3, 0x45, 0xf7, 0xa0, 0x5b, 0xac, 0xb7, 0x94, 0x11, 0xaf, 0x33, 0x76, 0x4e, - 0xef, 0x62, 0x53, 0xa1, 0x8f, 0xe0, 0xe0, 0x57, 0x9a, 0xf3, 0x50, 0x6c, 0x73, 0x5a, 0x6c, 0x79, - 0xb2, 0xf1, 0xba, 0x6a, 0xc3, 0xa1, 0x44, 0x17, 0x16, 0x94, 0x9a, 0x14, 0x4d, 0x5b, 0xec, 0x29, - 0x8b, 0xae, 0x44, 0xb4, 0xc1, 0x53, 0x18, 0xd5, 0xcb, 0xc6, 0x5e, 0x5f, 0xcd, 0x39, 0xa8, 0x48, - 0xda, 0xdc, 0x14, 0x86, 0x29, 0x8d, 0x88, 0x88, 0x5f, 0xd2, 0xb0, 0xc8, 0x48, 0xea, 0xb9, 0xca, - 0xc4, 0xf8, 0x75, 0x26, 0xe6, 0x19, 0x49, 0xf1, 0xbe, 0x6d, 0x93, 0x95, 0x94, 0x5d, 0x8d, 0xd9, - 0xd0, 0x44, 0x10, 0x0f, 0xc6, 0xad, 0x53, 0x84, 0xab, 0xe1, 0x8f, 0x24, 0x78, 0x8b, 0xa6, 0xa5, - 0x0f, 0xc6, 0x2d, 0xe9, 0xce, 0xa2, 0x5a, 0xfe, 0x14, 0x86, 0x19, 0x2f, 0xe2, 0x5a, 0xd4, 0xfe, - 0x9b, 0x8a, 0xb2, 0x6d, 0x56, 0x54, 0x35, 0x46, 0x8b, 0x1a, 0x6a, 0x51, 0x16, 0xad, 0x44, 0x55, - 0x34, 0x2d, 0xea, 0x40, 0x8b, 0xb2, 0xa8, 0x12, 0xe5, 0xff, 0xe9, 0x40, 0x57, 0x6f, 0x85, 0x3e, - 0x86, 0xd1, 0xba, 0x64, 0x65, 0x72, 0xd3, 0x88, 0xbe, 0x66, 0x77, 0x6a, 0x5c, 0x5b, 0x39, 0x83, - 0x7b, 0xaf, 0x52, 0x6f, 0x5d, 0xb7, 0xc3, 0x57, 0x1a, 0xf4, 0x5b, 0x39, 0x81, 0x41, 0x99, 0x65, - 0x34, 0x0f, 0x57, 0xbc, 0x4c, 0x37, 0xe6, 0xce, 0x81, 0x82, 0x2e, 0x24, 0x72, 0x2b, 0x17, 0x5a, - 0xff, 0x3b, 0x17, 0xa0, 0x3e, 0x32, 0x79, 0x11, 0xf9, 0xd5, 0x55, 0x41, 0xb5, 0x83, 0xbb, 0xd8, - 0x54, 0x12, 0x4f, 0x68, 0x1a, 0x89, 0xad, 0xda, 0x7d, 0x88, 0x4d, 0xe5, 0xff, 0xee, 0x40, 0xdf, - 0x0e, 0x45, 0xf7, 0xa1, 0x93, 0xc8, 0x54, 0xf4, 0x1c, 0xf5, 0x82, 0x4e, 0x9a, 0x35, 0x54, 0xc1, - 0x89, 0x35, 0xbb, 0x39, 0x71, 0xd0, 0x97, 0xe0, 0x56, 0xa9, 0x6b, 0x4c, 0x1d, 0x05, 0x3a, 0x97, - 0x03, 0x9b, 0xcb, 0xc1, 0xc2, 0x32, 0x70, 0x4d, 0xf6, 0xff, 0xde, 0x83, 0xee, 0x4c, 0xa5, 0xfc, - 0xdb, 0x2a, 0xfa, 0x0c, 0x3a, 0x91, 0xcc, 0x69, 0x13, 0xb2, 0xef, 0x35, 0xb7, 0xa9, 0x28, 0xc7, - 0x9a, 0x89, 0xbe, 0x80, 0xde, 0x5a, 0x67, 0xb7, 0x11, 0x7b, 0xdc, 0xdc, 0x64, 0x02, 0x1e, 0x5b, - 0xb6, 0x6c, 0x2c, 0x74, 0xb0, 0xaa, 0x3b, 0xb0, 0xb3, 0xd1, 0xa4, 0x2f, 0xb6, 0x6c, 0xd9, 0x58, - 0xea, 0x20, 0x54, 0xa1, 0xb1, 0xb3, 0xd1, 0xa4, 0x25, 0xb6, 0x6c, 0xf4, 0x0d, 0xb8, 0x5b, 0x9b, - 0x8f, 0x2a, 0x2c, 0x76, 0x1e, 0x4c, 0x15, 0xa3, 0xb8, 0xee, 0x90, 0x89, 0x5a, 0x9d, 0x75, 0xc8, - 0x0a, 0x95, 0x48, 0x2d, 0x3c, 0xa8, 0xb0, 0x59, 0xe1, 0xff, 0xe1, 0xc0, 0xbe, 0x7e, 0x03, 0x8f, - 0x09, 0x8b, 0x93, 0xeb, 0xc6, 0x4f, 0x24, 0x82, 0xf6, 0x96, 0x26, 0x99, 0xf9, 0x42, 0xaa, 0x67, - 0x74, 0x06, 0x6d, 0xa9, 0x51, 0x1d, 0xe1, 0xc1, 0xae, 0x5f, 0xb8, 0x9e, 0xbc, 0xb8, 0xce, 0x28, - 0x56, 0x6c, 0x99, 0xb9, 0xfa, 0xab, 0xee, 0xb5, 0x5f, 0x97, 0xb9, 0xba, 0x0f, 0x1b, 0xee, 0x27, - 0x2b, 0x80, 0x7a, 0x12, 0x1a, 0x40, 0xef, 0xe1, 0xb3, 0xe5, 0xd3, 0xc5, 0x14, 0x8f, 0xde, 0x41, - 0x2e, 0x74, 0x2e, 0xcf, 0x97, 0x97, 0xd3, 0x91, 0x23, 0xf1, 0xf9, 0x72, 0x36, 0x3b, 0xc7, 0x2f, - 0x46, 0x7b, 0xb2, 0x58, 0x3e, 0x5d, 0xbc, 0x78, 0x3e, 0x7d, 0x34, 0x6a, 0xa1, 0x21, 0xb8, 0x4f, - 0xbe, 0x9d, 0x2f, 0x9e, 0x5d, 0xe2, 0xf3, 0xd9, 0xa8, 0x8d, 0xde, 0x85, 0x3b, 0xaa, 0x27, 0xac, - 0xc1, 0xce, 0x05, 0x86, 0xc6, 0x3f, 0x18, 0x3f, 0x3c, 0x88, 0x62, 0xb1, 0x2d, 0x57, 0xc1, 0x9a, - 0xb3, 0x7f, 0xff, 0x45, 0x09, 0x19, 0xdf, 0xd0, 0x64, 0x12, 0xf1, 0xaf, 0x62, 0x1e, 0xd6, 0xab, - 0xa1, 0x5e, 0xfd, 0x27, 0x00, 0x00, 0xff, 0xff, 0x16, 0x77, 0x81, 0x98, 0xd7, 0x08, 0x00, 0x00, +var File_io_prometheus_client_metrics_proto protoreflect.FileDescriptor + +var file_io_prometheus_client_metrics_proto_rawDesc = []byte{ + 0x0a, 0x22, 0x69, 0x6f, 0x2f, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x2f, + 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x2f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x73, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x14, 0x69, 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, + 0x65, 0x75, 0x73, 0x2e, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x1a, 0x1f, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x69, 0x6d, 0x65, + 0x73, 0x74, 0x61, 0x6d, 0x70, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0x35, 0x0a, 0x09, 0x4c, + 0x61, 0x62, 0x65, 0x6c, 0x50, 0x61, 0x69, 0x72, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x14, 0x0a, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, + 0x75, 0x65, 0x22, 0x1d, 0x0a, 0x05, 0x47, 0x61, 0x75, 0x67, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x76, + 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x01, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, + 0x65, 0x22, 0x5b, 0x0a, 0x07, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x65, 0x72, 0x12, 0x14, 0x0a, 0x05, + 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x01, 0x52, 0x05, 0x76, 0x61, 0x6c, + 0x75, 0x65, 0x12, 0x3a, 0x0a, 0x08, 0x65, 0x78, 0x65, 0x6d, 0x70, 0x6c, 0x61, 0x72, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x69, 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, + 0x68, 0x65, 0x75, 0x73, 0x2e, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x2e, 0x45, 0x78, 0x65, 0x6d, + 0x70, 0x6c, 0x61, 0x72, 0x52, 0x08, 0x65, 0x78, 0x65, 0x6d, 0x70, 0x6c, 0x61, 0x72, 0x22, 0x3c, + 0x0a, 0x08, 0x51, 0x75, 0x61, 0x6e, 0x74, 0x69, 0x6c, 0x65, 0x12, 0x1a, 0x0a, 0x08, 0x71, 0x75, + 0x61, 0x6e, 0x74, 0x69, 0x6c, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x01, 0x52, 0x08, 0x71, 0x75, + 0x61, 0x6e, 0x74, 0x69, 0x6c, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x01, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0x87, 0x01, 0x0a, + 0x07, 0x53, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x61, 0x6d, 0x70, + 0x6c, 0x65, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x04, 0x52, 0x0b, + 0x73, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x1d, 0x0a, 0x0a, 0x73, + 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x5f, 0x73, 0x75, 0x6d, 0x18, 0x02, 0x20, 0x01, 0x28, 0x01, 0x52, + 0x09, 0x73, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x53, 0x75, 0x6d, 0x12, 0x3a, 0x0a, 0x08, 0x71, 0x75, + 0x61, 0x6e, 0x74, 0x69, 0x6c, 0x65, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x69, + 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x2e, 0x63, 0x6c, 0x69, + 0x65, 0x6e, 0x74, 0x2e, 0x51, 0x75, 0x61, 0x6e, 0x74, 0x69, 0x6c, 0x65, 0x52, 0x08, 0x71, 0x75, + 0x61, 0x6e, 0x74, 0x69, 0x6c, 0x65, 0x22, 0x1f, 0x0a, 0x07, 0x55, 0x6e, 0x74, 0x79, 0x70, 0x65, + 0x64, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x01, + 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0xe3, 0x04, 0x0a, 0x09, 0x48, 0x69, 0x73, 0x74, + 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x5f, + 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x04, 0x52, 0x0b, 0x73, 0x61, 0x6d, + 0x70, 0x6c, 0x65, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x2c, 0x0a, 0x12, 0x73, 0x61, 0x6d, 0x70, + 0x6c, 0x65, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x5f, 0x66, 0x6c, 0x6f, 0x61, 0x74, 0x18, 0x04, + 0x20, 0x01, 0x28, 0x01, 0x52, 0x10, 0x73, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x43, 0x6f, 0x75, 0x6e, + 0x74, 0x46, 0x6c, 0x6f, 0x61, 0x74, 0x12, 0x1d, 0x0a, 0x0a, 0x73, 0x61, 0x6d, 0x70, 0x6c, 0x65, + 0x5f, 0x73, 0x75, 0x6d, 0x18, 0x02, 0x20, 0x01, 0x28, 0x01, 0x52, 0x09, 0x73, 0x61, 0x6d, 0x70, + 0x6c, 0x65, 0x53, 0x75, 0x6d, 0x12, 0x34, 0x0a, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x18, + 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x69, 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, + 0x74, 0x68, 0x65, 0x75, 0x73, 0x2e, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x2e, 0x42, 0x75, 0x63, + 0x6b, 0x65, 0x74, 0x52, 0x06, 0x62, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x16, 0x0a, 0x06, 0x73, + 0x63, 0x68, 0x65, 0x6d, 0x61, 0x18, 0x05, 0x20, 0x01, 0x28, 0x11, 0x52, 0x06, 0x73, 0x63, 0x68, + 0x65, 0x6d, 0x61, 0x12, 0x25, 0x0a, 0x0e, 0x7a, 0x65, 0x72, 0x6f, 0x5f, 0x74, 0x68, 0x72, 0x65, + 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x18, 0x06, 0x20, 0x01, 0x28, 0x01, 0x52, 0x0d, 0x7a, 0x65, 0x72, + 0x6f, 0x54, 0x68, 0x72, 0x65, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x12, 0x1d, 0x0a, 0x0a, 0x7a, 0x65, + 0x72, 0x6f, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x07, 0x20, 0x01, 0x28, 0x04, 0x52, 0x09, + 0x7a, 0x65, 0x72, 0x6f, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x28, 0x0a, 0x10, 0x7a, 0x65, 0x72, + 0x6f, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x5f, 0x66, 0x6c, 0x6f, 0x61, 0x74, 0x18, 0x08, 0x20, + 0x01, 0x28, 0x01, 0x52, 0x0e, 0x7a, 0x65, 0x72, 0x6f, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x46, 0x6c, + 0x6f, 0x61, 0x74, 0x12, 0x45, 0x0a, 0x0d, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x5f, + 0x73, 0x70, 0x61, 0x6e, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x69, 0x6f, 0x2e, + 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x2e, 0x63, 0x6c, 0x69, 0x65, 0x6e, + 0x74, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x53, 0x70, 0x61, 0x6e, 0x52, 0x0c, 0x6e, 0x65, + 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x53, 0x70, 0x61, 0x6e, 0x12, 0x25, 0x0a, 0x0e, 0x6e, 0x65, + 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x64, 0x65, 0x6c, 0x74, 0x61, 0x18, 0x0a, 0x20, 0x03, + 0x28, 0x12, 0x52, 0x0d, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x44, 0x65, 0x6c, 0x74, + 0x61, 0x12, 0x25, 0x0a, 0x0e, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x63, 0x6f, + 0x75, 0x6e, 0x74, 0x18, 0x0b, 0x20, 0x03, 0x28, 0x01, 0x52, 0x0d, 0x6e, 0x65, 0x67, 0x61, 0x74, + 0x69, 0x76, 0x65, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x45, 0x0a, 0x0d, 0x70, 0x6f, 0x73, 0x69, + 0x74, 0x69, 0x76, 0x65, 0x5f, 0x73, 0x70, 0x61, 0x6e, 0x18, 0x0c, 0x20, 0x03, 0x28, 0x0b, 0x32, + 0x20, 0x2e, 0x69, 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x2e, + 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x2e, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x53, 0x70, 0x61, + 0x6e, 0x52, 0x0c, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x53, 0x70, 0x61, 0x6e, 0x12, + 0x25, 0x0a, 0x0e, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x64, 0x65, 0x6c, 0x74, + 0x61, 0x18, 0x0d, 0x20, 0x03, 0x28, 0x12, 0x52, 0x0d, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, + 0x65, 0x44, 0x65, 0x6c, 0x74, 0x61, 0x12, 0x25, 0x0a, 0x0e, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, + 0x76, 0x65, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x0e, 0x20, 0x03, 0x28, 0x01, 0x52, 0x0d, + 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x22, 0xc6, 0x01, + 0x0a, 0x06, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, 0x12, 0x29, 0x0a, 0x10, 0x63, 0x75, 0x6d, 0x75, + 0x6c, 0x61, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, + 0x28, 0x04, 0x52, 0x0f, 0x63, 0x75, 0x6d, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x76, 0x65, 0x43, 0x6f, + 0x75, 0x6e, 0x74, 0x12, 0x34, 0x0a, 0x16, 0x63, 0x75, 0x6d, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x76, + 0x65, 0x5f, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x5f, 0x66, 0x6c, 0x6f, 0x61, 0x74, 0x18, 0x04, 0x20, + 0x01, 0x28, 0x01, 0x52, 0x14, 0x63, 0x75, 0x6d, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x76, 0x65, 0x43, + 0x6f, 0x75, 0x6e, 0x74, 0x46, 0x6c, 0x6f, 0x61, 0x74, 0x12, 0x1f, 0x0a, 0x0b, 0x75, 0x70, 0x70, + 0x65, 0x72, 0x5f, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x01, 0x52, 0x0a, + 0x75, 0x70, 0x70, 0x65, 0x72, 0x42, 0x6f, 0x75, 0x6e, 0x64, 0x12, 0x3a, 0x0a, 0x08, 0x65, 0x78, + 0x65, 0x6d, 0x70, 0x6c, 0x61, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x69, + 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x2e, 0x63, 0x6c, 0x69, + 0x65, 0x6e, 0x74, 0x2e, 0x45, 0x78, 0x65, 0x6d, 0x70, 0x6c, 0x61, 0x72, 0x52, 0x08, 0x65, 0x78, + 0x65, 0x6d, 0x70, 0x6c, 0x61, 0x72, 0x22, 0x3c, 0x0a, 0x0a, 0x42, 0x75, 0x63, 0x6b, 0x65, 0x74, + 0x53, 0x70, 0x61, 0x6e, 0x12, 0x16, 0x0a, 0x06, 0x6f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x11, 0x52, 0x06, 0x6f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x12, 0x16, 0x0a, 0x06, + 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x06, 0x6c, 0x65, + 0x6e, 0x67, 0x74, 0x68, 0x22, 0x91, 0x01, 0x0a, 0x08, 0x45, 0x78, 0x65, 0x6d, 0x70, 0x6c, 0x61, + 0x72, 0x12, 0x35, 0x0a, 0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, + 0x32, 0x1f, 0x2e, 0x69, 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, + 0x2e, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x50, 0x61, 0x69, + 0x72, 0x52, 0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, + 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x01, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x38, + 0x0a, 0x09, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x52, 0x09, 0x74, + 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x22, 0xff, 0x02, 0x0a, 0x06, 0x4d, 0x65, 0x74, + 0x72, 0x69, 0x63, 0x12, 0x35, 0x0a, 0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x18, 0x01, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x69, 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, + 0x75, 0x73, 0x2e, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x50, + 0x61, 0x69, 0x72, 0x52, 0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x12, 0x31, 0x0a, 0x05, 0x67, 0x61, + 0x75, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x69, 0x6f, 0x2e, 0x70, + 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x2e, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, + 0x2e, 0x47, 0x61, 0x75, 0x67, 0x65, 0x52, 0x05, 0x67, 0x61, 0x75, 0x67, 0x65, 0x12, 0x37, 0x0a, + 0x07, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x65, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, + 0x2e, 0x69, 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x2e, 0x63, + 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x2e, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x65, 0x72, 0x52, 0x07, 0x63, + 0x6f, 0x75, 0x6e, 0x74, 0x65, 0x72, 0x12, 0x37, 0x0a, 0x07, 0x73, 0x75, 0x6d, 0x6d, 0x61, 0x72, + 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x69, 0x6f, 0x2e, 0x70, 0x72, 0x6f, + 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x2e, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x2e, 0x53, + 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x52, 0x07, 0x73, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x12, + 0x37, 0x0a, 0x07, 0x75, 0x6e, 0x74, 0x79, 0x70, 0x65, 0x64, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x1d, 0x2e, 0x69, 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, + 0x2e, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x2e, 0x55, 0x6e, 0x74, 0x79, 0x70, 0x65, 0x64, 0x52, + 0x07, 0x75, 0x6e, 0x74, 0x79, 0x70, 0x65, 0x64, 0x12, 0x3d, 0x0a, 0x09, 0x68, 0x69, 0x73, 0x74, + 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x69, 0x6f, + 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x2e, 0x63, 0x6c, 0x69, 0x65, + 0x6e, 0x74, 0x2e, 0x48, 0x69, 0x73, 0x74, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x52, 0x09, 0x68, 0x69, + 0x73, 0x74, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x12, 0x21, 0x0a, 0x0c, 0x74, 0x69, 0x6d, 0x65, 0x73, + 0x74, 0x61, 0x6d, 0x70, 0x5f, 0x6d, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0b, 0x74, + 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x4d, 0x73, 0x22, 0xa2, 0x01, 0x0a, 0x0c, 0x4d, + 0x65, 0x74, 0x72, 0x69, 0x63, 0x46, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x12, 0x12, 0x0a, 0x04, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, + 0x12, 0x0a, 0x04, 0x68, 0x65, 0x6c, 0x70, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x68, + 0x65, 0x6c, 0x70, 0x12, 0x34, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x0e, 0x32, 0x20, 0x2e, 0x69, 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, + 0x73, 0x2e, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x54, + 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x34, 0x0a, 0x06, 0x6d, 0x65, 0x74, + 0x72, 0x69, 0x63, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x69, 0x6f, 0x2e, 0x70, + 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, 0x2e, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, + 0x2e, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x52, 0x06, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x2a, + 0x62, 0x0a, 0x0a, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0b, 0x0a, + 0x07, 0x43, 0x4f, 0x55, 0x4e, 0x54, 0x45, 0x52, 0x10, 0x00, 0x12, 0x09, 0x0a, 0x05, 0x47, 0x41, + 0x55, 0x47, 0x45, 0x10, 0x01, 0x12, 0x0b, 0x0a, 0x07, 0x53, 0x55, 0x4d, 0x4d, 0x41, 0x52, 0x59, + 0x10, 0x02, 0x12, 0x0b, 0x0a, 0x07, 0x55, 0x4e, 0x54, 0x59, 0x50, 0x45, 0x44, 0x10, 0x03, 0x12, + 0x0d, 0x0a, 0x09, 0x48, 0x49, 0x53, 0x54, 0x4f, 0x47, 0x52, 0x41, 0x4d, 0x10, 0x04, 0x12, 0x13, + 0x0a, 0x0f, 0x47, 0x41, 0x55, 0x47, 0x45, 0x5f, 0x48, 0x49, 0x53, 0x54, 0x4f, 0x47, 0x52, 0x41, + 0x4d, 0x10, 0x05, 0x42, 0x52, 0x0a, 0x14, 0x69, 0x6f, 0x2e, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, + 0x68, 0x65, 0x75, 0x73, 0x2e, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5a, 0x3a, 0x67, 0x69, 0x74, + 0x68, 0x75, 0x62, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, + 0x75, 0x73, 0x2f, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x6d, 0x6f, 0x64, 0x65, 0x6c, 0x2f, + 0x67, 0x6f, 0x3b, 0x69, 0x6f, 0x5f, 0x70, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x65, 0x75, 0x73, + 0x5f, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, +} + +var ( + file_io_prometheus_client_metrics_proto_rawDescOnce sync.Once + file_io_prometheus_client_metrics_proto_rawDescData = file_io_prometheus_client_metrics_proto_rawDesc +) + +func file_io_prometheus_client_metrics_proto_rawDescGZIP() []byte { + file_io_prometheus_client_metrics_proto_rawDescOnce.Do(func() { + file_io_prometheus_client_metrics_proto_rawDescData = protoimpl.X.CompressGZIP(file_io_prometheus_client_metrics_proto_rawDescData) + }) + return file_io_prometheus_client_metrics_proto_rawDescData +} + +var file_io_prometheus_client_metrics_proto_enumTypes = make([]protoimpl.EnumInfo, 1) +var file_io_prometheus_client_metrics_proto_msgTypes = make([]protoimpl.MessageInfo, 12) +var file_io_prometheus_client_metrics_proto_goTypes = []interface{}{ + (MetricType)(0), // 0: io.prometheus.client.MetricType + (*LabelPair)(nil), // 1: io.prometheus.client.LabelPair + (*Gauge)(nil), // 2: io.prometheus.client.Gauge + (*Counter)(nil), // 3: io.prometheus.client.Counter + (*Quantile)(nil), // 4: io.prometheus.client.Quantile + (*Summary)(nil), // 5: io.prometheus.client.Summary + (*Untyped)(nil), // 6: io.prometheus.client.Untyped + (*Histogram)(nil), // 7: io.prometheus.client.Histogram + (*Bucket)(nil), // 8: io.prometheus.client.Bucket + (*BucketSpan)(nil), // 9: io.prometheus.client.BucketSpan + (*Exemplar)(nil), // 10: io.prometheus.client.Exemplar + (*Metric)(nil), // 11: io.prometheus.client.Metric + (*MetricFamily)(nil), // 12: io.prometheus.client.MetricFamily + (*timestamppb.Timestamp)(nil), // 13: google.protobuf.Timestamp +} +var file_io_prometheus_client_metrics_proto_depIdxs = []int32{ + 10, // 0: io.prometheus.client.Counter.exemplar:type_name -> io.prometheus.client.Exemplar + 4, // 1: io.prometheus.client.Summary.quantile:type_name -> io.prometheus.client.Quantile + 8, // 2: io.prometheus.client.Histogram.bucket:type_name -> io.prometheus.client.Bucket + 9, // 3: io.prometheus.client.Histogram.negative_span:type_name -> io.prometheus.client.BucketSpan + 9, // 4: io.prometheus.client.Histogram.positive_span:type_name -> io.prometheus.client.BucketSpan + 10, // 5: io.prometheus.client.Bucket.exemplar:type_name -> io.prometheus.client.Exemplar + 1, // 6: io.prometheus.client.Exemplar.label:type_name -> io.prometheus.client.LabelPair + 13, // 7: io.prometheus.client.Exemplar.timestamp:type_name -> google.protobuf.Timestamp + 1, // 8: io.prometheus.client.Metric.label:type_name -> io.prometheus.client.LabelPair + 2, // 9: io.prometheus.client.Metric.gauge:type_name -> io.prometheus.client.Gauge + 3, // 10: io.prometheus.client.Metric.counter:type_name -> io.prometheus.client.Counter + 5, // 11: io.prometheus.client.Metric.summary:type_name -> io.prometheus.client.Summary + 6, // 12: io.prometheus.client.Metric.untyped:type_name -> io.prometheus.client.Untyped + 7, // 13: io.prometheus.client.Metric.histogram:type_name -> io.prometheus.client.Histogram + 0, // 14: io.prometheus.client.MetricFamily.type:type_name -> io.prometheus.client.MetricType + 11, // 15: io.prometheus.client.MetricFamily.metric:type_name -> io.prometheus.client.Metric + 16, // [16:16] is the sub-list for method output_type + 16, // [16:16] is the sub-list for method input_type + 16, // [16:16] is the sub-list for extension type_name + 16, // [16:16] is the sub-list for extension extendee + 0, // [0:16] is the sub-list for field type_name +} + +func init() { file_io_prometheus_client_metrics_proto_init() } +func file_io_prometheus_client_metrics_proto_init() { + if File_io_prometheus_client_metrics_proto != nil { + return + } + if !protoimpl.UnsafeEnabled { + file_io_prometheus_client_metrics_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*LabelPair); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_io_prometheus_client_metrics_proto_msgTypes[1].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*Gauge); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_io_prometheus_client_metrics_proto_msgTypes[2].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*Counter); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_io_prometheus_client_metrics_proto_msgTypes[3].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*Quantile); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_io_prometheus_client_metrics_proto_msgTypes[4].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*Summary); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_io_prometheus_client_metrics_proto_msgTypes[5].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*Untyped); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_io_prometheus_client_metrics_proto_msgTypes[6].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*Histogram); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_io_prometheus_client_metrics_proto_msgTypes[7].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*Bucket); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_io_prometheus_client_metrics_proto_msgTypes[8].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*BucketSpan); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_io_prometheus_client_metrics_proto_msgTypes[9].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*Exemplar); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_io_prometheus_client_metrics_proto_msgTypes[10].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*Metric); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_io_prometheus_client_metrics_proto_msgTypes[11].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*MetricFamily); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + } + type x struct{} + out := protoimpl.TypeBuilder{ + File: protoimpl.DescBuilder{ + GoPackagePath: reflect.TypeOf(x{}).PkgPath(), + RawDescriptor: file_io_prometheus_client_metrics_proto_rawDesc, + NumEnums: 1, + NumMessages: 12, + NumExtensions: 0, + NumServices: 0, + }, + GoTypes: file_io_prometheus_client_metrics_proto_goTypes, + DependencyIndexes: file_io_prometheus_client_metrics_proto_depIdxs, + EnumInfos: file_io_prometheus_client_metrics_proto_enumTypes, + MessageInfos: file_io_prometheus_client_metrics_proto_msgTypes, + }.Build() + File_io_prometheus_client_metrics_proto = out.File + file_io_prometheus_client_metrics_proto_rawDesc = nil + file_io_prometheus_client_metrics_proto_goTypes = nil + file_io_prometheus_client_metrics_proto_depIdxs = nil } diff --git a/vendor/github.com/prometheus/common/config/http_config.go b/vendor/github.com/prometheus/common/config/http_config.go index 1bc2d06bb6..37aa966748 100644 --- a/vendor/github.com/prometheus/common/config/http_config.go +++ b/vendor/github.com/prometheus/common/config/http_config.go @@ -31,6 +31,7 @@ import ( "time" "github.com/mwitkow/go-conntrack" + "golang.org/x/net/http/httpproxy" "golang.org/x/net/http2" "golang.org/x/oauth2" "golang.org/x/oauth2/clientcredentials" @@ -227,11 +228,26 @@ type OAuth2 struct { Scopes []string `yaml:"scopes,omitempty" json:"scopes,omitempty"` TokenURL string `yaml:"token_url" json:"token_url"` EndpointParams map[string]string `yaml:"endpoint_params,omitempty" json:"endpoint_params,omitempty"` + TLSConfig TLSConfig `yaml:"tls_config,omitempty"` + ProxyConfig `yaml:",inline"` +} - // HTTP proxy server to use to connect to the targets. - ProxyURL URL `yaml:"proxy_url,omitempty" json:"proxy_url,omitempty"` - // TLSConfig is used to connect to the token URL. - TLSConfig TLSConfig `yaml:"tls_config,omitempty"` +// UnmarshalYAML implements the yaml.Unmarshaler interface +func (o *OAuth2) UnmarshalYAML(unmarshal func(interface{}) error) error { + type plain OAuth2 + if err := unmarshal((*plain)(o)); err != nil { + return err + } + return o.ProxyConfig.Validate() +} + +// UnmarshalJSON implements the json.Marshaler interface for URL. +func (o *OAuth2) UnmarshalJSON(data []byte) error { + type plain OAuth2 + if err := json.Unmarshal(data, (*plain)(o)); err != nil { + return err + } + return o.ProxyConfig.Validate() } // SetDirectory joins any relative file paths with dir. @@ -281,13 +297,6 @@ type HTTPClientConfig struct { // The bearer token file for the targets. Deprecated in favour of // Authorization.CredentialsFile. BearerTokenFile string `yaml:"bearer_token_file,omitempty" json:"bearer_token_file,omitempty"` - // HTTP proxy server to use to connect to the targets. - ProxyURL URL `yaml:"proxy_url,omitempty" json:"proxy_url,omitempty"` - // ProxyConnectHeader optionally specifies headers to send to - // proxies during CONNECT requests. Assume that at least _some_ of - // these headers are going to contain secrets and use Secret as the - // value type instead of string. - ProxyConnectHeader Header `yaml:"proxy_connect_header,omitempty" json:"proxy_connect_header,omitempty"` // TLSConfig to use to connect to the targets. TLSConfig TLSConfig `yaml:"tls_config,omitempty" json:"tls_config,omitempty"` // FollowRedirects specifies whether the client should follow HTTP 3xx redirects. @@ -298,6 +307,8 @@ type HTTPClientConfig struct { // The omitempty flag is not set, because it would be hidden from the // marshalled configuration when set to false. EnableHTTP2 bool `yaml:"enable_http2" json:"enable_http2"` + // Proxy configuration. + ProxyConfig `yaml:",inline"` } // SetDirectory joins any relative file paths with dir. @@ -372,8 +383,8 @@ func (c *HTTPClientConfig) Validate() error { return fmt.Errorf("at most one of oauth2 client_secret & client_secret_file must be configured") } } - if len(c.ProxyConnectHeader) > 0 && (c.ProxyURL.URL == nil || c.ProxyURL.String() == "") { - return fmt.Errorf("if proxy_connect_header is configured proxy_url must also be configured") + if err := c.ProxyConfig.Validate(); err != nil { + return err } return nil } @@ -502,8 +513,8 @@ func NewRoundTripperFromConfig(cfg HTTPClientConfig, name string, optFuncs ...HT // The only timeout we care about is the configured scrape timeout. // It is applied on request. So we leave out any timings here. var rt http.RoundTripper = &http.Transport{ - Proxy: http.ProxyURL(cfg.ProxyURL.URL), - ProxyConnectHeader: cfg.ProxyConnectHeader.HTTPHeader(), + Proxy: cfg.ProxyConfig.Proxy(), + ProxyConnectHeader: cfg.ProxyConfig.GetProxyConnectHeader(), MaxIdleConns: 20000, MaxIdleConnsPerHost: 1000, // see https://github.com/golang/go/issues/13801 DisableKeepAlives: !opts.keepAlivesEnabled, @@ -568,8 +579,7 @@ func NewRoundTripperFromConfig(cfg HTTPClientConfig, name string, optFuncs ...HT // No need for a RoundTripper that reloads the CA file automatically. return newRT(tlsConfig) } - - return NewTLSRoundTripper(tlsConfig, cfg.TLSConfig.CAFile, cfg.TLSConfig.CertFile, cfg.TLSConfig.KeyFile, newRT) + return NewTLSRoundTripper(tlsConfig, cfg.TLSConfig.roundTripperSettings(), newRT) } type authorizationCredentialsRoundTripper struct { @@ -724,7 +734,8 @@ func (rt *oauth2RoundTripper) RoundTrip(req *http.Request) (*http.Response, erro tlsTransport := func(tlsConfig *tls.Config) (http.RoundTripper, error) { return &http.Transport{ TLSClientConfig: tlsConfig, - Proxy: http.ProxyURL(rt.config.ProxyURL.URL), + Proxy: rt.config.ProxyConfig.Proxy(), + ProxyConnectHeader: rt.config.ProxyConfig.GetProxyConnectHeader(), DisableKeepAlives: !rt.opts.keepAlivesEnabled, MaxIdleConns: 20, MaxIdleConnsPerHost: 1, // see https://github.com/golang/go/issues/13801 @@ -738,7 +749,7 @@ func (rt *oauth2RoundTripper) RoundTrip(req *http.Request) (*http.Response, erro if len(rt.config.TLSConfig.CAFile) == 0 { t, _ = tlsTransport(tlsConfig) } else { - t, err = NewTLSRoundTripper(tlsConfig, rt.config.TLSConfig.CAFile, rt.config.TLSConfig.CertFile, rt.config.TLSConfig.KeyFile, tlsTransport) + t, err = NewTLSRoundTripper(tlsConfig, rt.config.TLSConfig.roundTripperSettings(), tlsTransport) if err != nil { return nil, err } @@ -805,6 +816,10 @@ func cloneRequest(r *http.Request) *http.Request { // NewTLSConfig creates a new tls.Config from the given TLSConfig. func NewTLSConfig(cfg *TLSConfig) (*tls.Config, error) { + if err := cfg.Validate(); err != nil { + return nil, err + } + tlsConfig := &tls.Config{ InsecureSkipVerify: cfg.InsecureSkipVerify, MinVersion: uint16(cfg.MinVersion), @@ -819,7 +834,11 @@ func NewTLSConfig(cfg *TLSConfig) (*tls.Config, error) { // If a CA cert is provided then let's read it in so we can validate the // scrape target's certificate properly. - if len(cfg.CAFile) > 0 { + if len(cfg.CA) > 0 { + if !updateRootCA(tlsConfig, []byte(cfg.CA)) { + return nil, fmt.Errorf("unable to use inline CA cert") + } + } else if len(cfg.CAFile) > 0 { b, err := readCAFile(cfg.CAFile) if err != nil { return nil, err @@ -832,12 +851,9 @@ func NewTLSConfig(cfg *TLSConfig) (*tls.Config, error) { if len(cfg.ServerName) > 0 { tlsConfig.ServerName = cfg.ServerName } + // If a client cert & key is provided then configure TLS config accordingly. - if len(cfg.CertFile) > 0 && len(cfg.KeyFile) == 0 { - return nil, fmt.Errorf("client cert file %q specified without client key file", cfg.CertFile) - } else if len(cfg.KeyFile) > 0 && len(cfg.CertFile) == 0 { - return nil, fmt.Errorf("client key file %q specified without client cert file", cfg.KeyFile) - } else if len(cfg.CertFile) > 0 && len(cfg.KeyFile) > 0 { + if cfg.usingClientCert() && cfg.usingClientKey() { // Verify that client cert and key are valid. if _, err := cfg.getClientCertificate(nil); err != nil { return nil, err @@ -850,6 +866,12 @@ func NewTLSConfig(cfg *TLSConfig) (*tls.Config, error) { // TLSConfig configures the options for TLS connections. type TLSConfig struct { + // Text of the CA cert to use for the targets. + CA string `yaml:"ca,omitempty" json:"ca,omitempty"` + // Text of the client cert file for the targets. + Cert string `yaml:"cert,omitempty" json:"cert,omitempty"` + // Text of the client key file for the targets. + Key Secret `yaml:"key,omitempty" json:"key,omitempty"` // The CA cert to use for the targets. CAFile string `yaml:"ca_file,omitempty" json:"ca_file,omitempty"` // The client cert file for the targets. @@ -879,29 +901,77 @@ func (c *TLSConfig) SetDirectory(dir string) { // UnmarshalYAML implements the yaml.Unmarshaler interface. func (c *TLSConfig) UnmarshalYAML(unmarshal func(interface{}) error) error { type plain TLSConfig - return unmarshal((*plain)(c)) + if err := unmarshal((*plain)(c)); err != nil { + return err + } + return c.Validate() } -// readCertAndKey reads the cert and key files from the disk. -func readCertAndKey(certFile, keyFile string) ([]byte, []byte, error) { - certData, err := os.ReadFile(certFile) - if err != nil { - return nil, nil, err +// Validate validates the TLSConfig to check that only one of the inlined or +// file-based fields for the TLS CA, client certificate, and client key are +// used. +func (c *TLSConfig) Validate() error { + if len(c.CA) > 0 && len(c.CAFile) > 0 { + return fmt.Errorf("at most one of ca and ca_file must be configured") + } + if len(c.Cert) > 0 && len(c.CertFile) > 0 { + return fmt.Errorf("at most one of cert and cert_file must be configured") + } + if len(c.Key) > 0 && len(c.KeyFile) > 0 { + return fmt.Errorf("at most one of key and key_file must be configured") } - keyData, err := os.ReadFile(keyFile) - if err != nil { - return nil, nil, err + if c.usingClientCert() && !c.usingClientKey() { + return fmt.Errorf("exactly one of key or key_file must be configured when a client certificate is configured") + } else if c.usingClientKey() && !c.usingClientCert() { + return fmt.Errorf("exactly one of cert or cert_file must be configured when a client key is configured") } - return certData, keyData, nil + return nil +} + +func (c *TLSConfig) usingClientCert() bool { + return len(c.Cert) > 0 || len(c.CertFile) > 0 +} + +func (c *TLSConfig) usingClientKey() bool { + return len(c.Key) > 0 || len(c.KeyFile) > 0 +} + +func (c *TLSConfig) roundTripperSettings() TLSRoundTripperSettings { + return TLSRoundTripperSettings{ + CA: c.CA, + CAFile: c.CAFile, + Cert: c.Cert, + CertFile: c.CertFile, + Key: string(c.Key), + KeyFile: c.KeyFile, + } } // getClientCertificate reads the pair of client cert and key from disk and returns a tls.Certificate. func (c *TLSConfig) getClientCertificate(_ *tls.CertificateRequestInfo) (*tls.Certificate, error) { - certData, keyData, err := readCertAndKey(c.CertFile, c.KeyFile) - if err != nil { - return nil, fmt.Errorf("unable to read specified client cert (%s) & key (%s): %s", c.CertFile, c.KeyFile, err) + var ( + certData, keyData []byte + err error + ) + + if c.CertFile != "" { + certData, err = os.ReadFile(c.CertFile) + if err != nil { + return nil, fmt.Errorf("unable to read specified client cert (%s): %s", c.CertFile, err) + } + } else { + certData = []byte(c.Cert) + } + + if c.KeyFile != "" { + keyData, err = os.ReadFile(c.KeyFile) + if err != nil { + return nil, fmt.Errorf("unable to read specified client key (%s): %s", c.KeyFile, err) + } + } else { + keyData = []byte(c.Key) } cert, err := tls.X509KeyPair(certData, keyData) @@ -934,30 +1004,32 @@ func updateRootCA(cfg *tls.Config, b []byte) bool { // tlsRoundTripper is a RoundTripper that updates automatically its TLS // configuration whenever the content of the CA file changes. type tlsRoundTripper struct { - caFile string - certFile string - keyFile string + settings TLSRoundTripperSettings // newRT returns a new RoundTripper. newRT func(*tls.Config) (http.RoundTripper, error) mtx sync.RWMutex rt http.RoundTripper - hashCAFile []byte - hashCertFile []byte - hashKeyFile []byte + hashCAData []byte + hashCertData []byte + hashKeyData []byte tlsConfig *tls.Config } +type TLSRoundTripperSettings struct { + CA, CAFile string + Cert, CertFile string + Key, KeyFile string +} + func NewTLSRoundTripper( cfg *tls.Config, - caFile, certFile, keyFile string, + settings TLSRoundTripperSettings, newRT func(*tls.Config) (http.RoundTripper, error), ) (http.RoundTripper, error) { t := &tlsRoundTripper{ - caFile: caFile, - certFile: certFile, - keyFile: keyFile, + settings: settings, newRT: newRT, tlsConfig: cfg, } @@ -967,7 +1039,7 @@ func NewTLSRoundTripper( return nil, err } t.rt = rt - _, t.hashCAFile, t.hashCertFile, t.hashKeyFile, err = t.getTLSFilesWithHash() + _, t.hashCAData, t.hashCertData, t.hashKeyData, err = t.getTLSDataWithHash() if err != nil { return nil, err } @@ -975,36 +1047,66 @@ func NewTLSRoundTripper( return t, nil } -func (t *tlsRoundTripper) getTLSFilesWithHash() ([]byte, []byte, []byte, []byte, error) { - b1, err := readCAFile(t.caFile) - if err != nil { - return nil, nil, nil, nil, err +func (t *tlsRoundTripper) getTLSDataWithHash() ([]byte, []byte, []byte, []byte, error) { + var ( + caBytes, certBytes, keyBytes []byte + + err error + ) + + if t.settings.CAFile != "" { + caBytes, err = os.ReadFile(t.settings.CAFile) + if err != nil { + return nil, nil, nil, nil, err + } + } else if t.settings.CA != "" { + caBytes = []byte(t.settings.CA) } - h1 := sha256.Sum256(b1) - var h2, h3 [32]byte - if t.certFile != "" { - b2, b3, err := readCertAndKey(t.certFile, t.keyFile) + if t.settings.CertFile != "" { + certBytes, err = os.ReadFile(t.settings.CertFile) if err != nil { return nil, nil, nil, nil, err } - h2, h3 = sha256.Sum256(b2), sha256.Sum256(b3) + } else if t.settings.Cert != "" { + certBytes = []byte(t.settings.Cert) } - return b1, h1[:], h2[:], h3[:], nil + if t.settings.KeyFile != "" { + keyBytes, err = os.ReadFile(t.settings.KeyFile) + if err != nil { + return nil, nil, nil, nil, err + } + } else if t.settings.Key != "" { + keyBytes = []byte(t.settings.Key) + } + + var caHash, certHash, keyHash [32]byte + + if len(caBytes) > 0 { + caHash = sha256.Sum256(caBytes) + } + if len(certBytes) > 0 { + certHash = sha256.Sum256(certBytes) + } + if len(keyBytes) > 0 { + keyHash = sha256.Sum256(keyBytes) + } + + return caBytes, caHash[:], certHash[:], keyHash[:], nil } // RoundTrip implements the http.RoundTrip interface. func (t *tlsRoundTripper) RoundTrip(req *http.Request) (*http.Response, error) { - caData, caHash, certHash, keyHash, err := t.getTLSFilesWithHash() + caData, caHash, certHash, keyHash, err := t.getTLSDataWithHash() if err != nil { return nil, err } t.mtx.RLock() - equal := bytes.Equal(caHash[:], t.hashCAFile) && - bytes.Equal(certHash[:], t.hashCertFile) && - bytes.Equal(keyHash[:], t.hashKeyFile) + equal := bytes.Equal(caHash[:], t.hashCAData) && + bytes.Equal(certHash[:], t.hashCertData) && + bytes.Equal(keyHash[:], t.hashKeyData) rt := t.rt t.mtx.RUnlock() if equal { @@ -1017,7 +1119,7 @@ func (t *tlsRoundTripper) RoundTrip(req *http.Request) (*http.Response, error) { // using GetClientCertificate. tlsConfig := t.tlsConfig.Clone() if !updateRootCA(tlsConfig, caData) { - return nil, fmt.Errorf("unable to use specified CA cert %s", t.caFile) + return nil, fmt.Errorf("unable to use specified CA cert %s", t.settings.CAFile) } rt, err = t.newRT(tlsConfig) if err != nil { @@ -1027,9 +1129,9 @@ func (t *tlsRoundTripper) RoundTrip(req *http.Request) (*http.Response, error) { t.mtx.Lock() t.rt = rt - t.hashCAFile = caHash[:] - t.hashCertFile = certHash[:] - t.hashKeyFile = keyHash[:] + t.hashCAData = caHash[:] + t.hashCertData = certHash[:] + t.hashKeyData = keyHash[:] t.mtx.Unlock() return rt.RoundTrip(req) @@ -1072,3 +1174,78 @@ func (c HTTPClientConfig) String() string { } return string(b) } + +type ProxyConfig struct { + // HTTP proxy server to use to connect to the targets. + ProxyURL URL `yaml:"proxy_url,omitempty" json:"proxy_url,omitempty"` + // NoProxy contains addresses that should not use a proxy. + NoProxy string `yaml:"no_proxy,omitempty" json:"no_proxy,omitempty"` + // ProxyFromEnvironment makes use of net/http ProxyFromEnvironment function + // to determine proxies. + ProxyFromEnvironment bool `yaml:"proxy_from_environment,omitempty" json:"proxy_from_environment,omitempty"` + // ProxyConnectHeader optionally specifies headers to send to + // proxies during CONNECT requests. Assume that at least _some_ of + // these headers are going to contain secrets and use Secret as the + // value type instead of string. + ProxyConnectHeader Header `yaml:"proxy_connect_header,omitempty" json:"proxy_connect_header,omitempty"` + + proxyFunc func(*http.Request) (*url.URL, error) +} + +// UnmarshalYAML implements the yaml.Unmarshaler interface. +func (c *ProxyConfig) Validate() error { + if len(c.ProxyConnectHeader) > 0 && (!c.ProxyFromEnvironment && (c.ProxyURL.URL == nil || c.ProxyURL.String() == "")) { + return fmt.Errorf("if proxy_connect_header is configured, proxy_url or proxy_from_environment must also be configured") + } + if c.ProxyFromEnvironment && c.ProxyURL.URL != nil && c.ProxyURL.String() != "" { + return fmt.Errorf("if proxy_from_environment is configured, proxy_url must not be configured") + } + if c.ProxyFromEnvironment && c.NoProxy != "" { + return fmt.Errorf("if proxy_from_environment is configured, no_proxy must not be configured") + } + if c.ProxyURL.URL == nil && c.NoProxy != "" { + return fmt.Errorf("if no_proxy is configured, proxy_url must also be configured") + } + return nil +} + +// Proxy returns the Proxy URL for a request. +func (c *ProxyConfig) Proxy() (fn func(*http.Request) (*url.URL, error)) { + if c == nil { + return nil + } + defer func() { + fn = c.proxyFunc + }() + if c.proxyFunc != nil { + return + } + if c.ProxyFromEnvironment { + proxyFn := httpproxy.FromEnvironment().ProxyFunc() + c.proxyFunc = func(req *http.Request) (*url.URL, error) { + return proxyFn(req.URL) + } + return + } + if c.ProxyURL.URL != nil && c.ProxyURL.URL.String() != "" { + if c.NoProxy == "" { + c.proxyFunc = http.ProxyURL(c.ProxyURL.URL) + return + } + proxy := &httpproxy.Config{ + HTTPProxy: c.ProxyURL.String(), + HTTPSProxy: c.ProxyURL.String(), + NoProxy: c.NoProxy, + } + proxyFn := proxy.ProxyFunc() + c.proxyFunc = func(req *http.Request) (*url.URL, error) { + return proxyFn(req.URL) + } + } + return +} + +// ProxyConnectHeader() return the Proxy Connext Headers. +func (c *ProxyConfig) GetProxyConnectHeader() http.Header { + return c.ProxyConnectHeader.HTTPHeader() +} diff --git a/vendor/github.com/prometheus/common/expfmt/decode.go b/vendor/github.com/prometheus/common/expfmt/decode.go index f4fc884552..9063978151 100644 --- a/vendor/github.com/prometheus/common/expfmt/decode.go +++ b/vendor/github.com/prometheus/common/expfmt/decode.go @@ -132,7 +132,10 @@ func (d *textDecoder) Decode(v *dto.MetricFamily) error { } // Pick off one MetricFamily per Decode until there's nothing left. for key, fam := range d.fams { - *v = *fam + v.Name = fam.Name + v.Help = fam.Help + v.Type = fam.Type + v.Metric = fam.Metric delete(d.fams, key) return nil } diff --git a/vendor/github.com/prometheus/common/expfmt/encode.go b/vendor/github.com/prometheus/common/expfmt/encode.go index 64dc0eb40c..7f611ffaad 100644 --- a/vendor/github.com/prometheus/common/expfmt/encode.go +++ b/vendor/github.com/prometheus/common/expfmt/encode.go @@ -18,9 +18,9 @@ import ( "io" "net/http" - "github.com/golang/protobuf/proto" //nolint:staticcheck // Ignore SA1019. Need to keep deprecated package for compatibility. "github.com/matttproud/golang_protobuf_extensions/pbutil" "github.com/prometheus/common/internal/bitbucket.org/ww/goautoneg" + "google.golang.org/protobuf/encoding/prototext" dto "github.com/prometheus/client_model/go" ) @@ -99,8 +99,11 @@ func NegotiateIncludingOpenMetrics(h http.Header) Format { if ac.Type == "text" && ac.SubType == "plain" && (ver == TextVersion || ver == "") { return FmtText } - if ac.Type+"/"+ac.SubType == OpenMetricsType && (ver == OpenMetricsVersion || ver == "") { - return FmtOpenMetrics + if ac.Type+"/"+ac.SubType == OpenMetricsType && (ver == OpenMetricsVersion_0_0_1 || ver == OpenMetricsVersion_1_0_0 || ver == "") { + if ver == OpenMetricsVersion_1_0_0 { + return FmtOpenMetrics_1_0_0 + } + return FmtOpenMetrics_0_0_1 } } return FmtText @@ -133,7 +136,7 @@ func NewEncoder(w io.Writer, format Format) Encoder { case FmtProtoText: return encoderCloser{ encode: func(v *dto.MetricFamily) error { - _, err := fmt.Fprintln(w, proto.MarshalTextString(v)) + _, err := fmt.Fprintln(w, prototext.Format(v)) return err }, close: func() error { return nil }, @@ -146,7 +149,7 @@ func NewEncoder(w io.Writer, format Format) Encoder { }, close: func() error { return nil }, } - case FmtOpenMetrics: + case FmtOpenMetrics_0_0_1, FmtOpenMetrics_1_0_0: return encoderCloser{ encode: func(v *dto.MetricFamily) error { _, err := MetricFamilyToOpenMetrics(w, v) diff --git a/vendor/github.com/prometheus/common/expfmt/expfmt.go b/vendor/github.com/prometheus/common/expfmt/expfmt.go index 0f176fa64f..c4cb20f0d3 100644 --- a/vendor/github.com/prometheus/common/expfmt/expfmt.go +++ b/vendor/github.com/prometheus/common/expfmt/expfmt.go @@ -19,20 +19,22 @@ type Format string // Constants to assemble the Content-Type values for the different wire protocols. const ( - TextVersion = "0.0.4" - ProtoType = `application/vnd.google.protobuf` - ProtoProtocol = `io.prometheus.client.MetricFamily` - ProtoFmt = ProtoType + "; proto=" + ProtoProtocol + ";" - OpenMetricsType = `application/openmetrics-text` - OpenMetricsVersion = "0.0.1" + TextVersion = "0.0.4" + ProtoType = `application/vnd.google.protobuf` + ProtoProtocol = `io.prometheus.client.MetricFamily` + ProtoFmt = ProtoType + "; proto=" + ProtoProtocol + ";" + OpenMetricsType = `application/openmetrics-text` + OpenMetricsVersion_0_0_1 = "0.0.1" + OpenMetricsVersion_1_0_0 = "1.0.0" // The Content-Type values for the different wire protocols. - FmtUnknown Format = `<unknown>` - FmtText Format = `text/plain; version=` + TextVersion + `; charset=utf-8` - FmtProtoDelim Format = ProtoFmt + ` encoding=delimited` - FmtProtoText Format = ProtoFmt + ` encoding=text` - FmtProtoCompact Format = ProtoFmt + ` encoding=compact-text` - FmtOpenMetrics Format = OpenMetricsType + `; version=` + OpenMetricsVersion + `; charset=utf-8` + FmtUnknown Format = `<unknown>` + FmtText Format = `text/plain; version=` + TextVersion + `; charset=utf-8` + FmtProtoDelim Format = ProtoFmt + ` encoding=delimited` + FmtProtoText Format = ProtoFmt + ` encoding=text` + FmtProtoCompact Format = ProtoFmt + ` encoding=compact-text` + FmtOpenMetrics_1_0_0 Format = OpenMetricsType + `; version=` + OpenMetricsVersion_1_0_0 + `; charset=utf-8` + FmtOpenMetrics_0_0_1 Format = OpenMetricsType + `; version=` + OpenMetricsVersion_0_0_1 + `; charset=utf-8` ) const ( diff --git a/vendor/github.com/prometheus/common/expfmt/text_parse.go b/vendor/github.com/prometheus/common/expfmt/text_parse.go index ac2482782c..35db1cc9d7 100644 --- a/vendor/github.com/prometheus/common/expfmt/text_parse.go +++ b/vendor/github.com/prometheus/common/expfmt/text_parse.go @@ -24,8 +24,8 @@ import ( dto "github.com/prometheus/client_model/go" - "github.com/golang/protobuf/proto" //nolint:staticcheck // Ignore SA1019. Need to keep deprecated package for compatibility. "github.com/prometheus/common/model" + "google.golang.org/protobuf/proto" ) // A stateFn is a function that represents a state in a state machine. By diff --git a/vendor/github.com/prometheus/common/model/time.go b/vendor/github.com/prometheus/common/model/time.go index c909b8aa8c..5727452c1e 100644 --- a/vendor/github.com/prometheus/common/model/time.go +++ b/vendor/github.com/prometheus/common/model/time.go @@ -18,7 +18,6 @@ import ( "errors" "fmt" "math" - "regexp" "strconv" "strings" "time" @@ -183,54 +182,78 @@ func (d *Duration) Type() string { return "duration" } -var durationRE = regexp.MustCompile("^(([0-9]+)y)?(([0-9]+)w)?(([0-9]+)d)?(([0-9]+)h)?(([0-9]+)m)?(([0-9]+)s)?(([0-9]+)ms)?$") +func isdigit(c byte) bool { return c >= '0' && c <= '9' } + +// Units are required to go in order from biggest to smallest. +// This guards against confusion from "1m1d" being 1 minute + 1 day, not 1 month + 1 day. +var unitMap = map[string]struct { + pos int + mult uint64 +}{ + "ms": {7, uint64(time.Millisecond)}, + "s": {6, uint64(time.Second)}, + "m": {5, uint64(time.Minute)}, + "h": {4, uint64(time.Hour)}, + "d": {3, uint64(24 * time.Hour)}, + "w": {2, uint64(7 * 24 * time.Hour)}, + "y": {1, uint64(365 * 24 * time.Hour)}, +} // ParseDuration parses a string into a time.Duration, assuming that a year // always has 365d, a week always has 7d, and a day always has 24h. -func ParseDuration(durationStr string) (Duration, error) { - switch durationStr { +func ParseDuration(s string) (Duration, error) { + switch s { case "0": // Allow 0 without a unit. return 0, nil case "": return 0, errors.New("empty duration string") } - matches := durationRE.FindStringSubmatch(durationStr) - if matches == nil { - return 0, fmt.Errorf("not a valid duration string: %q", durationStr) - } - var dur time.Duration - // Parse the match at pos `pos` in the regex and use `mult` to turn that - // into ms, then add that value to the total parsed duration. - var overflowErr error - m := func(pos int, mult time.Duration) { - if matches[pos] == "" { - return + orig := s + var dur uint64 + lastUnitPos := 0 + + for s != "" { + if !isdigit(s[0]) { + return 0, fmt.Errorf("not a valid duration string: %q", orig) + } + // Consume [0-9]* + i := 0 + for ; i < len(s) && isdigit(s[i]); i++ { + } + v, err := strconv.ParseUint(s[:i], 10, 0) + if err != nil { + return 0, fmt.Errorf("not a valid duration string: %q", orig) } - n, _ := strconv.Atoi(matches[pos]) + s = s[i:] + // Consume unit. + for i = 0; i < len(s) && !isdigit(s[i]); i++ { + } + if i == 0 { + return 0, fmt.Errorf("not a valid duration string: %q", orig) + } + u := s[:i] + s = s[i:] + unit, ok := unitMap[u] + if !ok { + return 0, fmt.Errorf("unknown unit %q in duration %q", u, orig) + } + if unit.pos <= lastUnitPos { // Units must go in order from biggest to smallest. + return 0, fmt.Errorf("not a valid duration string: %q", orig) + } + lastUnitPos = unit.pos // Check if the provided duration overflows time.Duration (> ~ 290years). - if n > int((1<<63-1)/mult/time.Millisecond) { - overflowErr = errors.New("duration out of range") + if v > 1<<63/unit.mult { + return 0, errors.New("duration out of range") } - d := time.Duration(n) * time.Millisecond - dur += d * mult - - if dur < 0 { - overflowErr = errors.New("duration out of range") + dur += v * unit.mult + if dur > 1<<63-1 { + return 0, errors.New("duration out of range") } } - - m(2, 1000*60*60*24*365) // y - m(4, 1000*60*60*24*7) // w - m(6, 1000*60*60*24) // d - m(8, 1000*60*60) // h - m(10, 1000*60) // m - m(12, 1000) // s - m(14, 1) // ms - - return Duration(dur), overflowErr + return Duration(dur), nil } func (d Duration) String() string { diff --git a/vendor/github.com/prometheus/common/version/info.go b/vendor/github.com/prometheus/common/version/info.go index b3da48a17d..00caa0ba47 100644 --- a/vendor/github.com/prometheus/common/version/info.go +++ b/vendor/github.com/prometheus/common/version/info.go @@ -53,6 +53,7 @@ func NewCollector(program string) prometheus.Collector { "goversion": GoVersion, "goos": GoOS, "goarch": GoArch, + "tags": getTags(), }, }, func() float64 { return 1 }, @@ -66,6 +67,7 @@ var versionInfoTmpl = ` build date: {{.buildDate}} go version: {{.goVersion}} platform: {{.platform}} + tags: {{.tags}} ` // Print returns version information. @@ -79,6 +81,7 @@ func Print(program string) string { "buildDate": BuildDate, "goVersion": GoVersion, "platform": GoOS + "/" + GoArch, + "tags": getTags(), } t := template.Must(template.New("version").Parse(versionInfoTmpl)) @@ -96,5 +99,5 @@ func Info() string { // BuildContext returns goVersion, platform, buildUser and buildDate information. func BuildContext() string { - return fmt.Sprintf("(go=%s, platform=%s, user=%s, date=%s)", GoVersion, GoOS+"/"+GoArch, BuildUser, BuildDate) + return fmt.Sprintf("(go=%s, platform=%s, user=%s, date=%s, tags=%s)", GoVersion, GoOS+"/"+GoArch, BuildUser, BuildDate, getTags()) } diff --git a/vendor/github.com/prometheus/common/version/info_default.go b/vendor/github.com/prometheus/common/version/info_default.go index 2ab0be009c..8eb3a0bf17 100644 --- a/vendor/github.com/prometheus/common/version/info_default.go +++ b/vendor/github.com/prometheus/common/version/info_default.go @@ -19,3 +19,7 @@ package version func getRevision() string { return Revision } + +func getTags() string { + return "unknown" // Not available prior to Go 1.18 +} diff --git a/vendor/github.com/prometheus/common/version/info_go118.go b/vendor/github.com/prometheus/common/version/info_go118.go index bed0f49942..bfc7d41038 100644 --- a/vendor/github.com/prometheus/common/version/info_go118.go +++ b/vendor/github.com/prometheus/common/version/info_go118.go @@ -19,6 +19,7 @@ package version import "runtime/debug" var computedRevision string +var computedTags string func getRevision() string { if Revision != "" { @@ -27,19 +28,24 @@ func getRevision() string { return computedRevision } +func getTags() string { + return computedTags +} + func init() { - computedRevision = computeRevision() + computedRevision, computedTags = computeRevision() } -func computeRevision() string { +func computeRevision() (string, string) { var ( rev = "unknown" + tags = "unknown" modified bool ) buildInfo, ok := debug.ReadBuildInfo() if !ok { - return rev + return rev, tags } for _, v := range buildInfo.Settings { if v.Key == "vcs.revision" { @@ -50,9 +56,12 @@ func computeRevision() string { modified = true } } + if v.Key == "-tags" { + tags = v.Value + } } if modified { - return rev + "-modified" + return rev + "-modified", tags } - return rev + return rev, tags } diff --git a/vendor/github.com/prometheus/procfs/.golangci.yml b/vendor/github.com/prometheus/procfs/.golangci.yml index a197699a1e..c24864a927 100644 --- a/vendor/github.com/prometheus/procfs/.golangci.yml +++ b/vendor/github.com/prometheus/procfs/.golangci.yml @@ -2,6 +2,7 @@ linters: enable: - godot + - misspell - revive linter-settings: @@ -10,3 +11,5 @@ linter-settings: exclude: # Ignore "See: URL" - 'See:' + misspell: + locale: US diff --git a/vendor/github.com/prometheus/procfs/Makefile.common b/vendor/github.com/prometheus/procfs/Makefile.common index 6c8e3e2197..0ce7ea4612 100644 --- a/vendor/github.com/prometheus/procfs/Makefile.common +++ b/vendor/github.com/prometheus/procfs/Makefile.common @@ -49,25 +49,28 @@ endif GOTEST := $(GO) test GOTEST_DIR := ifneq ($(CIRCLE_JOB),) -ifneq ($(shell which gotestsum),) +ifneq ($(shell command -v gotestsum > /dev/null),) GOTEST_DIR := test-results GOTEST := gotestsum --junitfile $(GOTEST_DIR)/unit-tests.xml -- endif endif -PROMU_VERSION ?= 0.13.0 +PROMU_VERSION ?= 0.15.0 PROMU_URL := https://github.com/prometheus/promu/releases/download/v$(PROMU_VERSION)/promu-$(PROMU_VERSION).$(GO_BUILD_PLATFORM).tar.gz +SKIP_GOLANGCI_LINT := GOLANGCI_LINT := GOLANGCI_LINT_OPTS ?= -GOLANGCI_LINT_VERSION ?= v1.45.2 +GOLANGCI_LINT_VERSION ?= v1.53.3 # golangci-lint only supports linux, darwin and windows platforms on i386/amd64. # windows isn't included here because of the path separator being different. ifeq ($(GOHOSTOS),$(filter $(GOHOSTOS),linux darwin)) ifeq ($(GOHOSTARCH),$(filter $(GOHOSTARCH),amd64 i386)) # If we're in CI and there is an Actions file, that means the linter # is being run in Actions, so we don't need to run it here. - ifeq (,$(CIRCLE_JOB)) + ifneq (,$(SKIP_GOLANGCI_LINT)) + GOLANGCI_LINT := + else ifeq (,$(CIRCLE_JOB)) GOLANGCI_LINT := $(FIRST_GOPATH)/bin/golangci-lint else ifeq (,$(wildcard .github/workflows/golangci-lint.yml)) GOLANGCI_LINT := $(FIRST_GOPATH)/bin/golangci-lint @@ -88,6 +91,8 @@ BUILD_DOCKER_ARCHS = $(addprefix common-docker-,$(DOCKER_ARCHS)) PUBLISH_DOCKER_ARCHS = $(addprefix common-docker-publish-,$(DOCKER_ARCHS)) TAG_DOCKER_ARCHS = $(addprefix common-docker-tag-latest-,$(DOCKER_ARCHS)) +SANITIZED_DOCKER_IMAGE_TAG := $(subst +,-,$(DOCKER_IMAGE_TAG)) + ifeq ($(GOHOSTARCH),amd64) ifeq ($(GOHOSTOS),$(filter $(GOHOSTOS),linux freebsd darwin windows)) # Only supported on amd64 @@ -173,7 +178,7 @@ endif .PHONY: common-yamllint common-yamllint: @echo ">> running yamllint on all YAML files in the repository" -ifeq (, $(shell which yamllint)) +ifeq (, $(shell command -v yamllint > /dev/null)) @echo "yamllint not installed so skipping" else yamllint . @@ -202,7 +207,7 @@ common-tarball: promu .PHONY: common-docker $(BUILD_DOCKER_ARCHS) common-docker: $(BUILD_DOCKER_ARCHS) $(BUILD_DOCKER_ARCHS): common-docker-%: - docker build -t "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$*:$(DOCKER_IMAGE_TAG)" \ + docker build -t "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$*:$(SANITIZED_DOCKER_IMAGE_TAG)" \ -f $(DOCKERFILE_PATH) \ --build-arg ARCH="$*" \ --build-arg OS="linux" \ @@ -211,19 +216,19 @@ $(BUILD_DOCKER_ARCHS): common-docker-%: .PHONY: common-docker-publish $(PUBLISH_DOCKER_ARCHS) common-docker-publish: $(PUBLISH_DOCKER_ARCHS) $(PUBLISH_DOCKER_ARCHS): common-docker-publish-%: - docker push "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$*:$(DOCKER_IMAGE_TAG)" + docker push "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$*:$(SANITIZED_DOCKER_IMAGE_TAG)" DOCKER_MAJOR_VERSION_TAG = $(firstword $(subst ., ,$(shell cat VERSION))) .PHONY: common-docker-tag-latest $(TAG_DOCKER_ARCHS) common-docker-tag-latest: $(TAG_DOCKER_ARCHS) $(TAG_DOCKER_ARCHS): common-docker-tag-latest-%: - docker tag "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$*:$(DOCKER_IMAGE_TAG)" "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$*:latest" - docker tag "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$*:$(DOCKER_IMAGE_TAG)" "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$*:v$(DOCKER_MAJOR_VERSION_TAG)" + docker tag "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$*:$(SANITIZED_DOCKER_IMAGE_TAG)" "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$*:latest" + docker tag "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$*:$(SANITIZED_DOCKER_IMAGE_TAG)" "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$*:v$(DOCKER_MAJOR_VERSION_TAG)" .PHONY: common-docker-manifest common-docker-manifest: - DOCKER_CLI_EXPERIMENTAL=enabled docker manifest create -a "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME):$(DOCKER_IMAGE_TAG)" $(foreach ARCH,$(DOCKER_ARCHS),$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$(ARCH):$(DOCKER_IMAGE_TAG)) - DOCKER_CLI_EXPERIMENTAL=enabled docker manifest push "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME):$(DOCKER_IMAGE_TAG)" + DOCKER_CLI_EXPERIMENTAL=enabled docker manifest create -a "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME):$(SANITIZED_DOCKER_IMAGE_TAG)" $(foreach ARCH,$(DOCKER_ARCHS),$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME)-linux-$(ARCH):$(SANITIZED_DOCKER_IMAGE_TAG)) + DOCKER_CLI_EXPERIMENTAL=enabled docker manifest push "$(DOCKER_REPO)/$(DOCKER_IMAGE_NAME):$(SANITIZED_DOCKER_IMAGE_TAG)" .PHONY: promu promu: $(PROMU) diff --git a/vendor/github.com/prometheus/procfs/README.md b/vendor/github.com/prometheus/procfs/README.md index 43c37735a7..1224816c2a 100644 --- a/vendor/github.com/prometheus/procfs/README.md +++ b/vendor/github.com/prometheus/procfs/README.md @@ -51,11 +51,11 @@ ensure the `fixtures` directory is up to date by removing the existing directory extracting the ttar file using `make fixtures/.unpacked` or just `make test`. ```bash -rm -rf fixtures +rm -rf testdata/fixtures make test ``` Next, make the required changes to the extracted files in the `fixtures` directory. When the changes are complete, run `make update_fixtures` to create a new `fixtures.ttar` file based on the updated `fixtures` directory. And finally, verify the changes using -`git diff fixtures.ttar`. +`git diff testdata/fixtures.ttar`. diff --git a/vendor/github.com/prometheus/procfs/arp.go b/vendor/github.com/prometheus/procfs/arp.go index 68f36e888f..28783e2ddc 100644 --- a/vendor/github.com/prometheus/procfs/arp.go +++ b/vendor/github.com/prometheus/procfs/arp.go @@ -55,7 +55,7 @@ type ARPEntry struct { func (fs FS) GatherARPEntries() ([]ARPEntry, error) { data, err := os.ReadFile(fs.proc.Path("net/arp")) if err != nil { - return nil, fmt.Errorf("error reading arp %q: %w", fs.proc.Path("net/arp"), err) + return nil, fmt.Errorf("%s: error reading arp %s: %w", ErrFileRead, fs.proc.Path("net/arp"), err) } return parseARPEntries(data) @@ -78,11 +78,11 @@ func parseARPEntries(data []byte) ([]ARPEntry, error) { } else if width == expectedDataWidth { entry, err := parseARPEntry(columns) if err != nil { - return []ARPEntry{}, fmt.Errorf("failed to parse ARP entry: %w", err) + return []ARPEntry{}, fmt.Errorf("%s: Failed to parse ARP entry: %v: %w", ErrFileParse, entry, err) } entries = append(entries, entry) } else { - return []ARPEntry{}, fmt.Errorf("%d columns were detected, but %d were expected", width, expectedDataWidth) + return []ARPEntry{}, fmt.Errorf("%s: %d columns found, but expected %d: %w", ErrFileParse, width, expectedDataWidth, err) } } diff --git a/vendor/github.com/prometheus/procfs/buddyinfo.go b/vendor/github.com/prometheus/procfs/buddyinfo.go index f5b7939b26..4a173636c9 100644 --- a/vendor/github.com/prometheus/procfs/buddyinfo.go +++ b/vendor/github.com/prometheus/procfs/buddyinfo.go @@ -55,7 +55,7 @@ func parseBuddyInfo(r io.Reader) ([]BuddyInfo, error) { parts := strings.Fields(line) if len(parts) < 4 { - return nil, fmt.Errorf("invalid number of fields when parsing buddyinfo") + return nil, fmt.Errorf("%w: Invalid number of fields, found: %v", ErrFileParse, parts) } node := strings.TrimRight(parts[1], ",") @@ -66,7 +66,7 @@ func parseBuddyInfo(r io.Reader) ([]BuddyInfo, error) { bucketCount = arraySize } else { if bucketCount != arraySize { - return nil, fmt.Errorf("mismatch in number of buddyinfo buckets, previous count %d, new count %d", bucketCount, arraySize) + return nil, fmt.Errorf("%w: mismatch in number of buddyinfo buckets, previous count %d, new count %d", ErrFileParse, bucketCount, arraySize) } } @@ -74,7 +74,7 @@ func parseBuddyInfo(r io.Reader) ([]BuddyInfo, error) { for i := 0; i < arraySize; i++ { sizes[i], err = strconv.ParseFloat(parts[i+4], 64) if err != nil { - return nil, fmt.Errorf("invalid value in buddyinfo: %w", err) + return nil, fmt.Errorf("%s: Invalid valid in buddyinfo: %f: %w", ErrFileParse, sizes[i], err) } } diff --git a/vendor/github.com/prometheus/procfs/cpuinfo.go b/vendor/github.com/prometheus/procfs/cpuinfo.go index ff6b927da1..f4f5501c68 100644 --- a/vendor/github.com/prometheus/procfs/cpuinfo.go +++ b/vendor/github.com/prometheus/procfs/cpuinfo.go @@ -79,7 +79,7 @@ func parseCPUInfoX86(info []byte) ([]CPUInfo, error) { // find the first "processor" line firstLine := firstNonEmptyLine(scanner) if !strings.HasPrefix(firstLine, "processor") || !strings.Contains(firstLine, ":") { - return nil, fmt.Errorf("invalid cpuinfo file: %q", firstLine) + return nil, fmt.Errorf("%w: Cannot parse line: %q", ErrFileParse, firstLine) } field := strings.SplitN(firstLine, ": ", 2) v, err := strconv.ParseUint(field[1], 0, 32) @@ -192,9 +192,10 @@ func parseCPUInfoARM(info []byte) ([]CPUInfo, error) { scanner := bufio.NewScanner(bytes.NewReader(info)) firstLine := firstNonEmptyLine(scanner) - match, _ := regexp.MatchString("^[Pp]rocessor", firstLine) + match, err := regexp.MatchString("^[Pp]rocessor", firstLine) if !match || !strings.Contains(firstLine, ":") { - return nil, fmt.Errorf("invalid cpuinfo file: %q", firstLine) + return nil, fmt.Errorf("%s: Cannot parse line: %q: %w", ErrFileParse, firstLine, err) + } field := strings.SplitN(firstLine, ": ", 2) cpuinfo := []CPUInfo{} @@ -258,7 +259,7 @@ func parseCPUInfoS390X(info []byte) ([]CPUInfo, error) { firstLine := firstNonEmptyLine(scanner) if !strings.HasPrefix(firstLine, "vendor_id") || !strings.Contains(firstLine, ":") { - return nil, fmt.Errorf("invalid cpuinfo file: %q", firstLine) + return nil, fmt.Errorf("%w: Cannot parse line: %q", ErrFileParse, firstLine) } field := strings.SplitN(firstLine, ": ", 2) cpuinfo := []CPUInfo{} @@ -283,7 +284,7 @@ func parseCPUInfoS390X(info []byte) ([]CPUInfo, error) { if strings.HasPrefix(line, "processor") { match := cpuinfoS390XProcessorRegexp.FindStringSubmatch(line) if len(match) < 2 { - return nil, fmt.Errorf("invalid cpuinfo file: %q", firstLine) + return nil, fmt.Errorf("%w: %q", ErrFileParse, firstLine) } cpu := commonCPUInfo v, err := strconv.ParseUint(match[1], 0, 32) @@ -343,7 +344,7 @@ func parseCPUInfoMips(info []byte) ([]CPUInfo, error) { // find the first "processor" line firstLine := firstNonEmptyLine(scanner) if !strings.HasPrefix(firstLine, "system type") || !strings.Contains(firstLine, ":") { - return nil, fmt.Errorf("invalid cpuinfo file: %q", firstLine) + return nil, fmt.Errorf("%w: %q", ErrFileParse, firstLine) } field := strings.SplitN(firstLine, ": ", 2) cpuinfo := []CPUInfo{} @@ -380,12 +381,48 @@ func parseCPUInfoMips(info []byte) ([]CPUInfo, error) { return cpuinfo, nil } +func parseCPUInfoLoong(info []byte) ([]CPUInfo, error) { + scanner := bufio.NewScanner(bytes.NewReader(info)) + // find the first "processor" line + firstLine := firstNonEmptyLine(scanner) + if !strings.HasPrefix(firstLine, "system type") || !strings.Contains(firstLine, ":") { + return nil, errors.New("invalid cpuinfo file: " + firstLine) + } + field := strings.SplitN(firstLine, ": ", 2) + cpuinfo := []CPUInfo{} + systemType := field[1] + i := 0 + for scanner.Scan() { + line := scanner.Text() + if !strings.Contains(line, ":") { + continue + } + field := strings.SplitN(line, ": ", 2) + switch strings.TrimSpace(field[0]) { + case "processor": + v, err := strconv.ParseUint(field[1], 0, 32) + if err != nil { + return nil, err + } + i = int(v) + cpuinfo = append(cpuinfo, CPUInfo{}) // start of the next processor + cpuinfo[i].Processor = uint(v) + cpuinfo[i].VendorID = systemType + case "CPU Family": + cpuinfo[i].CPUFamily = field[1] + case "Model Name": + cpuinfo[i].ModelName = field[1] + } + } + return cpuinfo, nil +} + func parseCPUInfoPPC(info []byte) ([]CPUInfo, error) { scanner := bufio.NewScanner(bytes.NewReader(info)) firstLine := firstNonEmptyLine(scanner) if !strings.HasPrefix(firstLine, "processor") || !strings.Contains(firstLine, ":") { - return nil, fmt.Errorf("invalid cpuinfo file: %q", firstLine) + return nil, fmt.Errorf("%w: %q", ErrFileParse, firstLine) } field := strings.SplitN(firstLine, ": ", 2) v, err := strconv.ParseUint(field[1], 0, 32) @@ -430,7 +467,7 @@ func parseCPUInfoRISCV(info []byte) ([]CPUInfo, error) { firstLine := firstNonEmptyLine(scanner) if !strings.HasPrefix(firstLine, "processor") || !strings.Contains(firstLine, ":") { - return nil, fmt.Errorf("invalid cpuinfo file: %q", firstLine) + return nil, fmt.Errorf("%w: %q", ErrFileParse, firstLine) } field := strings.SplitN(firstLine, ": ", 2) v, err := strconv.ParseUint(field[1], 0, 32) diff --git a/vendor/github.com/prometheus/procfs/cpuinfo_loong64.go b/vendor/github.com/prometheus/procfs/cpuinfo_loong64.go new file mode 100644 index 0000000000..d88442f0ed --- /dev/null +++ b/vendor/github.com/prometheus/procfs/cpuinfo_loong64.go @@ -0,0 +1,19 @@ +// Copyright 2022 The Prometheus Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +//go:build linux +// +build linux + +package procfs + +var parseCPUInfo = parseCPUInfoLoong diff --git a/vendor/github.com/prometheus/procfs/cpuinfo_others.go b/vendor/github.com/prometheus/procfs/cpuinfo_others.go index ea41bf2ca1..a6b2b3127c 100644 --- a/vendor/github.com/prometheus/procfs/cpuinfo_others.go +++ b/vendor/github.com/prometheus/procfs/cpuinfo_others.go @@ -11,8 +11,8 @@ // See the License for the specific language governing permissions and // limitations under the License. -//go:build linux && !386 && !amd64 && !arm && !arm64 && !mips && !mips64 && !mips64le && !mipsle && !ppc64 && !ppc64le && !riscv64 && !s390x -// +build linux,!386,!amd64,!arm,!arm64,!mips,!mips64,!mips64le,!mipsle,!ppc64,!ppc64le,!riscv64,!s390x +//go:build linux && !386 && !amd64 && !arm && !arm64 && !loong64 && !mips && !mips64 && !mips64le && !mipsle && !ppc64 && !ppc64le && !riscv64 && !s390x +// +build linux,!386,!amd64,!arm,!arm64,!loong64,!mips,!mips64,!mips64le,!mipsle,!ppc64,!ppc64le,!riscv64,!s390x package procfs diff --git a/vendor/github.com/prometheus/procfs/crypto.go b/vendor/github.com/prometheus/procfs/crypto.go index 5048ad1f21..9a73e26393 100644 --- a/vendor/github.com/prometheus/procfs/crypto.go +++ b/vendor/github.com/prometheus/procfs/crypto.go @@ -55,12 +55,13 @@ func (fs FS) Crypto() ([]Crypto, error) { path := fs.proc.Path("crypto") b, err := util.ReadFileNoStat(path) if err != nil { - return nil, fmt.Errorf("error reading crypto %q: %w", path, err) + return nil, fmt.Errorf("%s: Cannot read file %v: %w", ErrFileRead, b, err) + } crypto, err := parseCrypto(bytes.NewReader(b)) if err != nil { - return nil, fmt.Errorf("error parsing crypto %q: %w", path, err) + return nil, fmt.Errorf("%s: Cannot parse %v: %w", ErrFileParse, crypto, err) } return crypto, nil @@ -83,7 +84,7 @@ func parseCrypto(r io.Reader) ([]Crypto, error) { kv := strings.Split(text, ":") if len(kv) != 2 { - return nil, fmt.Errorf("malformed crypto line: %q", text) + return nil, fmt.Errorf("%w: Cannot parae line: %q", ErrFileParse, text) } k := strings.TrimSpace(kv[0]) diff --git a/vendor/github.com/prometheus/procfs/doc.go b/vendor/github.com/prometheus/procfs/doc.go index d31a82600f..f9d961e441 100644 --- a/vendor/github.com/prometheus/procfs/doc.go +++ b/vendor/github.com/prometheus/procfs/doc.go @@ -16,30 +16,29 @@ // // Example: // -// package main -// -// import ( -// "fmt" -// "log" -// -// "github.com/prometheus/procfs" -// ) -// -// func main() { -// p, err := procfs.Self() -// if err != nil { -// log.Fatalf("could not get process: %s", err) -// } -// -// stat, err := p.Stat() -// if err != nil { -// log.Fatalf("could not get process stat: %s", err) -// } -// -// fmt.Printf("command: %s\n", stat.Comm) -// fmt.Printf("cpu time: %fs\n", stat.CPUTime()) -// fmt.Printf("vsize: %dB\n", stat.VirtualMemory()) -// fmt.Printf("rss: %dB\n", stat.ResidentMemory()) -// } -// +// package main +// +// import ( +// "fmt" +// "log" +// +// "github.com/prometheus/procfs" +// ) +// +// func main() { +// p, err := procfs.Self() +// if err != nil { +// log.Fatalf("could not get process: %s", err) +// } +// +// stat, err := p.Stat() +// if err != nil { +// log.Fatalf("could not get process stat: %s", err) +// } +// +// fmt.Printf("command: %s\n", stat.Comm) +// fmt.Printf("cpu time: %fs\n", stat.CPUTime()) +// fmt.Printf("vsize: %dB\n", stat.VirtualMemory()) +// fmt.Printf("rss: %dB\n", stat.ResidentMemory()) +// } package procfs diff --git a/vendor/github.com/prometheus/procfs/fs.go b/vendor/github.com/prometheus/procfs/fs.go index 0102ab0fd8..4980c875bf 100644 --- a/vendor/github.com/prometheus/procfs/fs.go +++ b/vendor/github.com/prometheus/procfs/fs.go @@ -20,7 +20,8 @@ import ( // FS represents the pseudo-filesystem sys, which provides an interface to // kernel data structures. type FS struct { - proc fs.FS + proc fs.FS + isReal bool } // DefaultMountPoint is the common mount point of the proc filesystem. @@ -39,5 +40,11 @@ func NewFS(mountPoint string) (FS, error) { if err != nil { return FS{}, err } - return FS{fs}, nil + + isReal, err := isRealProc(mountPoint) + if err != nil { + return FS{}, err + } + + return FS{fs, isReal}, nil } diff --git a/vendor/github.com/prometheus/procfs/fs_statfs_notype.go b/vendor/github.com/prometheus/procfs/fs_statfs_notype.go new file mode 100644 index 0000000000..13d74e3957 --- /dev/null +++ b/vendor/github.com/prometheus/procfs/fs_statfs_notype.go @@ -0,0 +1,23 @@ +// Copyright 2018 The Prometheus Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +//go:build netbsd || openbsd || solaris || windows || nostatfs +// +build netbsd openbsd solaris windows nostatfs + +package procfs + +// isRealProc returns true on architectures that don't have a Type argument +// in their Statfs_t struct +func isRealProc(mountPoint string) (bool, error) { + return true, nil +} diff --git a/vendor/github.com/prometheus/procfs/fs_statfs_type.go b/vendor/github.com/prometheus/procfs/fs_statfs_type.go new file mode 100644 index 0000000000..bee151445a --- /dev/null +++ b/vendor/github.com/prometheus/procfs/fs_statfs_type.go @@ -0,0 +1,33 @@ +// Copyright 2018 The Prometheus Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +//go:build !netbsd && !openbsd && !solaris && !windows && !nostatfs +// +build !netbsd,!openbsd,!solaris,!windows,!nostatfs + +package procfs + +import ( + "syscall" +) + +// isRealProc determines whether supplied mountpoint is really a proc filesystem. +func isRealProc(mountPoint string) (bool, error) { + stat := syscall.Statfs_t{} + err := syscall.Statfs(mountPoint, &stat) + if err != nil { + return false, err + } + + // 0x9fa0 is PROC_SUPER_MAGIC: https://elixir.bootlin.com/linux/v6.1/source/include/uapi/linux/magic.h#L87 + return stat.Type == 0x9fa0, nil +} diff --git a/vendor/github.com/prometheus/procfs/fscache.go b/vendor/github.com/prometheus/procfs/fscache.go index f8070e6e2b..f560a8db30 100644 --- a/vendor/github.com/prometheus/procfs/fscache.go +++ b/vendor/github.com/prometheus/procfs/fscache.go @@ -236,7 +236,7 @@ func (fs FS) Fscacheinfo() (Fscacheinfo, error) { m, err := parseFscacheinfo(bytes.NewReader(b)) if err != nil { - return Fscacheinfo{}, fmt.Errorf("failed to parse Fscacheinfo: %w", err) + return Fscacheinfo{}, fmt.Errorf("%s: Cannot parse %v: %w", ErrFileParse, m, err) } return *m, nil @@ -245,7 +245,7 @@ func (fs FS) Fscacheinfo() (Fscacheinfo, error) { func setFSCacheFields(fields []string, setFields ...*uint64) error { var err error if len(fields) < len(setFields) { - return fmt.Errorf("Insufficient number of fields, expected %v, got %v", len(setFields), len(fields)) + return fmt.Errorf("%s: Expected %d, but got %d: %w", ErrFileParse, len(setFields), len(fields), err) } for i := range setFields { @@ -263,7 +263,7 @@ func parseFscacheinfo(r io.Reader) (*Fscacheinfo, error) { for s.Scan() { fields := strings.Fields(s.Text()) if len(fields) < 2 { - return nil, fmt.Errorf("malformed Fscacheinfo line: %q", s.Text()) + return nil, fmt.Errorf("%w: malformed Fscacheinfo line: %q", ErrFileParse, s.Text()) } switch fields[0] { diff --git a/vendor/github.com/prometheus/procfs/internal/util/parse.go b/vendor/github.com/prometheus/procfs/internal/util/parse.go index b030951faf..14272dc788 100644 --- a/vendor/github.com/prometheus/procfs/internal/util/parse.go +++ b/vendor/github.com/prometheus/procfs/internal/util/parse.go @@ -64,6 +64,21 @@ func ParsePInt64s(ss []string) ([]*int64, error) { return us, nil } +// Parses a uint64 from given hex in string. +func ParseHexUint64s(ss []string) ([]*uint64, error) { + us := make([]*uint64, 0, len(ss)) + for _, s := range ss { + u, err := strconv.ParseUint(s, 16, 64) + if err != nil { + return nil, err + } + + us = append(us, &u) + } + + return us, nil +} + // ReadUintFromFile reads a file and attempts to parse a uint64 from it. func ReadUintFromFile(path string) (uint64, error) { data, err := os.ReadFile(path) diff --git a/vendor/github.com/prometheus/procfs/ipvs.go b/vendor/github.com/prometheus/procfs/ipvs.go index 391c07957e..5a145bbfe1 100644 --- a/vendor/github.com/prometheus/procfs/ipvs.go +++ b/vendor/github.com/prometheus/procfs/ipvs.go @@ -221,15 +221,16 @@ func parseIPPort(s string) (net.IP, uint16, error) { case 46: ip = net.ParseIP(s[1:40]) if ip == nil { - return nil, 0, fmt.Errorf("invalid IPv6 address: %s", s[1:40]) + return nil, 0, fmt.Errorf("%s: Invalid IPv6 addr %s: %w", ErrFileParse, s[1:40], err) } default: - return nil, 0, fmt.Errorf("unexpected IP:Port: %s", s) + return nil, 0, fmt.Errorf("%s: Unexpected IP:Port %s: %w", ErrFileParse, s, err) } portString := s[len(s)-4:] if len(portString) != 4 { - return nil, 0, fmt.Errorf("unexpected port string format: %s", portString) + return nil, 0, + fmt.Errorf("%s: Unexpected port string format %s: %w", ErrFileParse, portString, err) } port, err := strconv.ParseUint(portString, 16, 16) if err != nil { diff --git a/vendor/github.com/prometheus/procfs/loadavg.go b/vendor/github.com/prometheus/procfs/loadavg.go index 0096cafbdf..59465c5bbc 100644 --- a/vendor/github.com/prometheus/procfs/loadavg.go +++ b/vendor/github.com/prometheus/procfs/loadavg.go @@ -44,14 +44,14 @@ func parseLoad(loadavgBytes []byte) (*LoadAvg, error) { loads := make([]float64, 3) parts := strings.Fields(string(loadavgBytes)) if len(parts) < 3 { - return nil, fmt.Errorf("malformed loadavg line: too few fields in loadavg string: %q", string(loadavgBytes)) + return nil, fmt.Errorf("%w: Malformed line %q", ErrFileParse, string(loadavgBytes)) } var err error for i, load := range parts[0:3] { loads[i], err = strconv.ParseFloat(load, 64) if err != nil { - return nil, fmt.Errorf("could not parse load %q: %w", load, err) + return nil, fmt.Errorf("%s: Cannot parse load: %f: %w", ErrFileParse, loads[i], err) } } return &LoadAvg{ diff --git a/vendor/github.com/prometheus/procfs/mdstat.go b/vendor/github.com/prometheus/procfs/mdstat.go index a95c889cb9..fdd4b95445 100644 --- a/vendor/github.com/prometheus/procfs/mdstat.go +++ b/vendor/github.com/prometheus/procfs/mdstat.go @@ -70,7 +70,7 @@ func (fs FS) MDStat() ([]MDStat, error) { } mdstat, err := parseMDStat(data) if err != nil { - return nil, fmt.Errorf("error parsing mdstat %q: %w", fs.proc.Path("mdstat"), err) + return nil, fmt.Errorf("%s: Cannot parse %v: %w", ErrFileParse, fs.proc.Path("mdstat"), err) } return mdstat, nil } @@ -90,13 +90,13 @@ func parseMDStat(mdStatData []byte) ([]MDStat, error) { deviceFields := strings.Fields(line) if len(deviceFields) < 3 { - return nil, fmt.Errorf("not enough fields in mdline (expected at least 3): %s", line) + return nil, fmt.Errorf("%s: Expected 3+ lines, got %q", ErrFileParse, line) } mdName := deviceFields[0] // mdx state := deviceFields[2] // active or inactive if len(lines) <= i+3 { - return nil, fmt.Errorf("error parsing %q: too few lines for md device", mdName) + return nil, fmt.Errorf("%w: Too few lines for md device: %q", ErrFileParse, mdName) } // Failed disks have the suffix (F) & Spare disks have the suffix (S). @@ -105,7 +105,7 @@ func parseMDStat(mdStatData []byte) ([]MDStat, error) { active, total, down, size, err := evalStatusLine(lines[i], lines[i+1]) if err != nil { - return nil, fmt.Errorf("error parsing md device lines: %w", err) + return nil, fmt.Errorf("%s: Cannot parse md device lines: %v: %w", ErrFileParse, active, err) } syncLineIdx := i + 2 @@ -140,7 +140,7 @@ func parseMDStat(mdStatData []byte) ([]MDStat, error) { } else { syncedBlocks, pct, finish, speed, err = evalRecoveryLine(lines[syncLineIdx]) if err != nil { - return nil, fmt.Errorf("error parsing sync line in md device %q: %w", mdName, err) + return nil, fmt.Errorf("%s: Cannot parse sync line in md device: %q: %w", ErrFileParse, mdName, err) } } } @@ -168,13 +168,13 @@ func parseMDStat(mdStatData []byte) ([]MDStat, error) { func evalStatusLine(deviceLine, statusLine string) (active, total, down, size int64, err error) { statusFields := strings.Fields(statusLine) if len(statusFields) < 1 { - return 0, 0, 0, 0, fmt.Errorf("unexpected statusLine %q", statusLine) + return 0, 0, 0, 0, fmt.Errorf("%s: Unexpected statusline %q: %w", ErrFileParse, statusLine, err) } sizeStr := statusFields[0] size, err = strconv.ParseInt(sizeStr, 10, 64) if err != nil { - return 0, 0, 0, 0, fmt.Errorf("unexpected statusLine %q: %w", statusLine, err) + return 0, 0, 0, 0, fmt.Errorf("%s: Unexpected statusline %q: %w", ErrFileParse, statusLine, err) } if strings.Contains(deviceLine, "raid0") || strings.Contains(deviceLine, "linear") { @@ -189,17 +189,17 @@ func evalStatusLine(deviceLine, statusLine string) (active, total, down, size in matches := statusLineRE.FindStringSubmatch(statusLine) if len(matches) != 5 { - return 0, 0, 0, 0, fmt.Errorf("couldn't find all the substring matches: %s", statusLine) + return 0, 0, 0, 0, fmt.Errorf("%s: Could not fild all substring matches %s: %w", ErrFileParse, statusLine, err) } total, err = strconv.ParseInt(matches[2], 10, 64) if err != nil { - return 0, 0, 0, 0, fmt.Errorf("unexpected statusLine %q: %w", statusLine, err) + return 0, 0, 0, 0, fmt.Errorf("%s: Unexpected statusline %q: %w", ErrFileParse, statusLine, err) } active, err = strconv.ParseInt(matches[3], 10, 64) if err != nil { - return 0, 0, 0, 0, fmt.Errorf("unexpected statusLine %q: %w", statusLine, err) + return 0, 0, 0, 0, fmt.Errorf("%s: Unexpected active %d: %w", ErrFileParse, active, err) } down = int64(strings.Count(matches[4], "_")) @@ -209,42 +209,42 @@ func evalStatusLine(deviceLine, statusLine string) (active, total, down, size in func evalRecoveryLine(recoveryLine string) (syncedBlocks int64, pct float64, finish float64, speed float64, err error) { matches := recoveryLineBlocksRE.FindStringSubmatch(recoveryLine) if len(matches) != 2 { - return 0, 0, 0, 0, fmt.Errorf("unexpected recoveryLine: %s", recoveryLine) + return 0, 0, 0, 0, fmt.Errorf("%s: Unexpected recoveryLine %s: %w", ErrFileParse, recoveryLine, err) } syncedBlocks, err = strconv.ParseInt(matches[1], 10, 64) if err != nil { - return 0, 0, 0, 0, fmt.Errorf("error parsing int from recoveryLine %q: %w", recoveryLine, err) + return 0, 0, 0, 0, fmt.Errorf("%s: Unexpected parsing of recoveryLine %q: %w", ErrFileParse, recoveryLine, err) } // Get percentage complete matches = recoveryLinePctRE.FindStringSubmatch(recoveryLine) if len(matches) != 2 { - return syncedBlocks, 0, 0, 0, fmt.Errorf("unexpected recoveryLine matching percentage: %s", recoveryLine) + return syncedBlocks, 0, 0, 0, fmt.Errorf("%w: Unexpected recoveryLine matching percentage %s", ErrFileParse, recoveryLine) } pct, err = strconv.ParseFloat(strings.TrimSpace(matches[1]), 64) if err != nil { - return syncedBlocks, 0, 0, 0, fmt.Errorf("error parsing float from recoveryLine %q: %w", recoveryLine, err) + return syncedBlocks, 0, 0, 0, fmt.Errorf("%w: Error parsing float from recoveryLine %q", ErrFileParse, recoveryLine) } // Get time expected left to complete matches = recoveryLineFinishRE.FindStringSubmatch(recoveryLine) if len(matches) != 2 { - return syncedBlocks, pct, 0, 0, fmt.Errorf("unexpected recoveryLine matching est. finish time: %s", recoveryLine) + return syncedBlocks, pct, 0, 0, fmt.Errorf("%w: Unexpected recoveryLine matching est. finish time: %s", ErrFileParse, recoveryLine) } finish, err = strconv.ParseFloat(matches[1], 64) if err != nil { - return syncedBlocks, pct, 0, 0, fmt.Errorf("error parsing float from recoveryLine %q: %w", recoveryLine, err) + return syncedBlocks, pct, 0, 0, fmt.Errorf("%w: Unable to parse float from recoveryLine: %q", ErrFileParse, recoveryLine) } // Get recovery speed matches = recoveryLineSpeedRE.FindStringSubmatch(recoveryLine) if len(matches) != 2 { - return syncedBlocks, pct, finish, 0, fmt.Errorf("unexpected recoveryLine matching speed: %s", recoveryLine) + return syncedBlocks, pct, finish, 0, fmt.Errorf("%w: Unexpected recoveryLine value: %s", ErrFileParse, recoveryLine) } speed, err = strconv.ParseFloat(matches[1], 64) if err != nil { - return syncedBlocks, pct, finish, 0, fmt.Errorf("error parsing float from recoveryLine %q: %w", recoveryLine, err) + return syncedBlocks, pct, finish, 0, fmt.Errorf("%s: Error parsing float from recoveryLine: %q: %w", ErrFileParse, recoveryLine, err) } return syncedBlocks, pct, finish, speed, nil diff --git a/vendor/github.com/prometheus/procfs/meminfo.go b/vendor/github.com/prometheus/procfs/meminfo.go index f65e174e57..eaf00e2248 100644 --- a/vendor/github.com/prometheus/procfs/meminfo.go +++ b/vendor/github.com/prometheus/procfs/meminfo.go @@ -152,7 +152,7 @@ func (fs FS) Meminfo() (Meminfo, error) { m, err := parseMemInfo(bytes.NewReader(b)) if err != nil { - return Meminfo{}, fmt.Errorf("failed to parse meminfo: %w", err) + return Meminfo{}, fmt.Errorf("%s: %w", ErrFileParse, err) } return *m, nil @@ -165,7 +165,7 @@ func parseMemInfo(r io.Reader) (*Meminfo, error) { // Each line has at least a name and value; we ignore the unit. fields := strings.Fields(s.Text()) if len(fields) < 2 { - return nil, fmt.Errorf("malformed meminfo line: %q", s.Text()) + return nil, fmt.Errorf("%w: Malformed line %q", ErrFileParse, s.Text()) } v, err := strconv.ParseUint(fields[1], 0, 64) diff --git a/vendor/github.com/prometheus/procfs/mountinfo.go b/vendor/github.com/prometheus/procfs/mountinfo.go index 59f4d50558..388ebf396d 100644 --- a/vendor/github.com/prometheus/procfs/mountinfo.go +++ b/vendor/github.com/prometheus/procfs/mountinfo.go @@ -78,11 +78,11 @@ func parseMountInfoString(mountString string) (*MountInfo, error) { mountInfo := strings.Split(mountString, " ") mountInfoLength := len(mountInfo) if mountInfoLength < 10 { - return nil, fmt.Errorf("couldn't find enough fields in mount string: %s", mountString) + return nil, fmt.Errorf("%w: Too few fields in mount string: %s", ErrFileParse, mountString) } if mountInfo[mountInfoLength-4] != "-" { - return nil, fmt.Errorf("couldn't find separator in expected field: %s", mountInfo[mountInfoLength-4]) + return nil, fmt.Errorf("%w: couldn't find separator in expected field: %s", ErrFileParse, mountInfo[mountInfoLength-4]) } mount := &MountInfo{ @@ -98,18 +98,18 @@ func parseMountInfoString(mountString string) (*MountInfo, error) { mount.MountID, err = strconv.Atoi(mountInfo[0]) if err != nil { - return nil, fmt.Errorf("failed to parse mount ID") + return nil, fmt.Errorf("%w: mount ID: %q", ErrFileParse, mount.MountID) } mount.ParentID, err = strconv.Atoi(mountInfo[1]) if err != nil { - return nil, fmt.Errorf("failed to parse parent ID") + return nil, fmt.Errorf("%w: parent ID: %q", ErrFileParse, mount.ParentID) } // Has optional fields, which is a space separated list of values. // Example: shared:2 master:7 if mountInfo[6] != "" { mount.OptionalFields, err = mountOptionsParseOptionalFields(mountInfo[6 : mountInfoLength-4]) if err != nil { - return nil, err + return nil, fmt.Errorf("%s: %w", ErrFileParse, err) } } return mount, nil diff --git a/vendor/github.com/prometheus/procfs/mountstats.go b/vendor/github.com/prometheus/procfs/mountstats.go index f7a828bb1d..852c8c4a0e 100644 --- a/vendor/github.com/prometheus/procfs/mountstats.go +++ b/vendor/github.com/prometheus/procfs/mountstats.go @@ -186,6 +186,8 @@ type NFSOperationStats struct { CumulativeTotalResponseMilliseconds uint64 // Duration from when a request was enqueued to when it was completely handled. CumulativeTotalRequestMilliseconds uint64 + // The average time from the point the client sends RPC requests until it receives the response. + AverageRTTMilliseconds float64 // The count of operations that complete with tk_status < 0. These statuses usually indicate error conditions. Errors uint64 } @@ -264,7 +266,7 @@ func parseMountStats(r io.Reader) ([]*Mount, error) { if len(ss) > deviceEntryLen { // Only NFSv3 and v4 are supported for parsing statistics if m.Type != nfs3Type && m.Type != nfs4Type { - return nil, fmt.Errorf("cannot parse MountStats for fstype %q", m.Type) + return nil, fmt.Errorf("%w: Cannot parse MountStats for %q", ErrFileParse, m.Type) } statVersion := strings.TrimPrefix(ss[8], statVersionPrefix) @@ -284,10 +286,11 @@ func parseMountStats(r io.Reader) ([]*Mount, error) { } // parseMount parses an entry in /proc/[pid]/mountstats in the format: -// device [device] mounted on [mount] with fstype [type] +// +// device [device] mounted on [mount] with fstype [type] func parseMount(ss []string) (*Mount, error) { if len(ss) < deviceEntryLen { - return nil, fmt.Errorf("invalid device entry: %v", ss) + return nil, fmt.Errorf("%w: Invalid device %q", ErrFileParse, ss) } // Check for specific words appearing at specific indices to ensure @@ -305,7 +308,7 @@ func parseMount(ss []string) (*Mount, error) { for _, f := range format { if ss[f.i] != f.s { - return nil, fmt.Errorf("invalid device entry: %v", ss) + return nil, fmt.Errorf("%w: Invalid device %q", ErrFileParse, ss) } } @@ -342,7 +345,7 @@ func parseMountStatsNFS(s *bufio.Scanner, statVersion string) (*MountStatsNFS, e switch ss[0] { case fieldOpts: if len(ss) < 2 { - return nil, fmt.Errorf("not enough information for NFS stats: %v", ss) + return nil, fmt.Errorf("%w: Incomplete information for NFS stats: %v", ErrFileParse, ss) } if stats.Opts == nil { stats.Opts = map[string]string{} @@ -357,7 +360,7 @@ func parseMountStatsNFS(s *bufio.Scanner, statVersion string) (*MountStatsNFS, e } case fieldAge: if len(ss) < 2 { - return nil, fmt.Errorf("not enough information for NFS stats: %v", ss) + return nil, fmt.Errorf("%w: Incomplete information for NFS stats: %v", ErrFileParse, ss) } // Age integer is in seconds d, err := time.ParseDuration(ss[1] + "s") @@ -368,7 +371,7 @@ func parseMountStatsNFS(s *bufio.Scanner, statVersion string) (*MountStatsNFS, e stats.Age = d case fieldBytes: if len(ss) < 2 { - return nil, fmt.Errorf("not enough information for NFS stats: %v", ss) + return nil, fmt.Errorf("%w: Incomplete information for NFS stats: %v", ErrFileParse, ss) } bstats, err := parseNFSBytesStats(ss[1:]) if err != nil { @@ -378,7 +381,7 @@ func parseMountStatsNFS(s *bufio.Scanner, statVersion string) (*MountStatsNFS, e stats.Bytes = *bstats case fieldEvents: if len(ss) < 2 { - return nil, fmt.Errorf("not enough information for NFS stats: %v", ss) + return nil, fmt.Errorf("%w: Incomplete information for NFS events: %v", ErrFileParse, ss) } estats, err := parseNFSEventsStats(ss[1:]) if err != nil { @@ -388,7 +391,7 @@ func parseMountStatsNFS(s *bufio.Scanner, statVersion string) (*MountStatsNFS, e stats.Events = *estats case fieldTransport: if len(ss) < 3 { - return nil, fmt.Errorf("not enough information for NFS transport stats: %v", ss) + return nil, fmt.Errorf("%w: Incomplete information for NFS transport stats: %v", ErrFileParse, ss) } tstats, err := parseNFSTransportStats(ss[1:], statVersion) @@ -427,7 +430,7 @@ func parseMountStatsNFS(s *bufio.Scanner, statVersion string) (*MountStatsNFS, e // integer fields. func parseNFSBytesStats(ss []string) (*NFSBytesStats, error) { if len(ss) != fieldBytesLen { - return nil, fmt.Errorf("invalid NFS bytes stats: %v", ss) + return nil, fmt.Errorf("%w: Invalid NFS bytes stats: %v", ErrFileParse, ss) } ns := make([]uint64, 0, fieldBytesLen) @@ -456,7 +459,7 @@ func parseNFSBytesStats(ss []string) (*NFSBytesStats, error) { // integer fields. func parseNFSEventsStats(ss []string) (*NFSEventsStats, error) { if len(ss) != fieldEventsLen { - return nil, fmt.Errorf("invalid NFS events stats: %v", ss) + return nil, fmt.Errorf("%w: invalid NFS events stats: %v", ErrFileParse, ss) } ns := make([]uint64, 0, fieldEventsLen) @@ -520,7 +523,7 @@ func parseNFSOperationStats(s *bufio.Scanner) ([]NFSOperationStats, error) { } if len(ss) < minFields { - return nil, fmt.Errorf("invalid NFS per-operations stats: %v", ss) + return nil, fmt.Errorf("%w: invalid NFS per-operations stats: %v", ErrFileParse, ss) } // Skip string operation name for integers @@ -533,7 +536,6 @@ func parseNFSOperationStats(s *bufio.Scanner) ([]NFSOperationStats, error) { ns = append(ns, n) } - opStats := NFSOperationStats{ Operation: strings.TrimSuffix(ss[0], ":"), Requests: ns[0], @@ -545,6 +547,9 @@ func parseNFSOperationStats(s *bufio.Scanner) ([]NFSOperationStats, error) { CumulativeTotalResponseMilliseconds: ns[6], CumulativeTotalRequestMilliseconds: ns[7], } + if ns[0] != 0 { + opStats.AverageRTTMilliseconds = float64(ns[6]) / float64(ns[0]) + } if len(ns) > 8 { opStats.Errors = ns[8] @@ -571,10 +576,10 @@ func parseNFSTransportStats(ss []string, statVersion string) (*NFSTransportStats } else if protocol == "udp" { expectedLength = fieldTransport10UDPLen } else { - return nil, fmt.Errorf("invalid NFS protocol \"%s\" in stats 1.0 statement: %v", protocol, ss) + return nil, fmt.Errorf("%w: Invalid NFS protocol \"%s\" in stats 1.0 statement: %v", ErrFileParse, protocol, ss) } if len(ss) != expectedLength { - return nil, fmt.Errorf("invalid NFS transport stats 1.0 statement: %v", ss) + return nil, fmt.Errorf("%w: Invalid NFS transport stats 1.0 statement: %v", ErrFileParse, ss) } case statVersion11: var expectedLength int @@ -583,13 +588,13 @@ func parseNFSTransportStats(ss []string, statVersion string) (*NFSTransportStats } else if protocol == "udp" { expectedLength = fieldTransport11UDPLen } else { - return nil, fmt.Errorf("invalid NFS protocol \"%s\" in stats 1.1 statement: %v", protocol, ss) + return nil, fmt.Errorf("%w: invalid NFS protocol \"%s\" in stats 1.1 statement: %v", ErrFileParse, protocol, ss) } if len(ss) != expectedLength { - return nil, fmt.Errorf("invalid NFS transport stats 1.1 statement: %v", ss) + return nil, fmt.Errorf("%w: invalid NFS transport stats 1.1 statement: %v", ErrFileParse, ss) } default: - return nil, fmt.Errorf("unrecognized NFS transport stats version: %q", statVersion) + return nil, fmt.Errorf("%s: Unrecognized NFS transport stats version: %q", ErrFileParse, statVersion) } // Allocate enough for v1.1 stats since zero value for v1.1 stats will be okay diff --git a/vendor/github.com/prometheus/procfs/net_conntrackstat.go b/vendor/github.com/prometheus/procfs/net_conntrackstat.go index 8300daca05..fdfa456119 100644 --- a/vendor/github.com/prometheus/procfs/net_conntrackstat.go +++ b/vendor/github.com/prometheus/procfs/net_conntrackstat.go @@ -18,7 +18,6 @@ import ( "bytes" "fmt" "io" - "strconv" "strings" "github.com/prometheus/procfs/internal/util" @@ -28,9 +27,13 @@ import ( // and contains netfilter conntrack statistics at one CPU core. type ConntrackStatEntry struct { Entries uint64 + Searched uint64 Found uint64 + New uint64 Invalid uint64 Ignore uint64 + Delete uint64 + DeleteList uint64 Insert uint64 InsertFailed uint64 Drop uint64 @@ -55,7 +58,7 @@ func readConntrackStat(path string) ([]ConntrackStatEntry, error) { stat, err := parseConntrackStat(bytes.NewReader(b)) if err != nil { - return nil, fmt.Errorf("failed to read conntrack stats from %q: %w", path, err) + return nil, fmt.Errorf("%s: Cannot read file: %v: %w", ErrFileRead, path, err) } return stat, nil @@ -81,73 +84,35 @@ func parseConntrackStat(r io.Reader) ([]ConntrackStatEntry, error) { // Parses a ConntrackStatEntry from given array of fields. func parseConntrackStatEntry(fields []string) (*ConntrackStatEntry, error) { - if len(fields) != 17 { - return nil, fmt.Errorf("invalid conntrackstat entry, missing fields") - } - entry := &ConntrackStatEntry{} - - entries, err := parseConntrackStatField(fields[0]) - if err != nil { - return nil, err - } - entry.Entries = entries - - found, err := parseConntrackStatField(fields[2]) - if err != nil { - return nil, err - } - entry.Found = found - - invalid, err := parseConntrackStatField(fields[4]) - if err != nil { - return nil, err - } - entry.Invalid = invalid - - ignore, err := parseConntrackStatField(fields[5]) - if err != nil { - return nil, err - } - entry.Ignore = ignore - - insert, err := parseConntrackStatField(fields[8]) + entries, err := util.ParseHexUint64s(fields) if err != nil { - return nil, err + return nil, fmt.Errorf("%s: Cannot parse entry: %d: %w", ErrFileParse, entries, err) } - entry.Insert = insert - - insertFailed, err := parseConntrackStatField(fields[9]) - if err != nil { - return nil, err + numEntries := len(entries) + if numEntries < 16 || numEntries > 17 { + return nil, + fmt.Errorf("%w: invalid conntrackstat entry, invalid number of fields: %d", ErrFileParse, numEntries) } - entry.InsertFailed = insertFailed - drop, err := parseConntrackStatField(fields[10]) - if err != nil { - return nil, err + stats := &ConntrackStatEntry{ + Entries: *entries[0], + Searched: *entries[1], + Found: *entries[2], + New: *entries[3], + Invalid: *entries[4], + Ignore: *entries[5], + Delete: *entries[6], + DeleteList: *entries[7], + Insert: *entries[8], + InsertFailed: *entries[9], + Drop: *entries[10], + EarlyDrop: *entries[11], } - entry.Drop = drop - earlyDrop, err := parseConntrackStatField(fields[11]) - if err != nil { - return nil, err + // Ignore missing search_restart on Linux < 2.6.35. + if numEntries == 17 { + stats.SearchRestart = *entries[16] } - entry.EarlyDrop = earlyDrop - searchRestart, err := parseConntrackStatField(fields[16]) - if err != nil { - return nil, err - } - entry.SearchRestart = searchRestart - - return entry, nil -} - -// Parses a uint64 from given hex in string. -func parseConntrackStatField(field string) (uint64, error) { - val, err := strconv.ParseUint(field, 16, 64) - if err != nil { - return 0, fmt.Errorf("couldn't parse %q field: %w", field, err) - } - return val, err + return stats, nil } diff --git a/vendor/github.com/prometheus/procfs/net_ip_socket.go b/vendor/github.com/prometheus/procfs/net_ip_socket.go index 7fd57d7f46..4da81ea577 100644 --- a/vendor/github.com/prometheus/procfs/net_ip_socket.go +++ b/vendor/github.com/prometheus/procfs/net_ip_socket.go @@ -130,7 +130,7 @@ func parseIP(hexIP string) (net.IP, error) { var byteIP []byte byteIP, err := hex.DecodeString(hexIP) if err != nil { - return nil, fmt.Errorf("cannot parse address field in socket line %q", hexIP) + return nil, fmt.Errorf("%s: Cannot parse socket field in %q: %w", ErrFileParse, hexIP, err) } switch len(byteIP) { case 4: @@ -144,7 +144,7 @@ func parseIP(hexIP string) (net.IP, error) { } return i, nil default: - return nil, fmt.Errorf("Unable to parse IP %s", hexIP) + return nil, fmt.Errorf("%s: Unable to parse IP %s: %w", ErrFileParse, hexIP, nil) } } @@ -153,7 +153,8 @@ func parseNetIPSocketLine(fields []string) (*netIPSocketLine, error) { line := &netIPSocketLine{} if len(fields) < 10 { return nil, fmt.Errorf( - "cannot parse net socket line as it has less then 10 columns %q", + "%w: Less than 10 columns found %q", + ErrFileParse, strings.Join(fields, " "), ) } @@ -162,64 +163,65 @@ func parseNetIPSocketLine(fields []string) (*netIPSocketLine, error) { // sl s := strings.Split(fields[0], ":") if len(s) != 2 { - return nil, fmt.Errorf("cannot parse sl field in socket line %q", fields[0]) + return nil, fmt.Errorf("%w: Unable to parse sl field in line %q", ErrFileParse, fields[0]) } if line.Sl, err = strconv.ParseUint(s[0], 0, 64); err != nil { - return nil, fmt.Errorf("cannot parse sl value in socket line: %w", err) + return nil, fmt.Errorf("%s: Unable to parse sl field in %q: %w", ErrFileParse, line.Sl, err) } // local_address l := strings.Split(fields[1], ":") if len(l) != 2 { - return nil, fmt.Errorf("cannot parse local_address field in socket line %q", fields[1]) + return nil, fmt.Errorf("%w: Unable to parse local_address field in %q", ErrFileParse, fields[1]) } if line.LocalAddr, err = parseIP(l[0]); err != nil { return nil, err } if line.LocalPort, err = strconv.ParseUint(l[1], 16, 64); err != nil { - return nil, fmt.Errorf("cannot parse local_address port value in socket line: %w", err) + return nil, fmt.Errorf("%s: Unable to parse local_address port value line %q: %w", ErrFileParse, line.LocalPort, err) } // remote_address r := strings.Split(fields[2], ":") if len(r) != 2 { - return nil, fmt.Errorf("cannot parse rem_address field in socket line %q", fields[1]) + return nil, fmt.Errorf("%w: Unable to parse rem_address field in %q", ErrFileParse, fields[1]) } if line.RemAddr, err = parseIP(r[0]); err != nil { return nil, err } if line.RemPort, err = strconv.ParseUint(r[1], 16, 64); err != nil { - return nil, fmt.Errorf("cannot parse rem_address port value in socket line: %w", err) + return nil, fmt.Errorf("%s: Cannot parse rem_address port value in %q: %w", ErrFileParse, line.RemPort, err) } // st if line.St, err = strconv.ParseUint(fields[3], 16, 64); err != nil { - return nil, fmt.Errorf("cannot parse st value in socket line: %w", err) + return nil, fmt.Errorf("%s: Cannot parse st value in %q: %w", ErrFileParse, line.St, err) } // tx_queue and rx_queue q := strings.Split(fields[4], ":") if len(q) != 2 { return nil, fmt.Errorf( - "cannot parse tx/rx queues in socket line as it has a missing colon %q", + "%w: Missing colon for tx/rx queues in socket line %q", + ErrFileParse, fields[4], ) } if line.TxQueue, err = strconv.ParseUint(q[0], 16, 64); err != nil { - return nil, fmt.Errorf("cannot parse tx_queue value in socket line: %w", err) + return nil, fmt.Errorf("%s: Cannot parse tx_queue value in %q: %w", ErrFileParse, line.TxQueue, err) } if line.RxQueue, err = strconv.ParseUint(q[1], 16, 64); err != nil { - return nil, fmt.Errorf("cannot parse rx_queue value in socket line: %w", err) + return nil, fmt.Errorf("%s: Cannot parse trx_queue value in %q: %w", ErrFileParse, line.RxQueue, err) } // uid if line.UID, err = strconv.ParseUint(fields[7], 0, 64); err != nil { - return nil, fmt.Errorf("cannot parse uid value in socket line: %w", err) + return nil, fmt.Errorf("%s: Cannot parse UID value in %q: %w", ErrFileParse, line.UID, err) } // inode if line.Inode, err = strconv.ParseUint(fields[9], 0, 64); err != nil { - return nil, fmt.Errorf("cannot parse inode value in socket line: %w", err) + return nil, fmt.Errorf("%s: Cannot parse inode value in %q: %w", ErrFileParse, line.Inode, err) } return line, nil diff --git a/vendor/github.com/prometheus/procfs/net_protocols.go b/vendor/github.com/prometheus/procfs/net_protocols.go index 374b6f73f8..b6c77b709f 100644 --- a/vendor/github.com/prometheus/procfs/net_protocols.go +++ b/vendor/github.com/prometheus/procfs/net_protocols.go @@ -131,7 +131,7 @@ func (ps NetProtocolStats) parseLine(rawLine string) (*NetProtocolStatLine, erro } else if fields[6] == disabled { line.Slab = false } else { - return nil, fmt.Errorf("unable to parse capability for protocol: %s", line.Name) + return nil, fmt.Errorf("%w: capability for protocol: %s", ErrFileParse, line.Name) } line.ModuleName = fields[7] @@ -173,7 +173,7 @@ func (pc *NetProtocolCapabilities) parseCapabilities(capabilities []string) erro } else if capabilities[i] == "n" { *capabilityFields[i] = false } else { - return fmt.Errorf("unable to parse capability block for protocol: position %d", i) + return fmt.Errorf("%w: capability block for protocol: position %d", ErrFileParse, i) } } return nil diff --git a/vendor/github.com/prometheus/procfs/net_route.go b/vendor/github.com/prometheus/procfs/net_route.go new file mode 100644 index 0000000000..deb7029fe1 --- /dev/null +++ b/vendor/github.com/prometheus/procfs/net_route.go @@ -0,0 +1,143 @@ +// Copyright 2023 The Prometheus Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package procfs + +import ( + "bufio" + "bytes" + "fmt" + "io" + "strconv" + "strings" + + "github.com/prometheus/procfs/internal/util" +) + +const ( + blackholeRepresentation string = "*" + blackholeIfaceName string = "blackhole" + routeLineColumns int = 11 +) + +// A NetRouteLine represents one line from net/route. +type NetRouteLine struct { + Iface string + Destination uint32 + Gateway uint32 + Flags uint32 + RefCnt uint32 + Use uint32 + Metric uint32 + Mask uint32 + MTU uint32 + Window uint32 + IRTT uint32 +} + +func (fs FS) NetRoute() ([]NetRouteLine, error) { + return readNetRoute(fs.proc.Path("net", "route")) +} + +func readNetRoute(path string) ([]NetRouteLine, error) { + b, err := util.ReadFileNoStat(path) + if err != nil { + return nil, err + } + + routelines, err := parseNetRoute(bytes.NewReader(b)) + if err != nil { + return nil, fmt.Errorf("failed to read net route from %s: %w", path, err) + } + return routelines, nil +} + +func parseNetRoute(r io.Reader) ([]NetRouteLine, error) { + var routelines []NetRouteLine + + scanner := bufio.NewScanner(r) + scanner.Scan() + for scanner.Scan() { + fields := strings.Fields(scanner.Text()) + routeline, err := parseNetRouteLine(fields) + if err != nil { + return nil, err + } + routelines = append(routelines, *routeline) + } + return routelines, nil +} + +func parseNetRouteLine(fields []string) (*NetRouteLine, error) { + if len(fields) != routeLineColumns { + return nil, fmt.Errorf("invalid routeline, num of digits: %d", len(fields)) + } + iface := fields[0] + if iface == blackholeRepresentation { + iface = blackholeIfaceName + } + destination, err := strconv.ParseUint(fields[1], 16, 32) + if err != nil { + return nil, err + } + gateway, err := strconv.ParseUint(fields[2], 16, 32) + if err != nil { + return nil, err + } + flags, err := strconv.ParseUint(fields[3], 10, 32) + if err != nil { + return nil, err + } + refcnt, err := strconv.ParseUint(fields[4], 10, 32) + if err != nil { + return nil, err + } + use, err := strconv.ParseUint(fields[5], 10, 32) + if err != nil { + return nil, err + } + metric, err := strconv.ParseUint(fields[6], 10, 32) + if err != nil { + return nil, err + } + mask, err := strconv.ParseUint(fields[7], 16, 32) + if err != nil { + return nil, err + } + mtu, err := strconv.ParseUint(fields[8], 10, 32) + if err != nil { + return nil, err + } + window, err := strconv.ParseUint(fields[9], 10, 32) + if err != nil { + return nil, err + } + irtt, err := strconv.ParseUint(fields[10], 10, 32) + if err != nil { + return nil, err + } + routeline := &NetRouteLine{ + Iface: iface, + Destination: uint32(destination), + Gateway: uint32(gateway), + Flags: uint32(flags), + RefCnt: uint32(refcnt), + Use: uint32(use), + Metric: uint32(metric), + Mask: uint32(mask), + MTU: uint32(mtu), + Window: uint32(window), + IRTT: uint32(irtt), + } + return routeline, nil +} diff --git a/vendor/github.com/prometheus/procfs/net_sockstat.go b/vendor/github.com/prometheus/procfs/net_sockstat.go index e36f4872dd..360e36af7d 100644 --- a/vendor/github.com/prometheus/procfs/net_sockstat.go +++ b/vendor/github.com/prometheus/procfs/net_sockstat.go @@ -16,7 +16,6 @@ package procfs import ( "bufio" "bytes" - "errors" "fmt" "io" "strings" @@ -70,7 +69,7 @@ func readSockstat(name string) (*NetSockstat, error) { stat, err := parseSockstat(bytes.NewReader(b)) if err != nil { - return nil, fmt.Errorf("failed to read sockstats from %q: %w", name, err) + return nil, fmt.Errorf("%s: sockstats from %q: %w", ErrFileRead, name, err) } return stat, nil @@ -84,13 +83,13 @@ func parseSockstat(r io.Reader) (*NetSockstat, error) { // Expect a minimum of a protocol and one key/value pair. fields := strings.Split(s.Text(), " ") if len(fields) < 3 { - return nil, fmt.Errorf("malformed sockstat line: %q", s.Text()) + return nil, fmt.Errorf("%w: Malformed sockstat line: %q", ErrFileParse, s.Text()) } // The remaining fields are key/value pairs. kvs, err := parseSockstatKVs(fields[1:]) if err != nil { - return nil, fmt.Errorf("error parsing sockstat key/value pairs from %q: %w", s.Text(), err) + return nil, fmt.Errorf("%s: sockstat key/value pairs from %q: %w", ErrFileParse, s.Text(), err) } // The first field is the protocol. We must trim its colon suffix. @@ -119,7 +118,7 @@ func parseSockstat(r io.Reader) (*NetSockstat, error) { // parseSockstatKVs parses a string slice into a map of key/value pairs. func parseSockstatKVs(kvs []string) (map[string]int, error) { if len(kvs)%2 != 0 { - return nil, errors.New("odd number of fields in key/value pairs") + return nil, fmt.Errorf("%w:: Odd number of fields in key/value pairs %q", ErrFileParse, kvs) } // Iterate two values at a time to gather key/value pairs. diff --git a/vendor/github.com/prometheus/procfs/net_softnet.go b/vendor/github.com/prometheus/procfs/net_softnet.go index a94f86dc4a..c770852919 100644 --- a/vendor/github.com/prometheus/procfs/net_softnet.go +++ b/vendor/github.com/prometheus/procfs/net_softnet.go @@ -27,8 +27,9 @@ import ( // For the proc file format details, // See: // * Linux 2.6.23 https://elixir.bootlin.com/linux/v2.6.23/source/net/core/dev.c#L2343 -// * Linux 4.17 https://elixir.bootlin.com/linux/v4.17/source/net/core/net-procfs.c#L162 -// and https://elixir.bootlin.com/linux/v4.17/source/include/linux/netdevice.h#L2810. +// * Linux 2.6.39 https://elixir.bootlin.com/linux/v2.6.39/source/net/core/dev.c#L4086 +// * Linux 4.18 https://elixir.bootlin.com/linux/v4.18/source/net/core/net-procfs.c#L162 +// * Linux 5.14 https://elixir.bootlin.com/linux/v5.14/source/net/core/net-procfs.c#L169 // SoftnetStat contains a single row of data from /proc/net/softnet_stat. type SoftnetStat struct { @@ -38,6 +39,18 @@ type SoftnetStat struct { Dropped uint32 // Number of times processing packets ran out of quota. TimeSqueezed uint32 + // Number of collision occur while obtaining device lock while transmitting. + CPUCollision uint32 + // Number of times cpu woken up received_rps. + ReceivedRps uint32 + // number of times flow limit has been reached. + FlowLimitCount uint32 + // Softnet backlog status. + SoftnetBacklogLen uint32 + // CPU id owning this softnet_data. + Index uint32 + // softnet_data's Width. + Width int } var softNetProcFile = "net/softnet_stat" @@ -51,7 +64,7 @@ func (fs FS) NetSoftnetStat() ([]SoftnetStat, error) { entries, err := parseSoftnet(bytes.NewReader(b)) if err != nil { - return nil, fmt.Errorf("failed to parse /proc/net/softnet_stat: %w", err) + return nil, fmt.Errorf("%s: /proc/net/softnet_stat: %w", ErrFileParse, err) } return entries, nil @@ -63,25 +76,65 @@ func parseSoftnet(r io.Reader) ([]SoftnetStat, error) { s := bufio.NewScanner(r) var stats []SoftnetStat + cpuIndex := 0 for s.Scan() { columns := strings.Fields(s.Text()) width := len(columns) + softnetStat := SoftnetStat{} if width < minColumns { - return nil, fmt.Errorf("%d columns were detected, but at least %d were expected", width, minColumns) + return nil, fmt.Errorf("%w: detected %d columns, but expected at least %d", ErrFileParse, width, minColumns) } - // We only parse the first three columns at the moment. - us, err := parseHexUint32s(columns[0:3]) - if err != nil { - return nil, err + // Linux 2.6.23 https://elixir.bootlin.com/linux/v2.6.23/source/net/core/dev.c#L2347 + if width >= minColumns { + us, err := parseHexUint32s(columns[0:9]) + if err != nil { + return nil, err + } + + softnetStat.Processed = us[0] + softnetStat.Dropped = us[1] + softnetStat.TimeSqueezed = us[2] + softnetStat.CPUCollision = us[8] + } + + // Linux 2.6.39 https://elixir.bootlin.com/linux/v2.6.39/source/net/core/dev.c#L4086 + if width >= 10 { + us, err := parseHexUint32s(columns[9:10]) + if err != nil { + return nil, err + } + + softnetStat.ReceivedRps = us[0] } - stats = append(stats, SoftnetStat{ - Processed: us[0], - Dropped: us[1], - TimeSqueezed: us[2], - }) + // Linux 4.18 https://elixir.bootlin.com/linux/v4.18/source/net/core/net-procfs.c#L162 + if width >= 11 { + us, err := parseHexUint32s(columns[10:11]) + if err != nil { + return nil, err + } + + softnetStat.FlowLimitCount = us[0] + } + + // Linux 5.14 https://elixir.bootlin.com/linux/v5.14/source/net/core/net-procfs.c#L169 + if width >= 13 { + us, err := parseHexUint32s(columns[11:13]) + if err != nil { + return nil, err + } + + softnetStat.SoftnetBacklogLen = us[0] + softnetStat.Index = us[1] + } else { + // For older kernels, create the Index based on the scan line number. + softnetStat.Index = uint32(cpuIndex) + } + softnetStat.Width = width + stats = append(stats, softnetStat) + cpuIndex++ } return stats, nil diff --git a/vendor/github.com/prometheus/procfs/net_unix.go b/vendor/github.com/prometheus/procfs/net_unix.go index 98aa8e1c31..acbbc57eab 100644 --- a/vendor/github.com/prometheus/procfs/net_unix.go +++ b/vendor/github.com/prometheus/procfs/net_unix.go @@ -108,14 +108,14 @@ func parseNetUNIX(r io.Reader) (*NetUNIX, error) { line := s.Text() item, err := nu.parseLine(line, hasInode, minFields) if err != nil { - return nil, fmt.Errorf("failed to parse /proc/net/unix data %q: %w", line, err) + return nil, fmt.Errorf("%s: /proc/net/unix encountered data %q: %w", ErrFileParse, line, err) } nu.Rows = append(nu.Rows, item) } if err := s.Err(); err != nil { - return nil, fmt.Errorf("failed to scan /proc/net/unix data: %w", err) + return nil, fmt.Errorf("%s: /proc/net/unix encountered data: %w", ErrFileParse, err) } return &nu, nil @@ -126,7 +126,7 @@ func (u *NetUNIX) parseLine(line string, hasInode bool, min int) (*NetUNIXLine, l := len(fields) if l < min { - return nil, fmt.Errorf("expected at least %d fields but got %d", min, l) + return nil, fmt.Errorf("%w: expected at least %d fields but got %d", ErrFileParse, min, l) } // Field offsets are as follows: @@ -136,29 +136,29 @@ func (u *NetUNIX) parseLine(line string, hasInode bool, min int) (*NetUNIXLine, users, err := u.parseUsers(fields[1]) if err != nil { - return nil, fmt.Errorf("failed to parse ref count %q: %w", fields[1], err) + return nil, fmt.Errorf("%s: ref count %q: %w", ErrFileParse, fields[1], err) } flags, err := u.parseFlags(fields[3]) if err != nil { - return nil, fmt.Errorf("failed to parse flags %q: %w", fields[3], err) + return nil, fmt.Errorf("%s: Unable to parse flags %q: %w", ErrFileParse, fields[3], err) } typ, err := u.parseType(fields[4]) if err != nil { - return nil, fmt.Errorf("failed to parse type %q: %w", fields[4], err) + return nil, fmt.Errorf("%s: Failed to parse type %q: %w", ErrFileParse, fields[4], err) } state, err := u.parseState(fields[5]) if err != nil { - return nil, fmt.Errorf("failed to parse state %q: %w", fields[5], err) + return nil, fmt.Errorf("%s: Failed to parse state %q: %w", ErrFileParse, fields[5], err) } var inode uint64 if hasInode { inode, err = u.parseInode(fields[6]) if err != nil { - return nil, fmt.Errorf("failed to parse inode %q: %w", fields[6], err) + return nil, fmt.Errorf("%s failed to parse inode %q: %w", ErrFileParse, fields[6], err) } } diff --git a/vendor/github.com/prometheus/procfs/net_wireless.go b/vendor/github.com/prometheus/procfs/net_wireless.go new file mode 100644 index 0000000000..7443edca94 --- /dev/null +++ b/vendor/github.com/prometheus/procfs/net_wireless.go @@ -0,0 +1,182 @@ +// Copyright 2023 The Prometheus Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package procfs + +import ( + "bufio" + "bytes" + "fmt" + "io" + "strconv" + "strings" + + "github.com/prometheus/procfs/internal/util" +) + +// Wireless models the content of /proc/net/wireless. +type Wireless struct { + Name string + + // Status is the current 4-digit hex value status of the interface. + Status uint64 + + // QualityLink is the link quality. + QualityLink int + + // QualityLevel is the signal gain (dBm). + QualityLevel int + + // QualityNoise is the signal noise baseline (dBm). + QualityNoise int + + // DiscardedNwid is the number of discarded packets with wrong nwid/essid. + DiscardedNwid int + + // DiscardedCrypt is the number of discarded packets with wrong code/decode (WEP). + DiscardedCrypt int + + // DiscardedFrag is the number of discarded packets that can't perform MAC reassembly. + DiscardedFrag int + + // DiscardedRetry is the number of discarded packets that reached max MAC retries. + DiscardedRetry int + + // DiscardedMisc is the number of discarded packets for other reasons. + DiscardedMisc int + + // MissedBeacon is the number of missed beacons/superframe. + MissedBeacon int +} + +// Wireless returns kernel wireless statistics. +func (fs FS) Wireless() ([]*Wireless, error) { + b, err := util.ReadFileNoStat(fs.proc.Path("net/wireless")) + if err != nil { + return nil, err + } + + m, err := parseWireless(bytes.NewReader(b)) + if err != nil { + return nil, fmt.Errorf("%s: wireless: %w", ErrFileParse, err) + } + + return m, nil +} + +// parseWireless parses the contents of /proc/net/wireless. +/* +Inter-| sta-| Quality | Discarded packets | Missed | WE +face | tus | link level noise | nwid crypt frag retry misc | beacon | 22 + eth1: 0000 5. -256. -10. 0 1 0 3 0 0 + eth2: 0000 5. -256. -20. 0 2 0 4 0 0 +*/ +func parseWireless(r io.Reader) ([]*Wireless, error) { + var ( + interfaces []*Wireless + scanner = bufio.NewScanner(r) + ) + + for n := 0; scanner.Scan(); n++ { + // Skip the 2 header lines. + if n < 2 { + continue + } + + line := scanner.Text() + + parts := strings.Split(line, ":") + if len(parts) != 2 { + return nil, fmt.Errorf("%w: expected 2 parts after splitting line by ':', got %d for line %q", ErrFileParse, len(parts), line) + } + + name := strings.TrimSpace(parts[0]) + stats := strings.Fields(parts[1]) + + if len(stats) < 10 { + return nil, fmt.Errorf("%w: invalid number of fields in line %d, expected 10+, got %d: %q", ErrFileParse, n, len(stats), line) + } + + status, err := strconv.ParseUint(stats[0], 16, 16) + if err != nil { + return nil, fmt.Errorf("%w: invalid status in line %d: %q", ErrFileParse, n, line) + } + + qlink, err := strconv.Atoi(strings.TrimSuffix(stats[1], ".")) + if err != nil { + return nil, fmt.Errorf("%s: parse Quality:link as integer %q: %w", ErrFileParse, qlink, err) + } + + qlevel, err := strconv.Atoi(strings.TrimSuffix(stats[2], ".")) + if err != nil { + return nil, fmt.Errorf("%s: Quality:level as integer %q: %w", ErrFileParse, qlevel, err) + } + + qnoise, err := strconv.Atoi(strings.TrimSuffix(stats[3], ".")) + if err != nil { + return nil, fmt.Errorf("%s: Quality:noise as integer %q: %w", ErrFileParse, qnoise, err) + } + + dnwid, err := strconv.Atoi(stats[4]) + if err != nil { + return nil, fmt.Errorf("%s: Discarded:nwid as integer %q: %w", ErrFileParse, dnwid, err) + } + + dcrypt, err := strconv.Atoi(stats[5]) + if err != nil { + return nil, fmt.Errorf("%s: Discarded:crypt as integer %q: %w", ErrFileParse, dcrypt, err) + } + + dfrag, err := strconv.Atoi(stats[6]) + if err != nil { + return nil, fmt.Errorf("%s: Discarded:frag as integer %q: %w", ErrFileParse, dfrag, err) + } + + dretry, err := strconv.Atoi(stats[7]) + if err != nil { + return nil, fmt.Errorf("%s: Discarded:retry as integer %q: %w", ErrFileParse, dretry, err) + } + + dmisc, err := strconv.Atoi(stats[8]) + if err != nil { + return nil, fmt.Errorf("%s: Discarded:misc as integer %q: %w", ErrFileParse, dmisc, err) + } + + mbeacon, err := strconv.Atoi(stats[9]) + if err != nil { + return nil, fmt.Errorf("%s: Missed:beacon as integer %q: %w", ErrFileParse, mbeacon, err) + } + + w := &Wireless{ + Name: name, + Status: status, + QualityLink: qlink, + QualityLevel: qlevel, + QualityNoise: qnoise, + DiscardedNwid: dnwid, + DiscardedCrypt: dcrypt, + DiscardedFrag: dfrag, + DiscardedRetry: dretry, + DiscardedMisc: dmisc, + MissedBeacon: mbeacon, + } + + interfaces = append(interfaces, w) + } + + if err := scanner.Err(); err != nil { + return nil, fmt.Errorf("%s: Failed to scan /proc/net/wireless: %w", ErrFileRead, err) + } + + return interfaces, nil +} diff --git a/vendor/github.com/prometheus/procfs/net_xfrm.go b/vendor/github.com/prometheus/procfs/net_xfrm.go index f9d9d243db..932ef20468 100644 --- a/vendor/github.com/prometheus/procfs/net_xfrm.go +++ b/vendor/github.com/prometheus/procfs/net_xfrm.go @@ -115,7 +115,7 @@ func (fs FS) NewXfrmStat() (XfrmStat, error) { fields := strings.Fields(s.Text()) if len(fields) != 2 { - return XfrmStat{}, fmt.Errorf("couldn't parse %q line %q", file.Name(), s.Text()) + return XfrmStat{}, fmt.Errorf("%w: %q line %q", ErrFileParse, file.Name(), s.Text()) } name := fields[0] diff --git a/vendor/github.com/prometheus/procfs/netstat.go b/vendor/github.com/prometheus/procfs/netstat.go index dcea9c5a67..742dff453b 100644 --- a/vendor/github.com/prometheus/procfs/netstat.go +++ b/vendor/github.com/prometheus/procfs/netstat.go @@ -37,32 +37,46 @@ func (fs FS) NetStat() ([]NetStat, error) { var netStatsTotal []NetStat for _, filePath := range statFiles { - file, err := os.Open(filePath) + procNetstat, err := parseNetstat(filePath) if err != nil { return nil, err } + procNetstat.Filename = filepath.Base(filePath) - netStatFile := NetStat{ - Filename: filepath.Base(filePath), - Stats: make(map[string][]uint64), - } - scanner := bufio.NewScanner(file) - scanner.Scan() - // First string is always a header for stats - var headers []string - headers = append(headers, strings.Fields(scanner.Text())...) + netStatsTotal = append(netStatsTotal, procNetstat) + } + return netStatsTotal, nil +} + +// parseNetstat parses the metrics from `/proc/net/stat/` file +// and returns a NetStat structure. +func parseNetstat(filePath string) (NetStat, error) { + netStat := NetStat{ + Stats: make(map[string][]uint64), + } + file, err := os.Open(filePath) + if err != nil { + return netStat, err + } + defer file.Close() + + scanner := bufio.NewScanner(file) + scanner.Scan() - // Other strings represent per-CPU counters - for scanner.Scan() { - for num, counter := range strings.Fields(scanner.Text()) { - value, err := strconv.ParseUint(counter, 16, 64) - if err != nil { - return nil, err - } - netStatFile.Stats[headers[num]] = append(netStatFile.Stats[headers[num]], value) + // First string is always a header for stats + var headers []string + headers = append(headers, strings.Fields(scanner.Text())...) + + // Other strings represent per-CPU counters + for scanner.Scan() { + for num, counter := range strings.Fields(scanner.Text()) { + value, err := strconv.ParseUint(counter, 16, 64) + if err != nil { + return NetStat{}, err } + netStat.Stats[headers[num]] = append(netStat.Stats[headers[num]], value) } - netStatsTotal = append(netStatsTotal, netStatFile) } - return netStatsTotal, nil + + return netStat, nil } diff --git a/vendor/github.com/prometheus/procfs/proc.go b/vendor/github.com/prometheus/procfs/proc.go index c30223af72..d1f71caa5d 100644 --- a/vendor/github.com/prometheus/procfs/proc.go +++ b/vendor/github.com/prometheus/procfs/proc.go @@ -15,13 +15,13 @@ package procfs import ( "bytes" + "errors" "fmt" "io" "os" "strconv" "strings" - "github.com/prometheus/procfs/internal/fs" "github.com/prometheus/procfs/internal/util" ) @@ -30,12 +30,18 @@ type Proc struct { // The process ID. PID int - fs fs.FS + fs FS } // Procs represents a list of Proc structs. type Procs []Proc +var ( + ErrFileParse = errors.New("Error Parsing File") + ErrFileRead = errors.New("Error Reading File") + ErrMountPoint = errors.New("Error Accessing Mount point") +) + func (p Procs) Len() int { return len(p) } func (p Procs) Swap(i, j int) { p[i], p[j] = p[j], p[i] } func (p Procs) Less(i, j int) bool { return p[i].PID < p[j].PID } @@ -43,7 +49,7 @@ func (p Procs) Less(i, j int) bool { return p[i].PID < p[j].PID } // Self returns a process for the current process read via /proc/self. func Self() (Proc, error) { fs, err := NewFS(DefaultMountPoint) - if err != nil { + if err != nil || errors.Unwrap(err) == ErrMountPoint { return Proc{}, err } return fs.Self() @@ -92,7 +98,7 @@ func (fs FS) Proc(pid int) (Proc, error) { if _, err := os.Stat(fs.proc.Path(strconv.Itoa(pid))); err != nil { return Proc{}, err } - return Proc{PID: pid, fs: fs.proc}, nil + return Proc{PID: pid, fs: fs}, nil } // AllProcs returns a list of all currently available processes. @@ -105,7 +111,7 @@ func (fs FS) AllProcs() (Procs, error) { names, err := d.Readdirnames(-1) if err != nil { - return Procs{}, fmt.Errorf("could not read %q: %w", d.Name(), err) + return Procs{}, fmt.Errorf("%s: Cannot read file: %v: %w", ErrFileRead, names, err) } p := Procs{} @@ -114,7 +120,7 @@ func (fs FS) AllProcs() (Procs, error) { if err != nil { continue } - p = append(p, Proc{PID: int(pid), fs: fs.proc}) + p = append(p, Proc{PID: int(pid), fs: fs}) } return p, nil @@ -206,7 +212,7 @@ func (p Proc) FileDescriptors() ([]uintptr, error) { for i, n := range names { fd, err := strconv.ParseInt(n, 10, 32) if err != nil { - return nil, fmt.Errorf("could not parse fd %q: %w", n, err) + return nil, fmt.Errorf("%s: Cannot parse line: %v: %w", ErrFileParse, i, err) } fds[i] = uintptr(fd) } @@ -237,6 +243,19 @@ func (p Proc) FileDescriptorTargets() ([]string, error) { // FileDescriptorsLen returns the number of currently open file descriptors of // a process. func (p Proc) FileDescriptorsLen() (int, error) { + // Use fast path if available (Linux v6.2): https://github.com/torvalds/linux/commit/f1f1f2569901 + if p.fs.isReal { + stat, err := os.Stat(p.path("fd")) + if err != nil { + return 0, err + } + + size := stat.Size() + if size > 0 { + return int(size), nil + } + } + fds, err := p.fileDescriptors() if err != nil { return 0, err @@ -278,14 +297,14 @@ func (p Proc) fileDescriptors() ([]string, error) { names, err := d.Readdirnames(-1) if err != nil { - return nil, fmt.Errorf("could not read %q: %w", d.Name(), err) + return nil, fmt.Errorf("%s: Cannot read file: %v: %w", ErrFileRead, names, err) } return names, nil } func (p Proc) path(pa ...string) string { - return p.fs.Path(append([]string{strconv.Itoa(p.PID)}, pa...)...) + return p.fs.proc.Path(append([]string{strconv.Itoa(p.PID)}, pa...)...) } // FileDescriptorsInfo retrieves information about all file descriptors of diff --git a/vendor/github.com/prometheus/procfs/proc_cgroup.go b/vendor/github.com/prometheus/procfs/proc_cgroup.go index cca03327c3..daeed7f571 100644 --- a/vendor/github.com/prometheus/procfs/proc_cgroup.go +++ b/vendor/github.com/prometheus/procfs/proc_cgroup.go @@ -23,7 +23,7 @@ import ( "github.com/prometheus/procfs/internal/util" ) -// Cgroup models one line from /proc/[pid]/cgroup. Each Cgroup struct describes the the placement of a PID inside a +// Cgroup models one line from /proc/[pid]/cgroup. Each Cgroup struct describes the placement of a PID inside a // specific control hierarchy. The kernel has two cgroup APIs, v1 and v2. v1 has one hierarchy per available resource // controller, while v2 has one unified hierarchy shared by all controllers. Regardless of v1 or v2, all hierarchies // contain all running processes, so the question answerable with a Cgroup struct is 'where is this process in @@ -51,7 +51,7 @@ func parseCgroupString(cgroupStr string) (*Cgroup, error) { fields := strings.SplitN(cgroupStr, ":", 3) if len(fields) < 3 { - return nil, fmt.Errorf("at least 3 fields required, found %d fields in cgroup string: %s", len(fields), cgroupStr) + return nil, fmt.Errorf("%w: 3+ fields required, found %d fields in cgroup string: %s", ErrFileParse, len(fields), cgroupStr) } cgroup := &Cgroup{ @@ -60,7 +60,7 @@ func parseCgroupString(cgroupStr string) (*Cgroup, error) { } cgroup.HierarchyID, err = strconv.Atoi(fields[0]) if err != nil { - return nil, fmt.Errorf("failed to parse hierarchy ID") + return nil, fmt.Errorf("%w: hierarchy ID: %q", ErrFileParse, cgroup.HierarchyID) } if fields[1] != "" { ssNames := strings.Split(fields[1], ",") diff --git a/vendor/github.com/prometheus/procfs/proc_cgroups.go b/vendor/github.com/prometheus/procfs/proc_cgroups.go index 24d4dce9cf..5dd4938999 100644 --- a/vendor/github.com/prometheus/procfs/proc_cgroups.go +++ b/vendor/github.com/prometheus/procfs/proc_cgroups.go @@ -46,7 +46,7 @@ func parseCgroupSummaryString(CgroupSummaryStr string) (*CgroupSummary, error) { fields := strings.Fields(CgroupSummaryStr) // require at least 4 fields if len(fields) < 4 { - return nil, fmt.Errorf("at least 4 fields required, found %d fields in cgroup info string: %s", len(fields), CgroupSummaryStr) + return nil, fmt.Errorf("%w: 4+ fields required, found %d fields in cgroup info string: %s", ErrFileParse, len(fields), CgroupSummaryStr) } CgroupSummary := &CgroupSummary{ @@ -54,15 +54,15 @@ func parseCgroupSummaryString(CgroupSummaryStr string) (*CgroupSummary, error) { } CgroupSummary.Hierarchy, err = strconv.Atoi(fields[1]) if err != nil { - return nil, fmt.Errorf("failed to parse hierarchy ID") + return nil, fmt.Errorf("%w: Unable to parse hierarchy ID from %q", ErrFileParse, fields[1]) } CgroupSummary.Cgroups, err = strconv.Atoi(fields[2]) if err != nil { - return nil, fmt.Errorf("failed to parse Cgroup Num") + return nil, fmt.Errorf("%w: Unable to parse Cgroup Num from %q", ErrFileParse, fields[2]) } CgroupSummary.Enabled, err = strconv.Atoi(fields[3]) if err != nil { - return nil, fmt.Errorf("failed to parse Enabled") + return nil, fmt.Errorf("%w: Unable to parse Enabled from %q", ErrFileParse, fields[3]) } return CgroupSummary, nil } diff --git a/vendor/github.com/prometheus/procfs/proc_fdinfo.go b/vendor/github.com/prometheus/procfs/proc_fdinfo.go index 1bbdd4a8e9..4b7933e4f9 100644 --- a/vendor/github.com/prometheus/procfs/proc_fdinfo.go +++ b/vendor/github.com/prometheus/procfs/proc_fdinfo.go @@ -111,7 +111,7 @@ func parseInotifyInfo(line string) (*InotifyInfo, error) { } return i, nil } - return nil, fmt.Errorf("invalid inode entry: %q", line) + return nil, fmt.Errorf("%w: invalid inode entry: %q", ErrFileParse, line) } // ProcFDInfos represents a list of ProcFDInfo structs. diff --git a/vendor/github.com/prometheus/procfs/proc_interrupts.go b/vendor/github.com/prometheus/procfs/proc_interrupts.go new file mode 100644 index 0000000000..86b4b45246 --- /dev/null +++ b/vendor/github.com/prometheus/procfs/proc_interrupts.go @@ -0,0 +1,98 @@ +// Copyright 2022 The Prometheus Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package procfs + +import ( + "bufio" + "bytes" + "errors" + "fmt" + "io" + "strconv" + "strings" + + "github.com/prometheus/procfs/internal/util" +) + +// Interrupt represents a single interrupt line. +type Interrupt struct { + // Info is the type of interrupt. + Info string + // Devices is the name of the device that is located at that IRQ + Devices string + // Values is the number of interrupts per CPU. + Values []string +} + +// Interrupts models the content of /proc/interrupts. Key is the IRQ number. +// - https://access.redhat.com/documentation/en-us/red_hat_enterprise_linux/6/html/deployment_guide/s2-proc-interrupts +// - https://raspberrypi.stackexchange.com/questions/105802/explanation-of-proc-interrupts-output +type Interrupts map[string]Interrupt + +// Interrupts creates a new instance from a given Proc instance. +func (p Proc) Interrupts() (Interrupts, error) { + data, err := util.ReadFileNoStat(p.path("interrupts")) + if err != nil { + return nil, err + } + return parseInterrupts(bytes.NewReader(data)) +} + +func parseInterrupts(r io.Reader) (Interrupts, error) { + var ( + interrupts = Interrupts{} + scanner = bufio.NewScanner(r) + ) + + if !scanner.Scan() { + return nil, errors.New("interrupts empty") + } + cpuNum := len(strings.Fields(scanner.Text())) // one header per cpu + + for scanner.Scan() { + parts := strings.Fields(scanner.Text()) + if len(parts) == 0 { // skip empty lines + continue + } + if len(parts) < 2 { + return nil, fmt.Errorf("%w: Not enough fields in interrupts (expected 2+ fields but got %d): %s", ErrFileParse, len(parts), parts) + } + intName := parts[0][:len(parts[0])-1] // remove trailing : + + if len(parts) == 2 { + interrupts[intName] = Interrupt{ + Info: "", + Devices: "", + Values: []string{ + parts[1], + }, + } + continue + } + + intr := Interrupt{ + Values: parts[1 : cpuNum+1], + } + + if _, err := strconv.Atoi(intName); err == nil { // numeral interrupt + intr.Info = parts[cpuNum+1] + intr.Devices = strings.Join(parts[cpuNum+2:], " ") + } else { + intr.Info = strings.Join(parts[cpuNum+1:], " ") + } + interrupts[intName] = intr + } + + return interrupts, scanner.Err() +} diff --git a/vendor/github.com/prometheus/procfs/proc_limits.go b/vendor/github.com/prometheus/procfs/proc_limits.go index 7a1388185a..c86d815d73 100644 --- a/vendor/github.com/prometheus/procfs/proc_limits.go +++ b/vendor/github.com/prometheus/procfs/proc_limits.go @@ -103,7 +103,7 @@ func (p Proc) Limits() (ProcLimits, error) { //fields := limitsMatch.Split(s.Text(), limitsFields) fields := limitsMatch.FindStringSubmatch(s.Text()) if len(fields) != limitsFields { - return ProcLimits{}, fmt.Errorf("couldn't parse %q line %q", f.Name(), s.Text()) + return ProcLimits{}, fmt.Errorf("%w: couldn't parse %q line %q", ErrFileParse, f.Name(), s.Text()) } switch fields[1] { @@ -154,7 +154,7 @@ func parseUint(s string) (uint64, error) { } i, err := strconv.ParseUint(s, 10, 64) if err != nil { - return 0, fmt.Errorf("couldn't parse value %q: %w", s, err) + return 0, fmt.Errorf("%s: couldn't parse value %q: %w", ErrFileParse, s, err) } return i, nil } diff --git a/vendor/github.com/prometheus/procfs/proc_maps.go b/vendor/github.com/prometheus/procfs/proc_maps.go index f1bcbf32bb..727549a13f 100644 --- a/vendor/github.com/prometheus/procfs/proc_maps.go +++ b/vendor/github.com/prometheus/procfs/proc_maps.go @@ -65,7 +65,7 @@ type ProcMap struct { func parseDevice(s string) (uint64, error) { toks := strings.Split(s, ":") if len(toks) < 2 { - return 0, fmt.Errorf("unexpected number of fields") + return 0, fmt.Errorf("%w: unexpected number of fields, expected: 2, got: %q", ErrFileParse, len(toks)) } major, err := strconv.ParseUint(toks[0], 16, 0) @@ -95,7 +95,7 @@ func parseAddress(s string) (uintptr, error) { func parseAddresses(s string) (uintptr, uintptr, error) { toks := strings.Split(s, "-") if len(toks) < 2 { - return 0, 0, fmt.Errorf("invalid address") + return 0, 0, fmt.Errorf("%w: invalid address", ErrFileParse) } saddr, err := parseAddress(toks[0]) @@ -114,7 +114,7 @@ func parseAddresses(s string) (uintptr, uintptr, error) { // parsePermissions parses a token and returns any that are set. func parsePermissions(s string) (*ProcMapPermissions, error) { if len(s) < 4 { - return nil, fmt.Errorf("invalid permissions token") + return nil, fmt.Errorf("%w: invalid permissions token", ErrFileParse) } perms := ProcMapPermissions{} @@ -141,7 +141,7 @@ func parsePermissions(s string) (*ProcMapPermissions, error) { func parseProcMap(text string) (*ProcMap, error) { fields := strings.Fields(text) if len(fields) < 5 { - return nil, fmt.Errorf("truncated procmap entry") + return nil, fmt.Errorf("%w: truncated procmap entry", ErrFileParse) } saddr, eaddr, err := parseAddresses(fields[0]) diff --git a/vendor/github.com/prometheus/procfs/proc_netstat.go b/vendor/github.com/prometheus/procfs/proc_netstat.go index 48b5238194..8e3ff4d794 100644 --- a/vendor/github.com/prometheus/procfs/proc_netstat.go +++ b/vendor/github.com/prometheus/procfs/proc_netstat.go @@ -33,139 +33,140 @@ type ProcNetstat struct { } type TcpExt struct { // nolint:revive - SyncookiesSent float64 - SyncookiesRecv float64 - SyncookiesFailed float64 - EmbryonicRsts float64 - PruneCalled float64 - RcvPruned float64 - OfoPruned float64 - OutOfWindowIcmps float64 - LockDroppedIcmps float64 - ArpFilter float64 - TW float64 - TWRecycled float64 - TWKilled float64 - PAWSActive float64 - PAWSEstab float64 - DelayedACKs float64 - DelayedACKLocked float64 - DelayedACKLost float64 - ListenOverflows float64 - ListenDrops float64 - TCPHPHits float64 - TCPPureAcks float64 - TCPHPAcks float64 - TCPRenoRecovery float64 - TCPSackRecovery float64 - TCPSACKReneging float64 - TCPSACKReorder float64 - TCPRenoReorder float64 - TCPTSReorder float64 - TCPFullUndo float64 - TCPPartialUndo float64 - TCPDSACKUndo float64 - TCPLossUndo float64 - TCPLostRetransmit float64 - TCPRenoFailures float64 - TCPSackFailures float64 - TCPLossFailures float64 - TCPFastRetrans float64 - TCPSlowStartRetrans float64 - TCPTimeouts float64 - TCPLossProbes float64 - TCPLossProbeRecovery float64 - TCPRenoRecoveryFail float64 - TCPSackRecoveryFail float64 - TCPRcvCollapsed float64 - TCPDSACKOldSent float64 - TCPDSACKOfoSent float64 - TCPDSACKRecv float64 - TCPDSACKOfoRecv float64 - TCPAbortOnData float64 - TCPAbortOnClose float64 - TCPAbortOnMemory float64 - TCPAbortOnTimeout float64 - TCPAbortOnLinger float64 - TCPAbortFailed float64 - TCPMemoryPressures float64 - TCPMemoryPressuresChrono float64 - TCPSACKDiscard float64 - TCPDSACKIgnoredOld float64 - TCPDSACKIgnoredNoUndo float64 - TCPSpuriousRTOs float64 - TCPMD5NotFound float64 - TCPMD5Unexpected float64 - TCPMD5Failure float64 - TCPSackShifted float64 - TCPSackMerged float64 - TCPSackShiftFallback float64 - TCPBacklogDrop float64 - PFMemallocDrop float64 - TCPMinTTLDrop float64 - TCPDeferAcceptDrop float64 - IPReversePathFilter float64 - TCPTimeWaitOverflow float64 - TCPReqQFullDoCookies float64 - TCPReqQFullDrop float64 - TCPRetransFail float64 - TCPRcvCoalesce float64 - TCPOFOQueue float64 - TCPOFODrop float64 - TCPOFOMerge float64 - TCPChallengeACK float64 - TCPSYNChallenge float64 - TCPFastOpenActive float64 - TCPFastOpenActiveFail float64 - TCPFastOpenPassive float64 - TCPFastOpenPassiveFail float64 - TCPFastOpenListenOverflow float64 - TCPFastOpenCookieReqd float64 - TCPFastOpenBlackhole float64 - TCPSpuriousRtxHostQueues float64 - BusyPollRxPackets float64 - TCPAutoCorking float64 - TCPFromZeroWindowAdv float64 - TCPToZeroWindowAdv float64 - TCPWantZeroWindowAdv float64 - TCPSynRetrans float64 - TCPOrigDataSent float64 - TCPHystartTrainDetect float64 - TCPHystartTrainCwnd float64 - TCPHystartDelayDetect float64 - TCPHystartDelayCwnd float64 - TCPACKSkippedSynRecv float64 - TCPACKSkippedPAWS float64 - TCPACKSkippedSeq float64 - TCPACKSkippedFinWait2 float64 - TCPACKSkippedTimeWait float64 - TCPACKSkippedChallenge float64 - TCPWinProbe float64 - TCPKeepAlive float64 - TCPMTUPFail float64 - TCPMTUPSuccess float64 - TCPWqueueTooBig float64 + SyncookiesSent *float64 + SyncookiesRecv *float64 + SyncookiesFailed *float64 + EmbryonicRsts *float64 + PruneCalled *float64 + RcvPruned *float64 + OfoPruned *float64 + OutOfWindowIcmps *float64 + LockDroppedIcmps *float64 + ArpFilter *float64 + TW *float64 + TWRecycled *float64 + TWKilled *float64 + PAWSActive *float64 + PAWSEstab *float64 + DelayedACKs *float64 + DelayedACKLocked *float64 + DelayedACKLost *float64 + ListenOverflows *float64 + ListenDrops *float64 + TCPHPHits *float64 + TCPPureAcks *float64 + TCPHPAcks *float64 + TCPRenoRecovery *float64 + TCPSackRecovery *float64 + TCPSACKReneging *float64 + TCPSACKReorder *float64 + TCPRenoReorder *float64 + TCPTSReorder *float64 + TCPFullUndo *float64 + TCPPartialUndo *float64 + TCPDSACKUndo *float64 + TCPLossUndo *float64 + TCPLostRetransmit *float64 + TCPRenoFailures *float64 + TCPSackFailures *float64 + TCPLossFailures *float64 + TCPFastRetrans *float64 + TCPSlowStartRetrans *float64 + TCPTimeouts *float64 + TCPLossProbes *float64 + TCPLossProbeRecovery *float64 + TCPRenoRecoveryFail *float64 + TCPSackRecoveryFail *float64 + TCPRcvCollapsed *float64 + TCPDSACKOldSent *float64 + TCPDSACKOfoSent *float64 + TCPDSACKRecv *float64 + TCPDSACKOfoRecv *float64 + TCPAbortOnData *float64 + TCPAbortOnClose *float64 + TCPAbortOnMemory *float64 + TCPAbortOnTimeout *float64 + TCPAbortOnLinger *float64 + TCPAbortFailed *float64 + TCPMemoryPressures *float64 + TCPMemoryPressuresChrono *float64 + TCPSACKDiscard *float64 + TCPDSACKIgnoredOld *float64 + TCPDSACKIgnoredNoUndo *float64 + TCPSpuriousRTOs *float64 + TCPMD5NotFound *float64 + TCPMD5Unexpected *float64 + TCPMD5Failure *float64 + TCPSackShifted *float64 + TCPSackMerged *float64 + TCPSackShiftFallback *float64 + TCPBacklogDrop *float64 + PFMemallocDrop *float64 + TCPMinTTLDrop *float64 + TCPDeferAcceptDrop *float64 + IPReversePathFilter *float64 + TCPTimeWaitOverflow *float64 + TCPReqQFullDoCookies *float64 + TCPReqQFullDrop *float64 + TCPRetransFail *float64 + TCPRcvCoalesce *float64 + TCPRcvQDrop *float64 + TCPOFOQueue *float64 + TCPOFODrop *float64 + TCPOFOMerge *float64 + TCPChallengeACK *float64 + TCPSYNChallenge *float64 + TCPFastOpenActive *float64 + TCPFastOpenActiveFail *float64 + TCPFastOpenPassive *float64 + TCPFastOpenPassiveFail *float64 + TCPFastOpenListenOverflow *float64 + TCPFastOpenCookieReqd *float64 + TCPFastOpenBlackhole *float64 + TCPSpuriousRtxHostQueues *float64 + BusyPollRxPackets *float64 + TCPAutoCorking *float64 + TCPFromZeroWindowAdv *float64 + TCPToZeroWindowAdv *float64 + TCPWantZeroWindowAdv *float64 + TCPSynRetrans *float64 + TCPOrigDataSent *float64 + TCPHystartTrainDetect *float64 + TCPHystartTrainCwnd *float64 + TCPHystartDelayDetect *float64 + TCPHystartDelayCwnd *float64 + TCPACKSkippedSynRecv *float64 + TCPACKSkippedPAWS *float64 + TCPACKSkippedSeq *float64 + TCPACKSkippedFinWait2 *float64 + TCPACKSkippedTimeWait *float64 + TCPACKSkippedChallenge *float64 + TCPWinProbe *float64 + TCPKeepAlive *float64 + TCPMTUPFail *float64 + TCPMTUPSuccess *float64 + TCPWqueueTooBig *float64 } type IpExt struct { // nolint:revive - InNoRoutes float64 - InTruncatedPkts float64 - InMcastPkts float64 - OutMcastPkts float64 - InBcastPkts float64 - OutBcastPkts float64 - InOctets float64 - OutOctets float64 - InMcastOctets float64 - OutMcastOctets float64 - InBcastOctets float64 - OutBcastOctets float64 - InCsumErrors float64 - InNoECTPkts float64 - InECT1Pkts float64 - InECT0Pkts float64 - InCEPkts float64 - ReasmOverlaps float64 + InNoRoutes *float64 + InTruncatedPkts *float64 + InMcastPkts *float64 + OutMcastPkts *float64 + InBcastPkts *float64 + OutBcastPkts *float64 + InOctets *float64 + OutOctets *float64 + InMcastOctets *float64 + OutMcastOctets *float64 + InBcastOctets *float64 + OutBcastOctets *float64 + InCsumErrors *float64 + InNoECTPkts *float64 + InECT1Pkts *float64 + InECT0Pkts *float64 + InCEPkts *float64 + ReasmOverlaps *float64 } func (p Proc) Netstat() (ProcNetstat, error) { @@ -174,14 +175,14 @@ func (p Proc) Netstat() (ProcNetstat, error) { if err != nil { return ProcNetstat{PID: p.PID}, err } - procNetstat, err := parseNetstat(bytes.NewReader(data), filename) + procNetstat, err := parseProcNetstat(bytes.NewReader(data), filename) procNetstat.PID = p.PID return procNetstat, err } -// parseNetstat parses the metrics from proc/<pid>/net/netstat file +// parseProcNetstat parses the metrics from proc/<pid>/net/netstat file // and returns a ProcNetstat structure. -func parseNetstat(r io.Reader, fileName string) (ProcNetstat, error) { +func parseProcNetstat(r io.Reader, fileName string) (ProcNetstat, error) { var ( scanner = bufio.NewScanner(r) procNetstat = ProcNetstat{} @@ -194,8 +195,8 @@ func parseNetstat(r io.Reader, fileName string) (ProcNetstat, error) { // Remove trailing :. protocol := strings.TrimSuffix(nameParts[0], ":") if len(nameParts) != len(valueParts) { - return procNetstat, fmt.Errorf("mismatch field count mismatch in %s: %s", - fileName, protocol) + return procNetstat, fmt.Errorf("%w: mismatch field count mismatch in %s: %s", + ErrFileParse, fileName, protocol) } for i := 1; i < len(nameParts); i++ { value, err := strconv.ParseFloat(valueParts[i], 64) @@ -208,230 +209,232 @@ func parseNetstat(r io.Reader, fileName string) (ProcNetstat, error) { case "TcpExt": switch key { case "SyncookiesSent": - procNetstat.TcpExt.SyncookiesSent = value + procNetstat.TcpExt.SyncookiesSent = &value case "SyncookiesRecv": - procNetstat.TcpExt.SyncookiesRecv = value + procNetstat.TcpExt.SyncookiesRecv = &value case "SyncookiesFailed": - procNetstat.TcpExt.SyncookiesFailed = value + procNetstat.TcpExt.SyncookiesFailed = &value case "EmbryonicRsts": - procNetstat.TcpExt.EmbryonicRsts = value + procNetstat.TcpExt.EmbryonicRsts = &value case "PruneCalled": - procNetstat.TcpExt.PruneCalled = value + procNetstat.TcpExt.PruneCalled = &value case "RcvPruned": - procNetstat.TcpExt.RcvPruned = value + procNetstat.TcpExt.RcvPruned = &value case "OfoPruned": - procNetstat.TcpExt.OfoPruned = value + procNetstat.TcpExt.OfoPruned = &value case "OutOfWindowIcmps": - procNetstat.TcpExt.OutOfWindowIcmps = value + procNetstat.TcpExt.OutOfWindowIcmps = &value case "LockDroppedIcmps": - procNetstat.TcpExt.LockDroppedIcmps = value + procNetstat.TcpExt.LockDroppedIcmps = &value case "ArpFilter": - procNetstat.TcpExt.ArpFilter = value + procNetstat.TcpExt.ArpFilter = &value case "TW": - procNetstat.TcpExt.TW = value + procNetstat.TcpExt.TW = &value case "TWRecycled": - procNetstat.TcpExt.TWRecycled = value + procNetstat.TcpExt.TWRecycled = &value case "TWKilled": - procNetstat.TcpExt.TWKilled = value + procNetstat.TcpExt.TWKilled = &value case "PAWSActive": - procNetstat.TcpExt.PAWSActive = value + procNetstat.TcpExt.PAWSActive = &value case "PAWSEstab": - procNetstat.TcpExt.PAWSEstab = value + procNetstat.TcpExt.PAWSEstab = &value case "DelayedACKs": - procNetstat.TcpExt.DelayedACKs = value + procNetstat.TcpExt.DelayedACKs = &value case "DelayedACKLocked": - procNetstat.TcpExt.DelayedACKLocked = value + procNetstat.TcpExt.DelayedACKLocked = &value case "DelayedACKLost": - procNetstat.TcpExt.DelayedACKLost = value + procNetstat.TcpExt.DelayedACKLost = &value case "ListenOverflows": - procNetstat.TcpExt.ListenOverflows = value + procNetstat.TcpExt.ListenOverflows = &value case "ListenDrops": - procNetstat.TcpExt.ListenDrops = value + procNetstat.TcpExt.ListenDrops = &value case "TCPHPHits": - procNetstat.TcpExt.TCPHPHits = value + procNetstat.TcpExt.TCPHPHits = &value case "TCPPureAcks": - procNetstat.TcpExt.TCPPureAcks = value + procNetstat.TcpExt.TCPPureAcks = &value case "TCPHPAcks": - procNetstat.TcpExt.TCPHPAcks = value + procNetstat.TcpExt.TCPHPAcks = &value case "TCPRenoRecovery": - procNetstat.TcpExt.TCPRenoRecovery = value + procNetstat.TcpExt.TCPRenoRecovery = &value case "TCPSackRecovery": - procNetstat.TcpExt.TCPSackRecovery = value + procNetstat.TcpExt.TCPSackRecovery = &value case "TCPSACKReneging": - procNetstat.TcpExt.TCPSACKReneging = value + procNetstat.TcpExt.TCPSACKReneging = &value case "TCPSACKReorder": - procNetstat.TcpExt.TCPSACKReorder = value + procNetstat.TcpExt.TCPSACKReorder = &value case "TCPRenoReorder": - procNetstat.TcpExt.TCPRenoReorder = value + procNetstat.TcpExt.TCPRenoReorder = &value case "TCPTSReorder": - procNetstat.TcpExt.TCPTSReorder = value + procNetstat.TcpExt.TCPTSReorder = &value case "TCPFullUndo": - procNetstat.TcpExt.TCPFullUndo = value + procNetstat.TcpExt.TCPFullUndo = &value case "TCPPartialUndo": - procNetstat.TcpExt.TCPPartialUndo = value + procNetstat.TcpExt.TCPPartialUndo = &value case "TCPDSACKUndo": - procNetstat.TcpExt.TCPDSACKUndo = value + procNetstat.TcpExt.TCPDSACKUndo = &value case "TCPLossUndo": - procNetstat.TcpExt.TCPLossUndo = value + procNetstat.TcpExt.TCPLossUndo = &value case "TCPLostRetransmit": - procNetstat.TcpExt.TCPLostRetransmit = value + procNetstat.TcpExt.TCPLostRetransmit = &value case "TCPRenoFailures": - procNetstat.TcpExt.TCPRenoFailures = value + procNetstat.TcpExt.TCPRenoFailures = &value case "TCPSackFailures": - procNetstat.TcpExt.TCPSackFailures = value + procNetstat.TcpExt.TCPSackFailures = &value case "TCPLossFailures": - procNetstat.TcpExt.TCPLossFailures = value + procNetstat.TcpExt.TCPLossFailures = &value case "TCPFastRetrans": - procNetstat.TcpExt.TCPFastRetrans = value + procNetstat.TcpExt.TCPFastRetrans = &value case "TCPSlowStartRetrans": - procNetstat.TcpExt.TCPSlowStartRetrans = value + procNetstat.TcpExt.TCPSlowStartRetrans = &value case "TCPTimeouts": - procNetstat.TcpExt.TCPTimeouts = value + procNetstat.TcpExt.TCPTimeouts = &value case "TCPLossProbes": - procNetstat.TcpExt.TCPLossProbes = value + procNetstat.TcpExt.TCPLossProbes = &value case "TCPLossProbeRecovery": - procNetstat.TcpExt.TCPLossProbeRecovery = value + procNetstat.TcpExt.TCPLossProbeRecovery = &value case "TCPRenoRecoveryFail": - procNetstat.TcpExt.TCPRenoRecoveryFail = value + procNetstat.TcpExt.TCPRenoRecoveryFail = &value case "TCPSackRecoveryFail": - procNetstat.TcpExt.TCPSackRecoveryFail = value + procNetstat.TcpExt.TCPSackRecoveryFail = &value case "TCPRcvCollapsed": - procNetstat.TcpExt.TCPRcvCollapsed = value + procNetstat.TcpExt.TCPRcvCollapsed = &value case "TCPDSACKOldSent": - procNetstat.TcpExt.TCPDSACKOldSent = value + procNetstat.TcpExt.TCPDSACKOldSent = &value case "TCPDSACKOfoSent": - procNetstat.TcpExt.TCPDSACKOfoSent = value + procNetstat.TcpExt.TCPDSACKOfoSent = &value case "TCPDSACKRecv": - procNetstat.TcpExt.TCPDSACKRecv = value + procNetstat.TcpExt.TCPDSACKRecv = &value case "TCPDSACKOfoRecv": - procNetstat.TcpExt.TCPDSACKOfoRecv = value + procNetstat.TcpExt.TCPDSACKOfoRecv = &value case "TCPAbortOnData": - procNetstat.TcpExt.TCPAbortOnData = value + procNetstat.TcpExt.TCPAbortOnData = &value case "TCPAbortOnClose": - procNetstat.TcpExt.TCPAbortOnClose = value + procNetstat.TcpExt.TCPAbortOnClose = &value case "TCPDeferAcceptDrop": - procNetstat.TcpExt.TCPDeferAcceptDrop = value + procNetstat.TcpExt.TCPDeferAcceptDrop = &value case "IPReversePathFilter": - procNetstat.TcpExt.IPReversePathFilter = value + procNetstat.TcpExt.IPReversePathFilter = &value case "TCPTimeWaitOverflow": - procNetstat.TcpExt.TCPTimeWaitOverflow = value + procNetstat.TcpExt.TCPTimeWaitOverflow = &value case "TCPReqQFullDoCookies": - procNetstat.TcpExt.TCPReqQFullDoCookies = value + procNetstat.TcpExt.TCPReqQFullDoCookies = &value case "TCPReqQFullDrop": - procNetstat.TcpExt.TCPReqQFullDrop = value + procNetstat.TcpExt.TCPReqQFullDrop = &value case "TCPRetransFail": - procNetstat.TcpExt.TCPRetransFail = value + procNetstat.TcpExt.TCPRetransFail = &value case "TCPRcvCoalesce": - procNetstat.TcpExt.TCPRcvCoalesce = value + procNetstat.TcpExt.TCPRcvCoalesce = &value + case "TCPRcvQDrop": + procNetstat.TcpExt.TCPRcvQDrop = &value case "TCPOFOQueue": - procNetstat.TcpExt.TCPOFOQueue = value + procNetstat.TcpExt.TCPOFOQueue = &value case "TCPOFODrop": - procNetstat.TcpExt.TCPOFODrop = value + procNetstat.TcpExt.TCPOFODrop = &value case "TCPOFOMerge": - procNetstat.TcpExt.TCPOFOMerge = value + procNetstat.TcpExt.TCPOFOMerge = &value case "TCPChallengeACK": - procNetstat.TcpExt.TCPChallengeACK = value + procNetstat.TcpExt.TCPChallengeACK = &value case "TCPSYNChallenge": - procNetstat.TcpExt.TCPSYNChallenge = value + procNetstat.TcpExt.TCPSYNChallenge = &value case "TCPFastOpenActive": - procNetstat.TcpExt.TCPFastOpenActive = value + procNetstat.TcpExt.TCPFastOpenActive = &value case "TCPFastOpenActiveFail": - procNetstat.TcpExt.TCPFastOpenActiveFail = value + procNetstat.TcpExt.TCPFastOpenActiveFail = &value case "TCPFastOpenPassive": - procNetstat.TcpExt.TCPFastOpenPassive = value + procNetstat.TcpExt.TCPFastOpenPassive = &value case "TCPFastOpenPassiveFail": - procNetstat.TcpExt.TCPFastOpenPassiveFail = value + procNetstat.TcpExt.TCPFastOpenPassiveFail = &value case "TCPFastOpenListenOverflow": - procNetstat.TcpExt.TCPFastOpenListenOverflow = value + procNetstat.TcpExt.TCPFastOpenListenOverflow = &value case "TCPFastOpenCookieReqd": - procNetstat.TcpExt.TCPFastOpenCookieReqd = value + procNetstat.TcpExt.TCPFastOpenCookieReqd = &value case "TCPFastOpenBlackhole": - procNetstat.TcpExt.TCPFastOpenBlackhole = value + procNetstat.TcpExt.TCPFastOpenBlackhole = &value case "TCPSpuriousRtxHostQueues": - procNetstat.TcpExt.TCPSpuriousRtxHostQueues = value + procNetstat.TcpExt.TCPSpuriousRtxHostQueues = &value case "BusyPollRxPackets": - procNetstat.TcpExt.BusyPollRxPackets = value + procNetstat.TcpExt.BusyPollRxPackets = &value case "TCPAutoCorking": - procNetstat.TcpExt.TCPAutoCorking = value + procNetstat.TcpExt.TCPAutoCorking = &value case "TCPFromZeroWindowAdv": - procNetstat.TcpExt.TCPFromZeroWindowAdv = value + procNetstat.TcpExt.TCPFromZeroWindowAdv = &value case "TCPToZeroWindowAdv": - procNetstat.TcpExt.TCPToZeroWindowAdv = value + procNetstat.TcpExt.TCPToZeroWindowAdv = &value case "TCPWantZeroWindowAdv": - procNetstat.TcpExt.TCPWantZeroWindowAdv = value + procNetstat.TcpExt.TCPWantZeroWindowAdv = &value case "TCPSynRetrans": - procNetstat.TcpExt.TCPSynRetrans = value + procNetstat.TcpExt.TCPSynRetrans = &value case "TCPOrigDataSent": - procNetstat.TcpExt.TCPOrigDataSent = value + procNetstat.TcpExt.TCPOrigDataSent = &value case "TCPHystartTrainDetect": - procNetstat.TcpExt.TCPHystartTrainDetect = value + procNetstat.TcpExt.TCPHystartTrainDetect = &value case "TCPHystartTrainCwnd": - procNetstat.TcpExt.TCPHystartTrainCwnd = value + procNetstat.TcpExt.TCPHystartTrainCwnd = &value case "TCPHystartDelayDetect": - procNetstat.TcpExt.TCPHystartDelayDetect = value + procNetstat.TcpExt.TCPHystartDelayDetect = &value case "TCPHystartDelayCwnd": - procNetstat.TcpExt.TCPHystartDelayCwnd = value + procNetstat.TcpExt.TCPHystartDelayCwnd = &value case "TCPACKSkippedSynRecv": - procNetstat.TcpExt.TCPACKSkippedSynRecv = value + procNetstat.TcpExt.TCPACKSkippedSynRecv = &value case "TCPACKSkippedPAWS": - procNetstat.TcpExt.TCPACKSkippedPAWS = value + procNetstat.TcpExt.TCPACKSkippedPAWS = &value case "TCPACKSkippedSeq": - procNetstat.TcpExt.TCPACKSkippedSeq = value + procNetstat.TcpExt.TCPACKSkippedSeq = &value case "TCPACKSkippedFinWait2": - procNetstat.TcpExt.TCPACKSkippedFinWait2 = value + procNetstat.TcpExt.TCPACKSkippedFinWait2 = &value case "TCPACKSkippedTimeWait": - procNetstat.TcpExt.TCPACKSkippedTimeWait = value + procNetstat.TcpExt.TCPACKSkippedTimeWait = &value case "TCPACKSkippedChallenge": - procNetstat.TcpExt.TCPACKSkippedChallenge = value + procNetstat.TcpExt.TCPACKSkippedChallenge = &value case "TCPWinProbe": - procNetstat.TcpExt.TCPWinProbe = value + procNetstat.TcpExt.TCPWinProbe = &value case "TCPKeepAlive": - procNetstat.TcpExt.TCPKeepAlive = value + procNetstat.TcpExt.TCPKeepAlive = &value case "TCPMTUPFail": - procNetstat.TcpExt.TCPMTUPFail = value + procNetstat.TcpExt.TCPMTUPFail = &value case "TCPMTUPSuccess": - procNetstat.TcpExt.TCPMTUPSuccess = value + procNetstat.TcpExt.TCPMTUPSuccess = &value case "TCPWqueueTooBig": - procNetstat.TcpExt.TCPWqueueTooBig = value + procNetstat.TcpExt.TCPWqueueTooBig = &value } case "IpExt": switch key { case "InNoRoutes": - procNetstat.IpExt.InNoRoutes = value + procNetstat.IpExt.InNoRoutes = &value case "InTruncatedPkts": - procNetstat.IpExt.InTruncatedPkts = value + procNetstat.IpExt.InTruncatedPkts = &value case "InMcastPkts": - procNetstat.IpExt.InMcastPkts = value + procNetstat.IpExt.InMcastPkts = &value case "OutMcastPkts": - procNetstat.IpExt.OutMcastPkts = value + procNetstat.IpExt.OutMcastPkts = &value case "InBcastPkts": - procNetstat.IpExt.InBcastPkts = value + procNetstat.IpExt.InBcastPkts = &value case "OutBcastPkts": - procNetstat.IpExt.OutBcastPkts = value + procNetstat.IpExt.OutBcastPkts = &value case "InOctets": - procNetstat.IpExt.InOctets = value + procNetstat.IpExt.InOctets = &value case "OutOctets": - procNetstat.IpExt.OutOctets = value + procNetstat.IpExt.OutOctets = &value case "InMcastOctets": - procNetstat.IpExt.InMcastOctets = value + procNetstat.IpExt.InMcastOctets = &value case "OutMcastOctets": - procNetstat.IpExt.OutMcastOctets = value + procNetstat.IpExt.OutMcastOctets = &value case "InBcastOctets": - procNetstat.IpExt.InBcastOctets = value + procNetstat.IpExt.InBcastOctets = &value case "OutBcastOctets": - procNetstat.IpExt.OutBcastOctets = value + procNetstat.IpExt.OutBcastOctets = &value case "InCsumErrors": - procNetstat.IpExt.InCsumErrors = value + procNetstat.IpExt.InCsumErrors = &value case "InNoECTPkts": - procNetstat.IpExt.InNoECTPkts = value + procNetstat.IpExt.InNoECTPkts = &value case "InECT1Pkts": - procNetstat.IpExt.InECT1Pkts = value + procNetstat.IpExt.InECT1Pkts = &value case "InECT0Pkts": - procNetstat.IpExt.InECT0Pkts = value + procNetstat.IpExt.InECT0Pkts = &value case "InCEPkts": - procNetstat.IpExt.InCEPkts = value + procNetstat.IpExt.InCEPkts = &value case "ReasmOverlaps": - procNetstat.IpExt.ReasmOverlaps = value + procNetstat.IpExt.ReasmOverlaps = &value } } } diff --git a/vendor/github.com/prometheus/procfs/proc_ns.go b/vendor/github.com/prometheus/procfs/proc_ns.go index 391b4cbd11..c22666750f 100644 --- a/vendor/github.com/prometheus/procfs/proc_ns.go +++ b/vendor/github.com/prometheus/procfs/proc_ns.go @@ -40,7 +40,7 @@ func (p Proc) Namespaces() (Namespaces, error) { names, err := d.Readdirnames(-1) if err != nil { - return nil, fmt.Errorf("failed to read contents of ns dir: %w", err) + return nil, fmt.Errorf("%s: failed to read contents of ns dir: %w", ErrFileRead, err) } ns := make(Namespaces, len(names)) @@ -52,13 +52,13 @@ func (p Proc) Namespaces() (Namespaces, error) { fields := strings.SplitN(target, ":", 2) if len(fields) != 2 { - return nil, fmt.Errorf("failed to parse namespace type and inode from %q", target) + return nil, fmt.Errorf("%w: namespace type and inode from %q", ErrFileParse, target) } typ := fields[0] inode, err := strconv.ParseUint(strings.Trim(fields[1], "[]"), 10, 32) if err != nil { - return nil, fmt.Errorf("failed to parse inode from %q: %w", fields[1], err) + return nil, fmt.Errorf("%s: inode from %q: %w", ErrFileParse, fields[1], err) } ns[name] = Namespace{typ, uint32(inode)} diff --git a/vendor/github.com/prometheus/procfs/proc_psi.go b/vendor/github.com/prometheus/procfs/proc_psi.go index a68fe15290..fe9dbb425f 100644 --- a/vendor/github.com/prometheus/procfs/proc_psi.go +++ b/vendor/github.com/prometheus/procfs/proc_psi.go @@ -61,14 +61,14 @@ type PSIStats struct { func (fs FS) PSIStatsForResource(resource string) (PSIStats, error) { data, err := util.ReadFileNoStat(fs.proc.Path(fmt.Sprintf("%s/%s", "pressure", resource))) if err != nil { - return PSIStats{}, fmt.Errorf("psi_stats: unavailable for %q: %w", resource, err) + return PSIStats{}, fmt.Errorf("%s: psi_stats: unavailable for %q: %w", ErrFileRead, resource, err) } - return parsePSIStats(resource, bytes.NewReader(data)) + return parsePSIStats(bytes.NewReader(data)) } // parsePSIStats parses the specified file for pressure stall information. -func parsePSIStats(resource string, r io.Reader) (PSIStats, error) { +func parsePSIStats(r io.Reader) (PSIStats, error) { psiStats := PSIStats{} scanner := bufio.NewScanner(r) diff --git a/vendor/github.com/prometheus/procfs/proc_smaps.go b/vendor/github.com/prometheus/procfs/proc_smaps.go index 0e97d99575..ad8785a407 100644 --- a/vendor/github.com/prometheus/procfs/proc_smaps.go +++ b/vendor/github.com/prometheus/procfs/proc_smaps.go @@ -135,12 +135,12 @@ func (s *ProcSMapsRollup) parseLine(line string) error { } vBytes := vKBytes * 1024 - s.addValue(k, v, vKBytes, vBytes) + s.addValue(k, vBytes) return nil } -func (s *ProcSMapsRollup) addValue(k string, vString string, vUint uint64, vUintBytes uint64) { +func (s *ProcSMapsRollup) addValue(k string, vUintBytes uint64) { switch k { case "Rss": s.Rss += vUintBytes diff --git a/vendor/github.com/prometheus/procfs/proc_snmp.go b/vendor/github.com/prometheus/procfs/proc_snmp.go index ae191896cb..b9d2cf642a 100644 --- a/vendor/github.com/prometheus/procfs/proc_snmp.go +++ b/vendor/github.com/prometheus/procfs/proc_snmp.go @@ -37,100 +37,100 @@ type ProcSnmp struct { } type Ip struct { // nolint:revive - Forwarding float64 - DefaultTTL float64 - InReceives float64 - InHdrErrors float64 - InAddrErrors float64 - ForwDatagrams float64 - InUnknownProtos float64 - InDiscards float64 - InDelivers float64 - OutRequests float64 - OutDiscards float64 - OutNoRoutes float64 - ReasmTimeout float64 - ReasmReqds float64 - ReasmOKs float64 - ReasmFails float64 - FragOKs float64 - FragFails float64 - FragCreates float64 + Forwarding *float64 + DefaultTTL *float64 + InReceives *float64 + InHdrErrors *float64 + InAddrErrors *float64 + ForwDatagrams *float64 + InUnknownProtos *float64 + InDiscards *float64 + InDelivers *float64 + OutRequests *float64 + OutDiscards *float64 + OutNoRoutes *float64 + ReasmTimeout *float64 + ReasmReqds *float64 + ReasmOKs *float64 + ReasmFails *float64 + FragOKs *float64 + FragFails *float64 + FragCreates *float64 } -type Icmp struct { - InMsgs float64 - InErrors float64 - InCsumErrors float64 - InDestUnreachs float64 - InTimeExcds float64 - InParmProbs float64 - InSrcQuenchs float64 - InRedirects float64 - InEchos float64 - InEchoReps float64 - InTimestamps float64 - InTimestampReps float64 - InAddrMasks float64 - InAddrMaskReps float64 - OutMsgs float64 - OutErrors float64 - OutDestUnreachs float64 - OutTimeExcds float64 - OutParmProbs float64 - OutSrcQuenchs float64 - OutRedirects float64 - OutEchos float64 - OutEchoReps float64 - OutTimestamps float64 - OutTimestampReps float64 - OutAddrMasks float64 - OutAddrMaskReps float64 +type Icmp struct { // nolint:revive + InMsgs *float64 + InErrors *float64 + InCsumErrors *float64 + InDestUnreachs *float64 + InTimeExcds *float64 + InParmProbs *float64 + InSrcQuenchs *float64 + InRedirects *float64 + InEchos *float64 + InEchoReps *float64 + InTimestamps *float64 + InTimestampReps *float64 + InAddrMasks *float64 + InAddrMaskReps *float64 + OutMsgs *float64 + OutErrors *float64 + OutDestUnreachs *float64 + OutTimeExcds *float64 + OutParmProbs *float64 + OutSrcQuenchs *float64 + OutRedirects *float64 + OutEchos *float64 + OutEchoReps *float64 + OutTimestamps *float64 + OutTimestampReps *float64 + OutAddrMasks *float64 + OutAddrMaskReps *float64 } type IcmpMsg struct { - InType3 float64 - OutType3 float64 + InType3 *float64 + OutType3 *float64 } type Tcp struct { // nolint:revive - RtoAlgorithm float64 - RtoMin float64 - RtoMax float64 - MaxConn float64 - ActiveOpens float64 - PassiveOpens float64 - AttemptFails float64 - EstabResets float64 - CurrEstab float64 - InSegs float64 - OutSegs float64 - RetransSegs float64 - InErrs float64 - OutRsts float64 - InCsumErrors float64 + RtoAlgorithm *float64 + RtoMin *float64 + RtoMax *float64 + MaxConn *float64 + ActiveOpens *float64 + PassiveOpens *float64 + AttemptFails *float64 + EstabResets *float64 + CurrEstab *float64 + InSegs *float64 + OutSegs *float64 + RetransSegs *float64 + InErrs *float64 + OutRsts *float64 + InCsumErrors *float64 } type Udp struct { // nolint:revive - InDatagrams float64 - NoPorts float64 - InErrors float64 - OutDatagrams float64 - RcvbufErrors float64 - SndbufErrors float64 - InCsumErrors float64 - IgnoredMulti float64 + InDatagrams *float64 + NoPorts *float64 + InErrors *float64 + OutDatagrams *float64 + RcvbufErrors *float64 + SndbufErrors *float64 + InCsumErrors *float64 + IgnoredMulti *float64 } type UdpLite struct { // nolint:revive - InDatagrams float64 - NoPorts float64 - InErrors float64 - OutDatagrams float64 - RcvbufErrors float64 - SndbufErrors float64 - InCsumErrors float64 - IgnoredMulti float64 + InDatagrams *float64 + NoPorts *float64 + InErrors *float64 + OutDatagrams *float64 + RcvbufErrors *float64 + SndbufErrors *float64 + InCsumErrors *float64 + IgnoredMulti *float64 } func (p Proc) Snmp() (ProcSnmp, error) { @@ -159,8 +159,8 @@ func parseSnmp(r io.Reader, fileName string) (ProcSnmp, error) { // Remove trailing :. protocol := strings.TrimSuffix(nameParts[0], ":") if len(nameParts) != len(valueParts) { - return procSnmp, fmt.Errorf("mismatch field count mismatch in %s: %s", - fileName, protocol) + return procSnmp, fmt.Errorf("%w: mismatch field count mismatch in %s: %s", + ErrFileParse, fileName, protocol) } for i := 1; i < len(nameParts); i++ { value, err := strconv.ParseFloat(valueParts[i], 64) @@ -173,178 +173,178 @@ func parseSnmp(r io.Reader, fileName string) (ProcSnmp, error) { case "Ip": switch key { case "Forwarding": - procSnmp.Ip.Forwarding = value + procSnmp.Ip.Forwarding = &value case "DefaultTTL": - procSnmp.Ip.DefaultTTL = value + procSnmp.Ip.DefaultTTL = &value case "InReceives": - procSnmp.Ip.InReceives = value + procSnmp.Ip.InReceives = &value case "InHdrErrors": - procSnmp.Ip.InHdrErrors = value + procSnmp.Ip.InHdrErrors = &value case "InAddrErrors": - procSnmp.Ip.InAddrErrors = value + procSnmp.Ip.InAddrErrors = &value case "ForwDatagrams": - procSnmp.Ip.ForwDatagrams = value + procSnmp.Ip.ForwDatagrams = &value case "InUnknownProtos": - procSnmp.Ip.InUnknownProtos = value + procSnmp.Ip.InUnknownProtos = &value case "InDiscards": - procSnmp.Ip.InDiscards = value + procSnmp.Ip.InDiscards = &value case "InDelivers": - procSnmp.Ip.InDelivers = value + procSnmp.Ip.InDelivers = &value case "OutRequests": - procSnmp.Ip.OutRequests = value + procSnmp.Ip.OutRequests = &value case "OutDiscards": - procSnmp.Ip.OutDiscards = value + procSnmp.Ip.OutDiscards = &value case "OutNoRoutes": - procSnmp.Ip.OutNoRoutes = value + procSnmp.Ip.OutNoRoutes = &value case "ReasmTimeout": - procSnmp.Ip.ReasmTimeout = value + procSnmp.Ip.ReasmTimeout = &value case "ReasmReqds": - procSnmp.Ip.ReasmReqds = value + procSnmp.Ip.ReasmReqds = &value case "ReasmOKs": - procSnmp.Ip.ReasmOKs = value + procSnmp.Ip.ReasmOKs = &value case "ReasmFails": - procSnmp.Ip.ReasmFails = value + procSnmp.Ip.ReasmFails = &value case "FragOKs": - procSnmp.Ip.FragOKs = value + procSnmp.Ip.FragOKs = &value case "FragFails": - procSnmp.Ip.FragFails = value + procSnmp.Ip.FragFails = &value case "FragCreates": - procSnmp.Ip.FragCreates = value + procSnmp.Ip.FragCreates = &value } case "Icmp": switch key { case "InMsgs": - procSnmp.Icmp.InMsgs = value + procSnmp.Icmp.InMsgs = &value case "InErrors": - procSnmp.Icmp.InErrors = value + procSnmp.Icmp.InErrors = &value case "InCsumErrors": - procSnmp.Icmp.InCsumErrors = value + procSnmp.Icmp.InCsumErrors = &value case "InDestUnreachs": - procSnmp.Icmp.InDestUnreachs = value + procSnmp.Icmp.InDestUnreachs = &value case "InTimeExcds": - procSnmp.Icmp.InTimeExcds = value + procSnmp.Icmp.InTimeExcds = &value case "InParmProbs": - procSnmp.Icmp.InParmProbs = value + procSnmp.Icmp.InParmProbs = &value case "InSrcQuenchs": - procSnmp.Icmp.InSrcQuenchs = value + procSnmp.Icmp.InSrcQuenchs = &value case "InRedirects": - procSnmp.Icmp.InRedirects = value + procSnmp.Icmp.InRedirects = &value case "InEchos": - procSnmp.Icmp.InEchos = value + procSnmp.Icmp.InEchos = &value case "InEchoReps": - procSnmp.Icmp.InEchoReps = value + procSnmp.Icmp.InEchoReps = &value case "InTimestamps": - procSnmp.Icmp.InTimestamps = value + procSnmp.Icmp.InTimestamps = &value case "InTimestampReps": - procSnmp.Icmp.InTimestampReps = value + procSnmp.Icmp.InTimestampReps = &value case "InAddrMasks": - procSnmp.Icmp.InAddrMasks = value + procSnmp.Icmp.InAddrMasks = &value case "InAddrMaskReps": - procSnmp.Icmp.InAddrMaskReps = value + procSnmp.Icmp.InAddrMaskReps = &value case "OutMsgs": - procSnmp.Icmp.OutMsgs = value + procSnmp.Icmp.OutMsgs = &value case "OutErrors": - procSnmp.Icmp.OutErrors = value + procSnmp.Icmp.OutErrors = &value case "OutDestUnreachs": - procSnmp.Icmp.OutDestUnreachs = value + procSnmp.Icmp.OutDestUnreachs = &value case "OutTimeExcds": - procSnmp.Icmp.OutTimeExcds = value + procSnmp.Icmp.OutTimeExcds = &value case "OutParmProbs": - procSnmp.Icmp.OutParmProbs = value + procSnmp.Icmp.OutParmProbs = &value case "OutSrcQuenchs": - procSnmp.Icmp.OutSrcQuenchs = value + procSnmp.Icmp.OutSrcQuenchs = &value case "OutRedirects": - procSnmp.Icmp.OutRedirects = value + procSnmp.Icmp.OutRedirects = &value case "OutEchos": - procSnmp.Icmp.OutEchos = value + procSnmp.Icmp.OutEchos = &value case "OutEchoReps": - procSnmp.Icmp.OutEchoReps = value + procSnmp.Icmp.OutEchoReps = &value case "OutTimestamps": - procSnmp.Icmp.OutTimestamps = value + procSnmp.Icmp.OutTimestamps = &value case "OutTimestampReps": - procSnmp.Icmp.OutTimestampReps = value + procSnmp.Icmp.OutTimestampReps = &value case "OutAddrMasks": - procSnmp.Icmp.OutAddrMasks = value + procSnmp.Icmp.OutAddrMasks = &value case "OutAddrMaskReps": - procSnmp.Icmp.OutAddrMaskReps = value + procSnmp.Icmp.OutAddrMaskReps = &value } case "IcmpMsg": switch key { case "InType3": - procSnmp.IcmpMsg.InType3 = value + procSnmp.IcmpMsg.InType3 = &value case "OutType3": - procSnmp.IcmpMsg.OutType3 = value + procSnmp.IcmpMsg.OutType3 = &value } case "Tcp": switch key { case "RtoAlgorithm": - procSnmp.Tcp.RtoAlgorithm = value + procSnmp.Tcp.RtoAlgorithm = &value case "RtoMin": - procSnmp.Tcp.RtoMin = value + procSnmp.Tcp.RtoMin = &value case "RtoMax": - procSnmp.Tcp.RtoMax = value + procSnmp.Tcp.RtoMax = &value case "MaxConn": - procSnmp.Tcp.MaxConn = value + procSnmp.Tcp.MaxConn = &value case "ActiveOpens": - procSnmp.Tcp.ActiveOpens = value + procSnmp.Tcp.ActiveOpens = &value case "PassiveOpens": - procSnmp.Tcp.PassiveOpens = value + procSnmp.Tcp.PassiveOpens = &value case "AttemptFails": - procSnmp.Tcp.AttemptFails = value + procSnmp.Tcp.AttemptFails = &value case "EstabResets": - procSnmp.Tcp.EstabResets = value + procSnmp.Tcp.EstabResets = &value case "CurrEstab": - procSnmp.Tcp.CurrEstab = value + procSnmp.Tcp.CurrEstab = &value case "InSegs": - procSnmp.Tcp.InSegs = value + procSnmp.Tcp.InSegs = &value case "OutSegs": - procSnmp.Tcp.OutSegs = value + procSnmp.Tcp.OutSegs = &value case "RetransSegs": - procSnmp.Tcp.RetransSegs = value + procSnmp.Tcp.RetransSegs = &value case "InErrs": - procSnmp.Tcp.InErrs = value + procSnmp.Tcp.InErrs = &value case "OutRsts": - procSnmp.Tcp.OutRsts = value + procSnmp.Tcp.OutRsts = &value case "InCsumErrors": - procSnmp.Tcp.InCsumErrors = value + procSnmp.Tcp.InCsumErrors = &value } case "Udp": switch key { case "InDatagrams": - procSnmp.Udp.InDatagrams = value + procSnmp.Udp.InDatagrams = &value case "NoPorts": - procSnmp.Udp.NoPorts = value + procSnmp.Udp.NoPorts = &value case "InErrors": - procSnmp.Udp.InErrors = value + procSnmp.Udp.InErrors = &value case "OutDatagrams": - procSnmp.Udp.OutDatagrams = value + procSnmp.Udp.OutDatagrams = &value case "RcvbufErrors": - procSnmp.Udp.RcvbufErrors = value + procSnmp.Udp.RcvbufErrors = &value case "SndbufErrors": - procSnmp.Udp.SndbufErrors = value + procSnmp.Udp.SndbufErrors = &value case "InCsumErrors": - procSnmp.Udp.InCsumErrors = value + procSnmp.Udp.InCsumErrors = &value case "IgnoredMulti": - procSnmp.Udp.IgnoredMulti = value + procSnmp.Udp.IgnoredMulti = &value } case "UdpLite": switch key { case "InDatagrams": - procSnmp.UdpLite.InDatagrams = value + procSnmp.UdpLite.InDatagrams = &value case "NoPorts": - procSnmp.UdpLite.NoPorts = value + procSnmp.UdpLite.NoPorts = &value case "InErrors": - procSnmp.UdpLite.InErrors = value + procSnmp.UdpLite.InErrors = &value case "OutDatagrams": - procSnmp.UdpLite.OutDatagrams = value + procSnmp.UdpLite.OutDatagrams = &value case "RcvbufErrors": - procSnmp.UdpLite.RcvbufErrors = value + procSnmp.UdpLite.RcvbufErrors = &value case "SndbufErrors": - procSnmp.UdpLite.SndbufErrors = value + procSnmp.UdpLite.SndbufErrors = &value case "InCsumErrors": - procSnmp.UdpLite.InCsumErrors = value + procSnmp.UdpLite.InCsumErrors = &value case "IgnoredMulti": - procSnmp.UdpLite.IgnoredMulti = value + procSnmp.UdpLite.IgnoredMulti = &value } } } diff --git a/vendor/github.com/prometheus/procfs/proc_snmp6.go b/vendor/github.com/prometheus/procfs/proc_snmp6.go index f611992d52..3059cc6a13 100644 --- a/vendor/github.com/prometheus/procfs/proc_snmp6.go +++ b/vendor/github.com/prometheus/procfs/proc_snmp6.go @@ -36,106 +36,106 @@ type ProcSnmp6 struct { } type Ip6 struct { // nolint:revive - InReceives float64 - InHdrErrors float64 - InTooBigErrors float64 - InNoRoutes float64 - InAddrErrors float64 - InUnknownProtos float64 - InTruncatedPkts float64 - InDiscards float64 - InDelivers float64 - OutForwDatagrams float64 - OutRequests float64 - OutDiscards float64 - OutNoRoutes float64 - ReasmTimeout float64 - ReasmReqds float64 - ReasmOKs float64 - ReasmFails float64 - FragOKs float64 - FragFails float64 - FragCreates float64 - InMcastPkts float64 - OutMcastPkts float64 - InOctets float64 - OutOctets float64 - InMcastOctets float64 - OutMcastOctets float64 - InBcastOctets float64 - OutBcastOctets float64 - InNoECTPkts float64 - InECT1Pkts float64 - InECT0Pkts float64 - InCEPkts float64 + InReceives *float64 + InHdrErrors *float64 + InTooBigErrors *float64 + InNoRoutes *float64 + InAddrErrors *float64 + InUnknownProtos *float64 + InTruncatedPkts *float64 + InDiscards *float64 + InDelivers *float64 + OutForwDatagrams *float64 + OutRequests *float64 + OutDiscards *float64 + OutNoRoutes *float64 + ReasmTimeout *float64 + ReasmReqds *float64 + ReasmOKs *float64 + ReasmFails *float64 + FragOKs *float64 + FragFails *float64 + FragCreates *float64 + InMcastPkts *float64 + OutMcastPkts *float64 + InOctets *float64 + OutOctets *float64 + InMcastOctets *float64 + OutMcastOctets *float64 + InBcastOctets *float64 + OutBcastOctets *float64 + InNoECTPkts *float64 + InECT1Pkts *float64 + InECT0Pkts *float64 + InCEPkts *float64 } type Icmp6 struct { - InMsgs float64 - InErrors float64 - OutMsgs float64 - OutErrors float64 - InCsumErrors float64 - InDestUnreachs float64 - InPktTooBigs float64 - InTimeExcds float64 - InParmProblems float64 - InEchos float64 - InEchoReplies float64 - InGroupMembQueries float64 - InGroupMembResponses float64 - InGroupMembReductions float64 - InRouterSolicits float64 - InRouterAdvertisements float64 - InNeighborSolicits float64 - InNeighborAdvertisements float64 - InRedirects float64 - InMLDv2Reports float64 - OutDestUnreachs float64 - OutPktTooBigs float64 - OutTimeExcds float64 - OutParmProblems float64 - OutEchos float64 - OutEchoReplies float64 - OutGroupMembQueries float64 - OutGroupMembResponses float64 - OutGroupMembReductions float64 - OutRouterSolicits float64 - OutRouterAdvertisements float64 - OutNeighborSolicits float64 - OutNeighborAdvertisements float64 - OutRedirects float64 - OutMLDv2Reports float64 - InType1 float64 - InType134 float64 - InType135 float64 - InType136 float64 - InType143 float64 - OutType133 float64 - OutType135 float64 - OutType136 float64 - OutType143 float64 + InMsgs *float64 + InErrors *float64 + OutMsgs *float64 + OutErrors *float64 + InCsumErrors *float64 + InDestUnreachs *float64 + InPktTooBigs *float64 + InTimeExcds *float64 + InParmProblems *float64 + InEchos *float64 + InEchoReplies *float64 + InGroupMembQueries *float64 + InGroupMembResponses *float64 + InGroupMembReductions *float64 + InRouterSolicits *float64 + InRouterAdvertisements *float64 + InNeighborSolicits *float64 + InNeighborAdvertisements *float64 + InRedirects *float64 + InMLDv2Reports *float64 + OutDestUnreachs *float64 + OutPktTooBigs *float64 + OutTimeExcds *float64 + OutParmProblems *float64 + OutEchos *float64 + OutEchoReplies *float64 + OutGroupMembQueries *float64 + OutGroupMembResponses *float64 + OutGroupMembReductions *float64 + OutRouterSolicits *float64 + OutRouterAdvertisements *float64 + OutNeighborSolicits *float64 + OutNeighborAdvertisements *float64 + OutRedirects *float64 + OutMLDv2Reports *float64 + InType1 *float64 + InType134 *float64 + InType135 *float64 + InType136 *float64 + InType143 *float64 + OutType133 *float64 + OutType135 *float64 + OutType136 *float64 + OutType143 *float64 } type Udp6 struct { // nolint:revive - InDatagrams float64 - NoPorts float64 - InErrors float64 - OutDatagrams float64 - RcvbufErrors float64 - SndbufErrors float64 - InCsumErrors float64 - IgnoredMulti float64 + InDatagrams *float64 + NoPorts *float64 + InErrors *float64 + OutDatagrams *float64 + RcvbufErrors *float64 + SndbufErrors *float64 + InCsumErrors *float64 + IgnoredMulti *float64 } type UdpLite6 struct { // nolint:revive - InDatagrams float64 - NoPorts float64 - InErrors float64 - OutDatagrams float64 - RcvbufErrors float64 - SndbufErrors float64 - InCsumErrors float64 + InDatagrams *float64 + NoPorts *float64 + InErrors *float64 + OutDatagrams *float64 + RcvbufErrors *float64 + SndbufErrors *float64 + InCsumErrors *float64 } func (p Proc) Snmp6() (ProcSnmp6, error) { @@ -182,197 +182,197 @@ func parseSNMP6Stats(r io.Reader) (ProcSnmp6, error) { case "Ip6": switch key { case "InReceives": - procSnmp6.Ip6.InReceives = value + procSnmp6.Ip6.InReceives = &value case "InHdrErrors": - procSnmp6.Ip6.InHdrErrors = value + procSnmp6.Ip6.InHdrErrors = &value case "InTooBigErrors": - procSnmp6.Ip6.InTooBigErrors = value + procSnmp6.Ip6.InTooBigErrors = &value case "InNoRoutes": - procSnmp6.Ip6.InNoRoutes = value + procSnmp6.Ip6.InNoRoutes = &value case "InAddrErrors": - procSnmp6.Ip6.InAddrErrors = value + procSnmp6.Ip6.InAddrErrors = &value case "InUnknownProtos": - procSnmp6.Ip6.InUnknownProtos = value + procSnmp6.Ip6.InUnknownProtos = &value case "InTruncatedPkts": - procSnmp6.Ip6.InTruncatedPkts = value + procSnmp6.Ip6.InTruncatedPkts = &value case "InDiscards": - procSnmp6.Ip6.InDiscards = value + procSnmp6.Ip6.InDiscards = &value case "InDelivers": - procSnmp6.Ip6.InDelivers = value + procSnmp6.Ip6.InDelivers = &value case "OutForwDatagrams": - procSnmp6.Ip6.OutForwDatagrams = value + procSnmp6.Ip6.OutForwDatagrams = &value case "OutRequests": - procSnmp6.Ip6.OutRequests = value + procSnmp6.Ip6.OutRequests = &value case "OutDiscards": - procSnmp6.Ip6.OutDiscards = value + procSnmp6.Ip6.OutDiscards = &value case "OutNoRoutes": - procSnmp6.Ip6.OutNoRoutes = value + procSnmp6.Ip6.OutNoRoutes = &value case "ReasmTimeout": - procSnmp6.Ip6.ReasmTimeout = value + procSnmp6.Ip6.ReasmTimeout = &value case "ReasmReqds": - procSnmp6.Ip6.ReasmReqds = value + procSnmp6.Ip6.ReasmReqds = &value case "ReasmOKs": - procSnmp6.Ip6.ReasmOKs = value + procSnmp6.Ip6.ReasmOKs = &value case "ReasmFails": - procSnmp6.Ip6.ReasmFails = value + procSnmp6.Ip6.ReasmFails = &value case "FragOKs": - procSnmp6.Ip6.FragOKs = value + procSnmp6.Ip6.FragOKs = &value case "FragFails": - procSnmp6.Ip6.FragFails = value + procSnmp6.Ip6.FragFails = &value case "FragCreates": - procSnmp6.Ip6.FragCreates = value + procSnmp6.Ip6.FragCreates = &value case "InMcastPkts": - procSnmp6.Ip6.InMcastPkts = value + procSnmp6.Ip6.InMcastPkts = &value case "OutMcastPkts": - procSnmp6.Ip6.OutMcastPkts = value + procSnmp6.Ip6.OutMcastPkts = &value case "InOctets": - procSnmp6.Ip6.InOctets = value + procSnmp6.Ip6.InOctets = &value case "OutOctets": - procSnmp6.Ip6.OutOctets = value + procSnmp6.Ip6.OutOctets = &value case "InMcastOctets": - procSnmp6.Ip6.InMcastOctets = value + procSnmp6.Ip6.InMcastOctets = &value case "OutMcastOctets": - procSnmp6.Ip6.OutMcastOctets = value + procSnmp6.Ip6.OutMcastOctets = &value case "InBcastOctets": - procSnmp6.Ip6.InBcastOctets = value + procSnmp6.Ip6.InBcastOctets = &value case "OutBcastOctets": - procSnmp6.Ip6.OutBcastOctets = value + procSnmp6.Ip6.OutBcastOctets = &value case "InNoECTPkts": - procSnmp6.Ip6.InNoECTPkts = value + procSnmp6.Ip6.InNoECTPkts = &value case "InECT1Pkts": - procSnmp6.Ip6.InECT1Pkts = value + procSnmp6.Ip6.InECT1Pkts = &value case "InECT0Pkts": - procSnmp6.Ip6.InECT0Pkts = value + procSnmp6.Ip6.InECT0Pkts = &value case "InCEPkts": - procSnmp6.Ip6.InCEPkts = value + procSnmp6.Ip6.InCEPkts = &value } case "Icmp6": switch key { case "InMsgs": - procSnmp6.Icmp6.InMsgs = value + procSnmp6.Icmp6.InMsgs = &value case "InErrors": - procSnmp6.Icmp6.InErrors = value + procSnmp6.Icmp6.InErrors = &value case "OutMsgs": - procSnmp6.Icmp6.OutMsgs = value + procSnmp6.Icmp6.OutMsgs = &value case "OutErrors": - procSnmp6.Icmp6.OutErrors = value + procSnmp6.Icmp6.OutErrors = &value case "InCsumErrors": - procSnmp6.Icmp6.InCsumErrors = value + procSnmp6.Icmp6.InCsumErrors = &value case "InDestUnreachs": - procSnmp6.Icmp6.InDestUnreachs = value + procSnmp6.Icmp6.InDestUnreachs = &value case "InPktTooBigs": - procSnmp6.Icmp6.InPktTooBigs = value + procSnmp6.Icmp6.InPktTooBigs = &value case "InTimeExcds": - procSnmp6.Icmp6.InTimeExcds = value + procSnmp6.Icmp6.InTimeExcds = &value case "InParmProblems": - procSnmp6.Icmp6.InParmProblems = value + procSnmp6.Icmp6.InParmProblems = &value case "InEchos": - procSnmp6.Icmp6.InEchos = value + procSnmp6.Icmp6.InEchos = &value case "InEchoReplies": - procSnmp6.Icmp6.InEchoReplies = value + procSnmp6.Icmp6.InEchoReplies = &value case "InGroupMembQueries": - procSnmp6.Icmp6.InGroupMembQueries = value + procSnmp6.Icmp6.InGroupMembQueries = &value case "InGroupMembResponses": - procSnmp6.Icmp6.InGroupMembResponses = value + procSnmp6.Icmp6.InGroupMembResponses = &value case "InGroupMembReductions": - procSnmp6.Icmp6.InGroupMembReductions = value + procSnmp6.Icmp6.InGroupMembReductions = &value case "InRouterSolicits": - procSnmp6.Icmp6.InRouterSolicits = value + procSnmp6.Icmp6.InRouterSolicits = &value case "InRouterAdvertisements": - procSnmp6.Icmp6.InRouterAdvertisements = value + procSnmp6.Icmp6.InRouterAdvertisements = &value case "InNeighborSolicits": - procSnmp6.Icmp6.InNeighborSolicits = value + procSnmp6.Icmp6.InNeighborSolicits = &value case "InNeighborAdvertisements": - procSnmp6.Icmp6.InNeighborAdvertisements = value + procSnmp6.Icmp6.InNeighborAdvertisements = &value case "InRedirects": - procSnmp6.Icmp6.InRedirects = value + procSnmp6.Icmp6.InRedirects = &value case "InMLDv2Reports": - procSnmp6.Icmp6.InMLDv2Reports = value + procSnmp6.Icmp6.InMLDv2Reports = &value case "OutDestUnreachs": - procSnmp6.Icmp6.OutDestUnreachs = value + procSnmp6.Icmp6.OutDestUnreachs = &value case "OutPktTooBigs": - procSnmp6.Icmp6.OutPktTooBigs = value + procSnmp6.Icmp6.OutPktTooBigs = &value case "OutTimeExcds": - procSnmp6.Icmp6.OutTimeExcds = value + procSnmp6.Icmp6.OutTimeExcds = &value case "OutParmProblems": - procSnmp6.Icmp6.OutParmProblems = value + procSnmp6.Icmp6.OutParmProblems = &value case "OutEchos": - procSnmp6.Icmp6.OutEchos = value + procSnmp6.Icmp6.OutEchos = &value case "OutEchoReplies": - procSnmp6.Icmp6.OutEchoReplies = value + procSnmp6.Icmp6.OutEchoReplies = &value case "OutGroupMembQueries": - procSnmp6.Icmp6.OutGroupMembQueries = value + procSnmp6.Icmp6.OutGroupMembQueries = &value case "OutGroupMembResponses": - procSnmp6.Icmp6.OutGroupMembResponses = value + procSnmp6.Icmp6.OutGroupMembResponses = &value case "OutGroupMembReductions": - procSnmp6.Icmp6.OutGroupMembReductions = value + procSnmp6.Icmp6.OutGroupMembReductions = &value case "OutRouterSolicits": - procSnmp6.Icmp6.OutRouterSolicits = value + procSnmp6.Icmp6.OutRouterSolicits = &value case "OutRouterAdvertisements": - procSnmp6.Icmp6.OutRouterAdvertisements = value + procSnmp6.Icmp6.OutRouterAdvertisements = &value case "OutNeighborSolicits": - procSnmp6.Icmp6.OutNeighborSolicits = value + procSnmp6.Icmp6.OutNeighborSolicits = &value case "OutNeighborAdvertisements": - procSnmp6.Icmp6.OutNeighborAdvertisements = value + procSnmp6.Icmp6.OutNeighborAdvertisements = &value case "OutRedirects": - procSnmp6.Icmp6.OutRedirects = value + procSnmp6.Icmp6.OutRedirects = &value case "OutMLDv2Reports": - procSnmp6.Icmp6.OutMLDv2Reports = value + procSnmp6.Icmp6.OutMLDv2Reports = &value case "InType1": - procSnmp6.Icmp6.InType1 = value + procSnmp6.Icmp6.InType1 = &value case "InType134": - procSnmp6.Icmp6.InType134 = value + procSnmp6.Icmp6.InType134 = &value case "InType135": - procSnmp6.Icmp6.InType135 = value + procSnmp6.Icmp6.InType135 = &value case "InType136": - procSnmp6.Icmp6.InType136 = value + procSnmp6.Icmp6.InType136 = &value case "InType143": - procSnmp6.Icmp6.InType143 = value + procSnmp6.Icmp6.InType143 = &value case "OutType133": - procSnmp6.Icmp6.OutType133 = value + procSnmp6.Icmp6.OutType133 = &value case "OutType135": - procSnmp6.Icmp6.OutType135 = value + procSnmp6.Icmp6.OutType135 = &value case "OutType136": - procSnmp6.Icmp6.OutType136 = value + procSnmp6.Icmp6.OutType136 = &value case "OutType143": - procSnmp6.Icmp6.OutType143 = value + procSnmp6.Icmp6.OutType143 = &value } case "Udp6": switch key { case "InDatagrams": - procSnmp6.Udp6.InDatagrams = value + procSnmp6.Udp6.InDatagrams = &value case "NoPorts": - procSnmp6.Udp6.NoPorts = value + procSnmp6.Udp6.NoPorts = &value case "InErrors": - procSnmp6.Udp6.InErrors = value + procSnmp6.Udp6.InErrors = &value case "OutDatagrams": - procSnmp6.Udp6.OutDatagrams = value + procSnmp6.Udp6.OutDatagrams = &value case "RcvbufErrors": - procSnmp6.Udp6.RcvbufErrors = value + procSnmp6.Udp6.RcvbufErrors = &value case "SndbufErrors": - procSnmp6.Udp6.SndbufErrors = value + procSnmp6.Udp6.SndbufErrors = &value case "InCsumErrors": - procSnmp6.Udp6.InCsumErrors = value + procSnmp6.Udp6.InCsumErrors = &value case "IgnoredMulti": - procSnmp6.Udp6.IgnoredMulti = value + procSnmp6.Udp6.IgnoredMulti = &value } case "UdpLite6": switch key { case "InDatagrams": - procSnmp6.UdpLite6.InDatagrams = value + procSnmp6.UdpLite6.InDatagrams = &value case "NoPorts": - procSnmp6.UdpLite6.NoPorts = value + procSnmp6.UdpLite6.NoPorts = &value case "InErrors": - procSnmp6.UdpLite6.InErrors = value + procSnmp6.UdpLite6.InErrors = &value case "OutDatagrams": - procSnmp6.UdpLite6.OutDatagrams = value + procSnmp6.UdpLite6.OutDatagrams = &value case "RcvbufErrors": - procSnmp6.UdpLite6.RcvbufErrors = value + procSnmp6.UdpLite6.RcvbufErrors = &value case "SndbufErrors": - procSnmp6.UdpLite6.SndbufErrors = value + procSnmp6.UdpLite6.SndbufErrors = &value case "InCsumErrors": - procSnmp6.UdpLite6.InCsumErrors = value + procSnmp6.UdpLite6.InCsumErrors = &value } } } diff --git a/vendor/github.com/prometheus/procfs/proc_stat.go b/vendor/github.com/prometheus/procfs/proc_stat.go index 06c556ef96..923e55005b 100644 --- a/vendor/github.com/prometheus/procfs/proc_stat.go +++ b/vendor/github.com/prometheus/procfs/proc_stat.go @@ -18,7 +18,6 @@ import ( "fmt" "os" - "github.com/prometheus/procfs/internal/fs" "github.com/prometheus/procfs/internal/util" ) @@ -102,6 +101,8 @@ type ProcStat struct { RSS int // Soft limit in bytes on the rss of the process. RSSLimit uint64 + // CPU number last executed on. + Processor uint // Real-time scheduling priority, a number in the range 1 to 99 for processes // scheduled under a real-time policy, or 0, for non-real-time processes. RTPriority uint @@ -110,7 +111,7 @@ type ProcStat struct { // Aggregated block I/O delays, measured in clock ticks (centiseconds). DelayAcctBlkIOTicks uint64 - proc fs.FS + proc FS } // NewStat returns the current status information of the process. @@ -137,7 +138,7 @@ func (p Proc) Stat() (ProcStat, error) { ) if l < 0 || r < 0 { - return ProcStat{}, fmt.Errorf("unexpected format, couldn't extract comm %q", data) + return ProcStat{}, fmt.Errorf("%w: unexpected format, couldn't extract comm %q", ErrFileParse, data) } s.Comm = string(data[l+1 : r]) @@ -184,7 +185,7 @@ func (p Proc) Stat() (ProcStat, error) { &ignoreUint64, &ignoreUint64, &ignoreInt64, - &ignoreInt64, + &s.Processor, &s.RTPriority, &s.Policy, &s.DelayAcctBlkIOTicks, @@ -208,8 +209,7 @@ func (s ProcStat) ResidentMemory() int { // StartTime returns the unix timestamp of the process in seconds. func (s ProcStat) StartTime() (float64, error) { - fs := FS{proc: s.proc} - stat, err := fs.Stat() + stat, err := s.proc.Stat() if err != nil { return 0, err } diff --git a/vendor/github.com/prometheus/procfs/proc_status.go b/vendor/github.com/prometheus/procfs/proc_status.go index 594022ded4..c055d075db 100644 --- a/vendor/github.com/prometheus/procfs/proc_status.go +++ b/vendor/github.com/prometheus/procfs/proc_status.go @@ -15,6 +15,7 @@ package procfs import ( "bytes" + "sort" "strconv" "strings" @@ -76,6 +77,9 @@ type ProcStatus struct { UIDs [4]string // GIDs of the process (Real, effective, saved set, and filesystem GIDs) GIDs [4]string + + // CpusAllowedList: List of cpu cores processes are allowed to run on. + CpusAllowedList []uint64 } // NewStatus returns the current status information of the process. @@ -96,10 +100,10 @@ func (p Proc) NewStatus() (ProcStatus, error) { kv := strings.SplitN(line, ":", 2) // removes spaces - k := string(strings.TrimSpace(kv[0])) - v := string(strings.TrimSpace(kv[1])) + k := strings.TrimSpace(kv[0]) + v := strings.TrimSpace(kv[1]) // removes "kB" - v = string(bytes.Trim([]byte(v), " kB")) + v = strings.TrimSuffix(v, " kB") // value to int when possible // we can skip error check here, 'cause vKBytes is not used when value is a string @@ -161,10 +165,38 @@ func (s *ProcStatus) fillStatus(k string, vString string, vUint uint64, vUintByt s.VoluntaryCtxtSwitches = vUint case "nonvoluntary_ctxt_switches": s.NonVoluntaryCtxtSwitches = vUint + case "Cpus_allowed_list": + s.CpusAllowedList = calcCpusAllowedList(vString) } + } // TotalCtxtSwitches returns the total context switch. func (s ProcStatus) TotalCtxtSwitches() uint64 { return s.VoluntaryCtxtSwitches + s.NonVoluntaryCtxtSwitches } + +func calcCpusAllowedList(cpuString string) []uint64 { + s := strings.Split(cpuString, ",") + + var g []uint64 + + for _, cpu := range s { + // parse cpu ranges, example: 1-3=[1,2,3] + if l := strings.Split(strings.TrimSpace(cpu), "-"); len(l) > 1 { + startCPU, _ := strconv.ParseUint(l[0], 10, 64) + endCPU, _ := strconv.ParseUint(l[1], 10, 64) + + for i := startCPU; i <= endCPU; i++ { + g = append(g, i) + } + } else if len(l) == 1 { + cpu, _ := strconv.ParseUint(l[0], 10, 64) + g = append(g, cpu) + } + + } + + sort.Slice(g, func(i, j int) bool { return g[i] < g[j] }) + return g +} diff --git a/vendor/github.com/prometheus/procfs/proc_sys.go b/vendor/github.com/prometheus/procfs/proc_sys.go index d46533ebf4..12c5bf05b7 100644 --- a/vendor/github.com/prometheus/procfs/proc_sys.go +++ b/vendor/github.com/prometheus/procfs/proc_sys.go @@ -44,7 +44,7 @@ func (fs FS) SysctlInts(sysctl string) ([]int, error) { vp := util.NewValueParser(f) values[i] = vp.Int() if err := vp.Err(); err != nil { - return nil, fmt.Errorf("field %d in sysctl %s is not a valid int: %w", i, sysctl, err) + return nil, fmt.Errorf("%s: field %d in sysctl %s is not a valid int: %w", ErrFileParse, i, sysctl, err) } } return values, nil diff --git a/vendor/github.com/prometheus/procfs/slab.go b/vendor/github.com/prometheus/procfs/slab.go index bc9aaf5c28..8611c90177 100644 --- a/vendor/github.com/prometheus/procfs/slab.go +++ b/vendor/github.com/prometheus/procfs/slab.go @@ -68,7 +68,7 @@ func parseV21SlabEntry(line string) (*Slab, error) { l := slabSpace.ReplaceAllString(line, " ") s := strings.Split(l, " ") if len(s) != 16 { - return nil, fmt.Errorf("unable to parse: %q", line) + return nil, fmt.Errorf("%w: unable to parse: %q", ErrFileParse, line) } var err error i := &Slab{Name: s[0]} diff --git a/vendor/github.com/prometheus/procfs/softirqs.go b/vendor/github.com/prometheus/procfs/softirqs.go index 559129cbca..b8fad677dc 100644 --- a/vendor/github.com/prometheus/procfs/softirqs.go +++ b/vendor/github.com/prometheus/procfs/softirqs.go @@ -57,7 +57,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { ) if !scanner.Scan() { - return Softirqs{}, fmt.Errorf("softirqs empty") + return Softirqs{}, fmt.Errorf("%w: softirqs empty", ErrFileRead) } for scanner.Scan() { @@ -74,7 +74,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { softirqs.Hi = make([]uint64, len(perCPU)) for i, count := range perCPU { if softirqs.Hi[i], err = strconv.ParseUint(count, 10, 64); err != nil { - return Softirqs{}, fmt.Errorf("couldn't parse %q (HI%d): %w", count, i, err) + return Softirqs{}, fmt.Errorf("%s: couldn't parse %q (HI%d): %w", ErrFileParse, count, i, err) } } case parts[0] == "TIMER:": @@ -82,7 +82,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { softirqs.Timer = make([]uint64, len(perCPU)) for i, count := range perCPU { if softirqs.Timer[i], err = strconv.ParseUint(count, 10, 64); err != nil { - return Softirqs{}, fmt.Errorf("couldn't parse %q (TIMER%d): %w", count, i, err) + return Softirqs{}, fmt.Errorf("%s: couldn't parse %q (TIMER%d): %w", ErrFileParse, count, i, err) } } case parts[0] == "NET_TX:": @@ -90,7 +90,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { softirqs.NetTx = make([]uint64, len(perCPU)) for i, count := range perCPU { if softirqs.NetTx[i], err = strconv.ParseUint(count, 10, 64); err != nil { - return Softirqs{}, fmt.Errorf("couldn't parse %q (NET_TX%d): %w", count, i, err) + return Softirqs{}, fmt.Errorf("%s: couldn't parse %q (NET_TX%d): %w", ErrFileParse, count, i, err) } } case parts[0] == "NET_RX:": @@ -98,7 +98,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { softirqs.NetRx = make([]uint64, len(perCPU)) for i, count := range perCPU { if softirqs.NetRx[i], err = strconv.ParseUint(count, 10, 64); err != nil { - return Softirqs{}, fmt.Errorf("couldn't parse %q (NET_RX%d): %w", count, i, err) + return Softirqs{}, fmt.Errorf("%s: couldn't parse %q (NET_RX%d): %w", ErrFileParse, count, i, err) } } case parts[0] == "BLOCK:": @@ -106,7 +106,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { softirqs.Block = make([]uint64, len(perCPU)) for i, count := range perCPU { if softirqs.Block[i], err = strconv.ParseUint(count, 10, 64); err != nil { - return Softirqs{}, fmt.Errorf("couldn't parse %q (BLOCK%d): %w", count, i, err) + return Softirqs{}, fmt.Errorf("%s: couldn't parse %q (BLOCK%d): %w", ErrFileParse, count, i, err) } } case parts[0] == "IRQ_POLL:": @@ -114,7 +114,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { softirqs.IRQPoll = make([]uint64, len(perCPU)) for i, count := range perCPU { if softirqs.IRQPoll[i], err = strconv.ParseUint(count, 10, 64); err != nil { - return Softirqs{}, fmt.Errorf("couldn't parse %q (IRQ_POLL%d): %w", count, i, err) + return Softirqs{}, fmt.Errorf("%s: couldn't parse %q (IRQ_POLL%d): %w", ErrFileParse, count, i, err) } } case parts[0] == "TASKLET:": @@ -122,7 +122,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { softirqs.Tasklet = make([]uint64, len(perCPU)) for i, count := range perCPU { if softirqs.Tasklet[i], err = strconv.ParseUint(count, 10, 64); err != nil { - return Softirqs{}, fmt.Errorf("couldn't parse %q (TASKLET%d): %w", count, i, err) + return Softirqs{}, fmt.Errorf("%s: couldn't parse %q (TASKLET%d): %w", ErrFileParse, count, i, err) } } case parts[0] == "SCHED:": @@ -130,7 +130,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { softirqs.Sched = make([]uint64, len(perCPU)) for i, count := range perCPU { if softirqs.Sched[i], err = strconv.ParseUint(count, 10, 64); err != nil { - return Softirqs{}, fmt.Errorf("couldn't parse %q (SCHED%d): %w", count, i, err) + return Softirqs{}, fmt.Errorf("%s: couldn't parse %q (SCHED%d): %w", ErrFileParse, count, i, err) } } case parts[0] == "HRTIMER:": @@ -138,7 +138,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { softirqs.HRTimer = make([]uint64, len(perCPU)) for i, count := range perCPU { if softirqs.HRTimer[i], err = strconv.ParseUint(count, 10, 64); err != nil { - return Softirqs{}, fmt.Errorf("couldn't parse %q (HRTIMER%d): %w", count, i, err) + return Softirqs{}, fmt.Errorf("%s: couldn't parse %q (HRTIMER%d): %w", ErrFileParse, count, i, err) } } case parts[0] == "RCU:": @@ -146,14 +146,14 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { softirqs.RCU = make([]uint64, len(perCPU)) for i, count := range perCPU { if softirqs.RCU[i], err = strconv.ParseUint(count, 10, 64); err != nil { - return Softirqs{}, fmt.Errorf("couldn't parse %q (RCU%d): %w", count, i, err) + return Softirqs{}, fmt.Errorf("%s: couldn't parse %q (RCU%d): %w", ErrFileParse, count, i, err) } } } } if err := scanner.Err(); err != nil { - return Softirqs{}, fmt.Errorf("couldn't parse softirqs: %w", err) + return Softirqs{}, fmt.Errorf("%s: couldn't parse softirqs: %w", ErrFileParse, err) } return softirqs, scanner.Err() diff --git a/vendor/github.com/prometheus/procfs/stat.go b/vendor/github.com/prometheus/procfs/stat.go index 33f97caa08..34fc3ee21b 100644 --- a/vendor/github.com/prometheus/procfs/stat.go +++ b/vendor/github.com/prometheus/procfs/stat.go @@ -62,7 +62,7 @@ type Stat struct { // Summed up cpu statistics. CPUTotal CPUStat // Per-CPU statistics. - CPU []CPUStat + CPU map[int64]CPUStat // Number of times interrupts were handled, which contains numbered and unnumbered IRQs. IRQTotal uint64 // Number of times a numbered IRQ was triggered. @@ -93,10 +93,10 @@ func parseCPUStat(line string) (CPUStat, int64, error) { &cpuStat.Guest, &cpuStat.GuestNice) if err != nil && err != io.EOF { - return CPUStat{}, -1, fmt.Errorf("couldn't parse %q (cpu): %w", line, err) + return CPUStat{}, -1, fmt.Errorf("%s: couldn't parse %q (cpu): %w", ErrFileParse, line, err) } if count == 0 { - return CPUStat{}, -1, fmt.Errorf("couldn't parse %q (cpu): 0 elements parsed", line) + return CPUStat{}, -1, fmt.Errorf("%w: couldn't parse %q (cpu): 0 elements parsed", ErrFileParse, line) } cpuStat.User /= userHZ @@ -116,7 +116,7 @@ func parseCPUStat(line string) (CPUStat, int64, error) { cpuID, err := strconv.ParseInt(cpu[3:], 10, 64) if err != nil { - return CPUStat{}, -1, fmt.Errorf("couldn't parse %q (cpu/cpuid): %w", line, err) + return CPUStat{}, -1, fmt.Errorf("%s: couldn't parse %q (cpu/cpuid): %w", ErrFileParse, line, err) } return cpuStat, cpuID, nil @@ -136,7 +136,7 @@ func parseSoftIRQStat(line string) (SoftIRQStat, uint64, error) { &softIRQStat.Hrtimer, &softIRQStat.Rcu) if err != nil { - return SoftIRQStat{}, 0, fmt.Errorf("couldn't parse %q (softirq): %w", line, err) + return SoftIRQStat{}, 0, fmt.Errorf("%s: couldn't parse %q (softirq): %w", ErrFileParse, line, err) } return softIRQStat, total, nil @@ -170,10 +170,27 @@ func (fs FS) Stat() (Stat, error) { if err != nil { return Stat{}, err } + procStat, err := parseStat(bytes.NewReader(data), fileName) + if err != nil { + return Stat{}, err + } + return procStat, nil +} - stat := Stat{} +// parseStat parses the metrics from /proc/[pid]/stat. +func parseStat(r io.Reader, fileName string) (Stat, error) { + var ( + scanner = bufio.NewScanner(r) + stat = Stat{ + CPU: make(map[int64]CPUStat), + } + err error + ) + + // Increase default scanner buffer to handle very long `intr` lines. + buf := make([]byte, 0, 8*1024) + scanner.Buffer(buf, 1024*1024) - scanner := bufio.NewScanner(bytes.NewReader(data)) for scanner.Scan() { line := scanner.Text() parts := strings.Fields(scanner.Text()) @@ -184,34 +201,34 @@ func (fs FS) Stat() (Stat, error) { switch { case parts[0] == "btime": if stat.BootTime, err = strconv.ParseUint(parts[1], 10, 64); err != nil { - return Stat{}, fmt.Errorf("couldn't parse %q (btime): %w", parts[1], err) + return Stat{}, fmt.Errorf("%s: couldn't parse %q (btime): %w", ErrFileParse, parts[1], err) } case parts[0] == "intr": if stat.IRQTotal, err = strconv.ParseUint(parts[1], 10, 64); err != nil { - return Stat{}, fmt.Errorf("couldn't parse %q (intr): %w", parts[1], err) + return Stat{}, fmt.Errorf("%s: couldn't parse %q (intr): %w", ErrFileParse, parts[1], err) } numberedIRQs := parts[2:] stat.IRQ = make([]uint64, len(numberedIRQs)) for i, count := range numberedIRQs { if stat.IRQ[i], err = strconv.ParseUint(count, 10, 64); err != nil { - return Stat{}, fmt.Errorf("couldn't parse %q (intr%d): %w", count, i, err) + return Stat{}, fmt.Errorf("%s: couldn't parse %q (intr%d): %w", ErrFileParse, count, i, err) } } case parts[0] == "ctxt": if stat.ContextSwitches, err = strconv.ParseUint(parts[1], 10, 64); err != nil { - return Stat{}, fmt.Errorf("couldn't parse %q (ctxt): %w", parts[1], err) + return Stat{}, fmt.Errorf("%s: couldn't parse %q (ctxt): %w", ErrFileParse, parts[1], err) } case parts[0] == "processes": if stat.ProcessCreated, err = strconv.ParseUint(parts[1], 10, 64); err != nil { - return Stat{}, fmt.Errorf("couldn't parse %q (processes): %w", parts[1], err) + return Stat{}, fmt.Errorf("%s: couldn't parse %q (processes): %w", ErrFileParse, parts[1], err) } case parts[0] == "procs_running": if stat.ProcessesRunning, err = strconv.ParseUint(parts[1], 10, 64); err != nil { - return Stat{}, fmt.Errorf("couldn't parse %q (procs_running): %w", parts[1], err) + return Stat{}, fmt.Errorf("%s: couldn't parse %q (procs_running): %w", ErrFileParse, parts[1], err) } case parts[0] == "procs_blocked": if stat.ProcessesBlocked, err = strconv.ParseUint(parts[1], 10, 64); err != nil { - return Stat{}, fmt.Errorf("couldn't parse %q (procs_blocked): %w", parts[1], err) + return Stat{}, fmt.Errorf("%s: couldn't parse %q (procs_blocked): %w", ErrFileParse, parts[1], err) } case parts[0] == "softirq": softIRQStats, total, err := parseSoftIRQStat(line) @@ -228,16 +245,13 @@ func (fs FS) Stat() (Stat, error) { if cpuID == -1 { stat.CPUTotal = cpuStat } else { - for int64(len(stat.CPU)) <= cpuID { - stat.CPU = append(stat.CPU, CPUStat{}) - } stat.CPU[cpuID] = cpuStat } } } if err := scanner.Err(); err != nil { - return Stat{}, fmt.Errorf("couldn't parse %q: %w", fileName, err) + return Stat{}, fmt.Errorf("%s: couldn't parse %q: %w", ErrFileParse, fileName, err) } return stat, nil diff --git a/vendor/github.com/prometheus/procfs/swaps.go b/vendor/github.com/prometheus/procfs/swaps.go index 15edc2212b..fa00f555db 100644 --- a/vendor/github.com/prometheus/procfs/swaps.go +++ b/vendor/github.com/prometheus/procfs/swaps.go @@ -64,7 +64,7 @@ func parseSwapString(swapString string) (*Swap, error) { swapFields := strings.Fields(swapString) swapLength := len(swapFields) if swapLength < 5 { - return nil, fmt.Errorf("too few fields in swap string: %s", swapString) + return nil, fmt.Errorf("%w: too few fields in swap string: %s", ErrFileParse, swapString) } swap := &Swap{ @@ -74,15 +74,15 @@ func parseSwapString(swapString string) (*Swap, error) { swap.Size, err = strconv.Atoi(swapFields[2]) if err != nil { - return nil, fmt.Errorf("invalid swap size: %s", swapFields[2]) + return nil, fmt.Errorf("%s: invalid swap size: %s: %w", ErrFileParse, swapFields[2], err) } swap.Used, err = strconv.Atoi(swapFields[3]) if err != nil { - return nil, fmt.Errorf("invalid swap used: %s", swapFields[3]) + return nil, fmt.Errorf("%s: invalid swap used: %s: %w", ErrFileParse, swapFields[3], err) } swap.Priority, err = strconv.Atoi(swapFields[4]) if err != nil { - return nil, fmt.Errorf("invalid swap priority: %s", swapFields[4]) + return nil, fmt.Errorf("%s: invalid swap priority: %s: %w", ErrFileParse, swapFields[4], err) } return swap, nil diff --git a/vendor/github.com/prometheus/procfs/thread.go b/vendor/github.com/prometheus/procfs/thread.go new file mode 100644 index 0000000000..df2215ece0 --- /dev/null +++ b/vendor/github.com/prometheus/procfs/thread.go @@ -0,0 +1,80 @@ +// Copyright 2022 The Prometheus Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package procfs + +import ( + "fmt" + "os" + "strconv" + + fsi "github.com/prometheus/procfs/internal/fs" +) + +// Provide access to /proc/PID/task/TID files, for thread specific values. Since +// such files have the same structure as /proc/PID/ ones, the data structures +// and the parsers for the latter may be reused. + +// AllThreads returns a list of all currently available threads under /proc/PID. +func AllThreads(pid int) (Procs, error) { + fs, err := NewFS(DefaultMountPoint) + if err != nil { + return Procs{}, err + } + return fs.AllThreads(pid) +} + +// AllThreads returns a list of all currently available threads for PID. +func (fs FS) AllThreads(pid int) (Procs, error) { + taskPath := fs.proc.Path(strconv.Itoa(pid), "task") + d, err := os.Open(taskPath) + if err != nil { + return Procs{}, err + } + defer d.Close() + + names, err := d.Readdirnames(-1) + if err != nil { + return Procs{}, fmt.Errorf("%s: could not read %q: %w", ErrFileRead, d.Name(), err) + } + + t := Procs{} + for _, n := range names { + tid, err := strconv.ParseInt(n, 10, 64) + if err != nil { + continue + } + + t = append(t, Proc{PID: int(tid), fs: FS{fsi.FS(taskPath), fs.isReal}}) + } + + return t, nil +} + +// Thread returns a process for a given PID, TID. +func (fs FS) Thread(pid, tid int) (Proc, error) { + taskPath := fs.proc.Path(strconv.Itoa(pid), "task") + if _, err := os.Stat(taskPath); err != nil { + return Proc{}, err + } + return Proc{PID: tid, fs: FS{fsi.FS(taskPath), fs.isReal}}, nil +} + +// Thread returns a process for a given TID of Proc. +func (proc Proc) Thread(tid int) (Proc, error) { + tfs := FS{fsi.FS(proc.path("task")), proc.fs.isReal} + if _, err := os.Stat(tfs.proc.Path(strconv.Itoa(tid))); err != nil { + return Proc{}, err + } + return Proc{PID: tid, fs: tfs}, nil +} diff --git a/vendor/github.com/prometheus/procfs/vm.go b/vendor/github.com/prometheus/procfs/vm.go index 20ceb77e2d..51c49d89e8 100644 --- a/vendor/github.com/prometheus/procfs/vm.go +++ b/vendor/github.com/prometheus/procfs/vm.go @@ -26,7 +26,9 @@ import ( ) // The VM interface is described at -// https://www.kernel.org/doc/Documentation/sysctl/vm.txt +// +// https://www.kernel.org/doc/Documentation/sysctl/vm.txt +// // Each setting is exposed as a single file. // Each file contains one line with a single numerical value, except lowmem_reserve_ratio which holds an array // and numa_zonelist_order (deprecated) which is a string. @@ -84,7 +86,7 @@ func (fs FS) VM() (*VM, error) { return nil, err } if !file.Mode().IsDir() { - return nil, fmt.Errorf("%s is not a directory", path) + return nil, fmt.Errorf("%w: %s is not a directory", ErrFileRead, path) } files, err := os.ReadDir(path) diff --git a/vendor/github.com/prometheus/procfs/zoneinfo.go b/vendor/github.com/prometheus/procfs/zoneinfo.go index c745a4c04f..ce5fefa5b3 100644 --- a/vendor/github.com/prometheus/procfs/zoneinfo.go +++ b/vendor/github.com/prometheus/procfs/zoneinfo.go @@ -75,11 +75,11 @@ var nodeZoneRE = regexp.MustCompile(`(\d+), zone\s+(\w+)`) func (fs FS) Zoneinfo() ([]Zoneinfo, error) { data, err := os.ReadFile(fs.proc.Path("zoneinfo")) if err != nil { - return nil, fmt.Errorf("error reading zoneinfo %q: %w", fs.proc.Path("zoneinfo"), err) + return nil, fmt.Errorf("%s: error reading zoneinfo %q: %w", ErrFileRead, fs.proc.Path("zoneinfo"), err) } zoneinfo, err := parseZoneinfo(data) if err != nil { - return nil, fmt.Errorf("error parsing zoneinfo %q: %w", fs.proc.Path("zoneinfo"), err) + return nil, fmt.Errorf("%s: error parsing zoneinfo %q: %w", ErrFileParse, fs.proc.Path("zoneinfo"), err) } return zoneinfo, nil } diff --git a/vendor/github.com/stretchr/testify/assert/assertion_compare.go b/vendor/github.com/stretchr/testify/assert/assertion_compare.go index 95d8e59da6..b774da88d8 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_compare.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_compare.go @@ -352,9 +352,9 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { // Greater asserts that the first element is greater than the second // -// assert.Greater(t, 2, 1) -// assert.Greater(t, float64(2), float64(1)) -// assert.Greater(t, "b", "a") +// assert.Greater(t, 2, 1) +// assert.Greater(t, float64(2), float64(1)) +// assert.Greater(t, "b", "a") func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -364,10 +364,10 @@ func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface // GreaterOrEqual asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqual(t, 2, 1) -// assert.GreaterOrEqual(t, 2, 2) -// assert.GreaterOrEqual(t, "b", "a") -// assert.GreaterOrEqual(t, "b", "b") +// assert.GreaterOrEqual(t, 2, 1) +// assert.GreaterOrEqual(t, 2, 2) +// assert.GreaterOrEqual(t, "b", "a") +// assert.GreaterOrEqual(t, "b", "b") func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -377,9 +377,9 @@ func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...in // Less asserts that the first element is less than the second // -// assert.Less(t, 1, 2) -// assert.Less(t, float64(1), float64(2)) -// assert.Less(t, "a", "b") +// assert.Less(t, 1, 2) +// assert.Less(t, float64(1), float64(2)) +// assert.Less(t, "a", "b") func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -389,10 +389,10 @@ func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) // LessOrEqual asserts that the first element is less than or equal to the second // -// assert.LessOrEqual(t, 1, 2) -// assert.LessOrEqual(t, 2, 2) -// assert.LessOrEqual(t, "a", "b") -// assert.LessOrEqual(t, "b", "b") +// assert.LessOrEqual(t, 1, 2) +// assert.LessOrEqual(t, 2, 2) +// assert.LessOrEqual(t, "a", "b") +// assert.LessOrEqual(t, "b", "b") func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -402,8 +402,8 @@ func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...inter // Positive asserts that the specified element is positive // -// assert.Positive(t, 1) -// assert.Positive(t, 1.23) +// assert.Positive(t, 1) +// assert.Positive(t, 1.23) func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -414,8 +414,8 @@ func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { // Negative asserts that the specified element is negative // -// assert.Negative(t, -1) -// assert.Negative(t, -1.23) +// assert.Negative(t, -1) +// assert.Negative(t, -1.23) func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/assert/assertion_format.go b/vendor/github.com/stretchr/testify/assert/assertion_format.go index 7880b8f943..84dbd6c790 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_format.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_format.go @@ -22,9 +22,9 @@ func Conditionf(t TestingT, comp Comparison, msg string, args ...interface{}) bo // Containsf asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Containsf(t, "Hello World", "World", "error message %s", "formatted") -// assert.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") -// assert.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") +// assert.Containsf(t, "Hello World", "World", "error message %s", "formatted") +// assert.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") +// assert.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") func Containsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -56,7 +56,7 @@ func ElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string // Emptyf asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Emptyf(t, obj, "error message %s", "formatted") +// assert.Emptyf(t, obj, "error message %s", "formatted") func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -66,7 +66,7 @@ func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) boo // Equalf asserts that two objects are equal. // -// assert.Equalf(t, 123, 123, "error message %s", "formatted") +// assert.Equalf(t, 123, 123, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -81,8 +81,8 @@ func Equalf(t TestingT, expected interface{}, actual interface{}, msg string, ar // EqualErrorf asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// assert.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// assert.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") func EqualErrorf(t TestingT, theError error, errString string, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -90,10 +90,27 @@ func EqualErrorf(t TestingT, theError error, errString string, msg string, args return EqualError(t, theError, errString, append([]interface{}{msg}, args...)...) } +// EqualExportedValuesf asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// assert.EqualExportedValuesf(t, S{1, 2}, S{1, 3}, "error message %s", "formatted") => true +// assert.EqualExportedValuesf(t, S{1, 2}, S{2, 3}, "error message %s", "formatted") => false +func EqualExportedValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return EqualExportedValues(t, expected, actual, append([]interface{}{msg}, args...)...) +} + // EqualValuesf asserts that two objects are equal or convertable to the same types // and equal. // -// assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") +// assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -103,10 +120,10 @@ func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg stri // Errorf asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if assert.Errorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedErrorf, err) -// } +// actualObj, err := SomeFunction() +// if assert.Errorf(t, err, "error message %s", "formatted") { +// assert.Equal(t, expectedErrorf, err) +// } func Errorf(t TestingT, err error, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -126,8 +143,8 @@ func ErrorAsf(t TestingT, err error, target interface{}, msg string, args ...int // ErrorContainsf asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// assert.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// assert.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") func ErrorContainsf(t TestingT, theError error, contains string, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -147,7 +164,7 @@ func ErrorIsf(t TestingT, err error, target error, msg string, args ...interface // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// assert.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -155,9 +172,34 @@ func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick return Eventually(t, condition, waitFor, tick, append([]interface{}{msg}, args...)...) } +// EventuallyWithTf asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// assert.EventuallyWithTf(t, func(c *assert.CollectT, "error message %s", "formatted") { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +func EventuallyWithTf(t TestingT, condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return EventuallyWithT(t, condition, waitFor, tick, append([]interface{}{msg}, args...)...) +} + // Exactlyf asserts that two objects are equal in value and type. // -// assert.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") +// assert.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") func Exactlyf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -183,7 +225,7 @@ func FailNowf(t TestingT, failureMessage string, msg string, args ...interface{} // Falsef asserts that the specified value is false. // -// assert.Falsef(t, myBool, "error message %s", "formatted") +// assert.Falsef(t, myBool, "error message %s", "formatted") func Falsef(t TestingT, value bool, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -202,9 +244,9 @@ func FileExistsf(t TestingT, path string, msg string, args ...interface{}) bool // Greaterf asserts that the first element is greater than the second // -// assert.Greaterf(t, 2, 1, "error message %s", "formatted") -// assert.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") -// assert.Greaterf(t, "b", "a", "error message %s", "formatted") +// assert.Greaterf(t, 2, 1, "error message %s", "formatted") +// assert.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") +// assert.Greaterf(t, "b", "a", "error message %s", "formatted") func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -214,10 +256,10 @@ func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...in // GreaterOrEqualf asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") +// assert.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") +// assert.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") +// assert.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") +// assert.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -228,7 +270,7 @@ func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, arg // HTTPBodyContainsf asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// assert.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) bool { @@ -241,7 +283,7 @@ func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url // HTTPBodyNotContainsf asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// assert.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) bool { @@ -253,7 +295,7 @@ func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, u // HTTPErrorf asserts that a specified handler returns an error status code. // -// assert.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -265,7 +307,7 @@ func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, // HTTPRedirectf asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -277,7 +319,7 @@ func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url stri // HTTPStatusCodef asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") +// assert.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msg string, args ...interface{}) bool { @@ -289,7 +331,7 @@ func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url st // HTTPSuccessf asserts that a specified handler returns a success status code. // -// assert.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") +// assert.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -301,7 +343,7 @@ func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url strin // Implementsf asserts that an object is implemented by the specified interface. // -// assert.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// assert.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -311,7 +353,7 @@ func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, ms // InDeltaf asserts that the two numerals are within delta of each other. // -// assert.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") +// assert.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") func InDeltaf(t TestingT, expected interface{}, actual interface{}, delta float64, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -353,9 +395,9 @@ func InEpsilonSlicef(t TestingT, expected interface{}, actual interface{}, epsil // IsDecreasingf asserts that the collection is decreasing // -// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -365,9 +407,9 @@ func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface // IsIncreasingf asserts that the collection is increasing // -// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -377,9 +419,9 @@ func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface // IsNonDecreasingf asserts that the collection is not decreasing // -// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -389,9 +431,9 @@ func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interf // IsNonIncreasingf asserts that the collection is not increasing // -// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsNonIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -409,7 +451,7 @@ func IsTypef(t TestingT, expectedType interface{}, object interface{}, msg strin // JSONEqf asserts that two JSON strings are equivalent. // -// assert.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") +// assert.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") func JSONEqf(t TestingT, expected string, actual string, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -420,7 +462,7 @@ func JSONEqf(t TestingT, expected string, actual string, msg string, args ...int // Lenf asserts that the specified object has specific length. // Lenf also fails if the object has a type that len() not accept. // -// assert.Lenf(t, mySlice, 3, "error message %s", "formatted") +// assert.Lenf(t, mySlice, 3, "error message %s", "formatted") func Lenf(t TestingT, object interface{}, length int, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -430,9 +472,9 @@ func Lenf(t TestingT, object interface{}, length int, msg string, args ...interf // Lessf asserts that the first element is less than the second // -// assert.Lessf(t, 1, 2, "error message %s", "formatted") -// assert.Lessf(t, float64(1), float64(2), "error message %s", "formatted") -// assert.Lessf(t, "a", "b", "error message %s", "formatted") +// assert.Lessf(t, 1, 2, "error message %s", "formatted") +// assert.Lessf(t, float64(1), float64(2), "error message %s", "formatted") +// assert.Lessf(t, "a", "b", "error message %s", "formatted") func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -442,10 +484,10 @@ func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...inter // LessOrEqualf asserts that the first element is less than or equal to the second // -// assert.LessOrEqualf(t, 1, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, "a", "b", "error message %s", "formatted") -// assert.LessOrEqualf(t, "b", "b", "error message %s", "formatted") +// assert.LessOrEqualf(t, 1, 2, "error message %s", "formatted") +// assert.LessOrEqualf(t, 2, 2, "error message %s", "formatted") +// assert.LessOrEqualf(t, "a", "b", "error message %s", "formatted") +// assert.LessOrEqualf(t, "b", "b", "error message %s", "formatted") func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -455,8 +497,8 @@ func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args . // Negativef asserts that the specified element is negative // -// assert.Negativef(t, -1, "error message %s", "formatted") -// assert.Negativef(t, -1.23, "error message %s", "formatted") +// assert.Negativef(t, -1, "error message %s", "formatted") +// assert.Negativef(t, -1.23, "error message %s", "formatted") func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -467,7 +509,7 @@ func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) bool // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// assert.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -477,7 +519,7 @@ func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time. // Nilf asserts that the specified object is nil. // -// assert.Nilf(t, err, "error message %s", "formatted") +// assert.Nilf(t, err, "error message %s", "formatted") func Nilf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -496,10 +538,10 @@ func NoDirExistsf(t TestingT, path string, msg string, args ...interface{}) bool // NoErrorf asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if assert.NoErrorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if assert.NoErrorf(t, err, "error message %s", "formatted") { +// assert.Equal(t, expectedObj, actualObj) +// } func NoErrorf(t TestingT, err error, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -519,9 +561,9 @@ func NoFileExistsf(t TestingT, path string, msg string, args ...interface{}) boo // NotContainsf asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") +// assert.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") +// assert.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") +// assert.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -532,9 +574,9 @@ func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, a // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmptyf(t, obj, "error message %s", "formatted") { -// assert.Equal(t, "two", obj[1]) -// } +// if assert.NotEmptyf(t, obj, "error message %s", "formatted") { +// assert.Equal(t, "two", obj[1]) +// } func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -544,7 +586,7 @@ func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) // NotEqualf asserts that the specified values are NOT equal. // -// assert.NotEqualf(t, obj1, obj2, "error message %s", "formatted") +// assert.NotEqualf(t, obj1, obj2, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -557,7 +599,7 @@ func NotEqualf(t TestingT, expected interface{}, actual interface{}, msg string, // NotEqualValuesf asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") +// assert.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -576,7 +618,7 @@ func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interf // NotNilf asserts that the specified object is not nil. // -// assert.NotNilf(t, err, "error message %s", "formatted") +// assert.NotNilf(t, err, "error message %s", "formatted") func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -586,7 +628,7 @@ func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) bo // NotPanicsf asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") +// assert.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") func NotPanicsf(t TestingT, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -596,8 +638,8 @@ func NotPanicsf(t TestingT, f PanicTestFunc, msg string, args ...interface{}) bo // NotRegexpf asserts that a specified regexp does not match a string. // -// assert.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") -// assert.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") +// assert.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") +// assert.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -607,7 +649,7 @@ func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args .. // NotSamef asserts that two pointers do not reference the same object. // -// assert.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") +// assert.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -621,7 +663,7 @@ func NotSamef(t TestingT, expected interface{}, actual interface{}, msg string, // NotSubsetf asserts that the specified list(array, slice...) contains not all // elements given in the specified subset(array, slice...). // -// assert.NotSubsetf(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") +// assert.NotSubsetf(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") func NotSubsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -639,7 +681,7 @@ func NotZerof(t TestingT, i interface{}, msg string, args ...interface{}) bool { // Panicsf asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") +// assert.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") func Panicsf(t TestingT, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -651,7 +693,7 @@ func Panicsf(t TestingT, f PanicTestFunc, msg string, args ...interface{}) bool // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// assert.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithErrorf(t TestingT, errString string, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -662,7 +704,7 @@ func PanicsWithErrorf(t TestingT, errString string, f PanicTestFunc, msg string, // PanicsWithValuef asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// assert.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithValuef(t TestingT, expected interface{}, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -672,8 +714,8 @@ func PanicsWithValuef(t TestingT, expected interface{}, f PanicTestFunc, msg str // Positivef asserts that the specified element is positive // -// assert.Positivef(t, 1, "error message %s", "formatted") -// assert.Positivef(t, 1.23, "error message %s", "formatted") +// assert.Positivef(t, 1, "error message %s", "formatted") +// assert.Positivef(t, 1.23, "error message %s", "formatted") func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -683,8 +725,8 @@ func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) bool // Regexpf asserts that a specified regexp matches a string. // -// assert.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") -// assert.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") +// assert.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") +// assert.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -694,7 +736,7 @@ func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...in // Samef asserts that two pointers reference the same object. // -// assert.Samef(t, ptr1, ptr2, "error message %s", "formatted") +// assert.Samef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -708,7 +750,7 @@ func Samef(t TestingT, expected interface{}, actual interface{}, msg string, arg // Subsetf asserts that the specified list(array, slice...) contains all // elements given in the specified subset(array, slice...). // -// assert.Subsetf(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") +// assert.Subsetf(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -718,7 +760,7 @@ func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args // Truef asserts that the specified value is true. // -// assert.Truef(t, myBool, "error message %s", "formatted") +// assert.Truef(t, myBool, "error message %s", "formatted") func Truef(t TestingT, value bool, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -728,7 +770,7 @@ func Truef(t TestingT, value bool, msg string, args ...interface{}) bool { // WithinDurationf asserts that the two times are within duration delta of each other. // -// assert.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") +// assert.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta time.Duration, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -738,7 +780,7 @@ func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta tim // WithinRangef asserts that a time is within a time range (inclusive). // -// assert.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") +// assert.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") func WithinRangef(t TestingT, actual time.Time, start time.Time, end time.Time, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/assert/assertion_forward.go b/vendor/github.com/stretchr/testify/assert/assertion_forward.go index 339515b8bf..b1d94aec53 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_forward.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_forward.go @@ -30,9 +30,9 @@ func (a *Assertions) Conditionf(comp Comparison, msg string, args ...interface{} // Contains asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// a.Contains("Hello World", "World") -// a.Contains(["Hello", "World"], "World") -// a.Contains({"Hello": "World"}, "Hello") +// a.Contains("Hello World", "World") +// a.Contains(["Hello", "World"], "World") +// a.Contains({"Hello": "World"}, "Hello") func (a *Assertions) Contains(s interface{}, contains interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -43,9 +43,9 @@ func (a *Assertions) Contains(s interface{}, contains interface{}, msgAndArgs .. // Containsf asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// a.Containsf("Hello World", "World", "error message %s", "formatted") -// a.Containsf(["Hello", "World"], "World", "error message %s", "formatted") -// a.Containsf({"Hello": "World"}, "Hello", "error message %s", "formatted") +// a.Containsf("Hello World", "World", "error message %s", "formatted") +// a.Containsf(["Hello", "World"], "World", "error message %s", "formatted") +// a.Containsf({"Hello": "World"}, "Hello", "error message %s", "formatted") func (a *Assertions) Containsf(s interface{}, contains interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -98,7 +98,7 @@ func (a *Assertions) ElementsMatchf(listA interface{}, listB interface{}, msg st // Empty asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// a.Empty(obj) +// a.Empty(obj) func (a *Assertions) Empty(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -109,7 +109,7 @@ func (a *Assertions) Empty(object interface{}, msgAndArgs ...interface{}) bool { // Emptyf asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// a.Emptyf(obj, "error message %s", "formatted") +// a.Emptyf(obj, "error message %s", "formatted") func (a *Assertions) Emptyf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -119,7 +119,7 @@ func (a *Assertions) Emptyf(object interface{}, msg string, args ...interface{}) // Equal asserts that two objects are equal. // -// a.Equal(123, 123) +// a.Equal(123, 123) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -134,8 +134,8 @@ func (a *Assertions) Equal(expected interface{}, actual interface{}, msgAndArgs // EqualError asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// a.EqualError(err, expectedErrorString) +// actualObj, err := SomeFunction() +// a.EqualError(err, expectedErrorString) func (a *Assertions) EqualError(theError error, errString string, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -146,8 +146,8 @@ func (a *Assertions) EqualError(theError error, errString string, msgAndArgs ... // EqualErrorf asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// a.EqualErrorf(err, expectedErrorString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// a.EqualErrorf(err, expectedErrorString, "error message %s", "formatted") func (a *Assertions) EqualErrorf(theError error, errString string, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -155,10 +155,44 @@ func (a *Assertions) EqualErrorf(theError error, errString string, msg string, a return EqualErrorf(a.t, theError, errString, msg, args...) } +// EqualExportedValues asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// a.EqualExportedValues(S{1, 2}, S{1, 3}) => true +// a.EqualExportedValues(S{1, 2}, S{2, 3}) => false +func (a *Assertions) EqualExportedValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return EqualExportedValues(a.t, expected, actual, msgAndArgs...) +} + +// EqualExportedValuesf asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// a.EqualExportedValuesf(S{1, 2}, S{1, 3}, "error message %s", "formatted") => true +// a.EqualExportedValuesf(S{1, 2}, S{2, 3}, "error message %s", "formatted") => false +func (a *Assertions) EqualExportedValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return EqualExportedValuesf(a.t, expected, actual, msg, args...) +} + // EqualValues asserts that two objects are equal or convertable to the same types // and equal. // -// a.EqualValues(uint32(123), int32(123)) +// a.EqualValues(uint32(123), int32(123)) func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -169,7 +203,7 @@ func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAn // EqualValuesf asserts that two objects are equal or convertable to the same types // and equal. // -// a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") +// a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -179,7 +213,7 @@ func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg // Equalf asserts that two objects are equal. // -// a.Equalf(123, 123, "error message %s", "formatted") +// a.Equalf(123, 123, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -193,10 +227,10 @@ func (a *Assertions) Equalf(expected interface{}, actual interface{}, msg string // Error asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if a.Error(err) { -// assert.Equal(t, expectedError, err) -// } +// actualObj, err := SomeFunction() +// if a.Error(err) { +// assert.Equal(t, expectedError, err) +// } func (a *Assertions) Error(err error, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -225,8 +259,8 @@ func (a *Assertions) ErrorAsf(err error, target interface{}, msg string, args .. // ErrorContains asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// a.ErrorContains(err, expectedErrorSubString) +// actualObj, err := SomeFunction() +// a.ErrorContains(err, expectedErrorSubString) func (a *Assertions) ErrorContains(theError error, contains string, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -237,8 +271,8 @@ func (a *Assertions) ErrorContains(theError error, contains string, msgAndArgs . // ErrorContainsf asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// a.ErrorContainsf(err, expectedErrorSubString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// a.ErrorContainsf(err, expectedErrorSubString, "error message %s", "formatted") func (a *Assertions) ErrorContainsf(theError error, contains string, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -266,10 +300,10 @@ func (a *Assertions) ErrorIsf(err error, target error, msg string, args ...inter // Errorf asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if a.Errorf(err, "error message %s", "formatted") { -// assert.Equal(t, expectedErrorf, err) -// } +// actualObj, err := SomeFunction() +// if a.Errorf(err, "error message %s", "formatted") { +// assert.Equal(t, expectedErrorf, err) +// } func (a *Assertions) Errorf(err error, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -280,7 +314,7 @@ func (a *Assertions) Errorf(err error, msg string, args ...interface{}) bool { // Eventually asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// a.Eventually(func() bool { return true; }, time.Second, 10*time.Millisecond) +// a.Eventually(func() bool { return true; }, time.Second, 10*time.Millisecond) func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -288,10 +322,60 @@ func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, ti return Eventually(a.t, condition, waitFor, tick, msgAndArgs...) } +// EventuallyWithT asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// a.EventuallyWithT(func(c *assert.CollectT) { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +func (a *Assertions) EventuallyWithT(condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return EventuallyWithT(a.t, condition, waitFor, tick, msgAndArgs...) +} + +// EventuallyWithTf asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// a.EventuallyWithTf(func(c *assert.CollectT, "error message %s", "formatted") { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +func (a *Assertions) EventuallyWithTf(condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return EventuallyWithTf(a.t, condition, waitFor, tick, msg, args...) +} + // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// a.Eventuallyf(func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// a.Eventuallyf(func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func (a *Assertions) Eventuallyf(condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -301,7 +385,7 @@ func (a *Assertions) Eventuallyf(condition func() bool, waitFor time.Duration, t // Exactly asserts that two objects are equal in value and type. // -// a.Exactly(int32(123), int64(123)) +// a.Exactly(int32(123), int64(123)) func (a *Assertions) Exactly(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -311,7 +395,7 @@ func (a *Assertions) Exactly(expected interface{}, actual interface{}, msgAndArg // Exactlyf asserts that two objects are equal in value and type. // -// a.Exactlyf(int32(123), int64(123), "error message %s", "formatted") +// a.Exactlyf(int32(123), int64(123), "error message %s", "formatted") func (a *Assertions) Exactlyf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -353,7 +437,7 @@ func (a *Assertions) Failf(failureMessage string, msg string, args ...interface{ // False asserts that the specified value is false. // -// a.False(myBool) +// a.False(myBool) func (a *Assertions) False(value bool, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -363,7 +447,7 @@ func (a *Assertions) False(value bool, msgAndArgs ...interface{}) bool { // Falsef asserts that the specified value is false. // -// a.Falsef(myBool, "error message %s", "formatted") +// a.Falsef(myBool, "error message %s", "formatted") func (a *Assertions) Falsef(value bool, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -391,9 +475,9 @@ func (a *Assertions) FileExistsf(path string, msg string, args ...interface{}) b // Greater asserts that the first element is greater than the second // -// a.Greater(2, 1) -// a.Greater(float64(2), float64(1)) -// a.Greater("b", "a") +// a.Greater(2, 1) +// a.Greater(float64(2), float64(1)) +// a.Greater("b", "a") func (a *Assertions) Greater(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -403,10 +487,10 @@ func (a *Assertions) Greater(e1 interface{}, e2 interface{}, msgAndArgs ...inter // GreaterOrEqual asserts that the first element is greater than or equal to the second // -// a.GreaterOrEqual(2, 1) -// a.GreaterOrEqual(2, 2) -// a.GreaterOrEqual("b", "a") -// a.GreaterOrEqual("b", "b") +// a.GreaterOrEqual(2, 1) +// a.GreaterOrEqual(2, 2) +// a.GreaterOrEqual("b", "a") +// a.GreaterOrEqual("b", "b") func (a *Assertions) GreaterOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -416,10 +500,10 @@ func (a *Assertions) GreaterOrEqual(e1 interface{}, e2 interface{}, msgAndArgs . // GreaterOrEqualf asserts that the first element is greater than or equal to the second // -// a.GreaterOrEqualf(2, 1, "error message %s", "formatted") -// a.GreaterOrEqualf(2, 2, "error message %s", "formatted") -// a.GreaterOrEqualf("b", "a", "error message %s", "formatted") -// a.GreaterOrEqualf("b", "b", "error message %s", "formatted") +// a.GreaterOrEqualf(2, 1, "error message %s", "formatted") +// a.GreaterOrEqualf(2, 2, "error message %s", "formatted") +// a.GreaterOrEqualf("b", "a", "error message %s", "formatted") +// a.GreaterOrEqualf("b", "b", "error message %s", "formatted") func (a *Assertions) GreaterOrEqualf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -429,9 +513,9 @@ func (a *Assertions) GreaterOrEqualf(e1 interface{}, e2 interface{}, msg string, // Greaterf asserts that the first element is greater than the second // -// a.Greaterf(2, 1, "error message %s", "formatted") -// a.Greaterf(float64(2), float64(1), "error message %s", "formatted") -// a.Greaterf("b", "a", "error message %s", "formatted") +// a.Greaterf(2, 1, "error message %s", "formatted") +// a.Greaterf(float64(2), float64(1), "error message %s", "formatted") +// a.Greaterf("b", "a", "error message %s", "formatted") func (a *Assertions) Greaterf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -442,7 +526,7 @@ func (a *Assertions) Greaterf(e1 interface{}, e2 interface{}, msg string, args . // HTTPBodyContains asserts that a specified handler returns a // body that contains a string. // -// a.HTTPBodyContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// a.HTTPBodyContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyContains(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) bool { @@ -455,7 +539,7 @@ func (a *Assertions) HTTPBodyContains(handler http.HandlerFunc, method string, u // HTTPBodyContainsf asserts that a specified handler returns a // body that contains a string. // -// a.HTTPBodyContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// a.HTTPBodyContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyContainsf(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) bool { @@ -468,7 +552,7 @@ func (a *Assertions) HTTPBodyContainsf(handler http.HandlerFunc, method string, // HTTPBodyNotContains asserts that a specified handler returns a // body that does not contain a string. // -// a.HTTPBodyNotContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// a.HTTPBodyNotContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyNotContains(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) bool { @@ -481,7 +565,7 @@ func (a *Assertions) HTTPBodyNotContains(handler http.HandlerFunc, method string // HTTPBodyNotContainsf asserts that a specified handler returns a // body that does not contain a string. // -// a.HTTPBodyNotContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// a.HTTPBodyNotContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyNotContainsf(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) bool { @@ -493,7 +577,7 @@ func (a *Assertions) HTTPBodyNotContainsf(handler http.HandlerFunc, method strin // HTTPError asserts that a specified handler returns an error status code. // -// a.HTTPError(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPError(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPError(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -505,7 +589,7 @@ func (a *Assertions) HTTPError(handler http.HandlerFunc, method string, url stri // HTTPErrorf asserts that a specified handler returns an error status code. // -// a.HTTPErrorf(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPErrorf(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPErrorf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -517,7 +601,7 @@ func (a *Assertions) HTTPErrorf(handler http.HandlerFunc, method string, url str // HTTPRedirect asserts that a specified handler returns a redirect status code. // -// a.HTTPRedirect(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPRedirect(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPRedirect(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -529,7 +613,7 @@ func (a *Assertions) HTTPRedirect(handler http.HandlerFunc, method string, url s // HTTPRedirectf asserts that a specified handler returns a redirect status code. // -// a.HTTPRedirectf(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPRedirectf(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPRedirectf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -541,7 +625,7 @@ func (a *Assertions) HTTPRedirectf(handler http.HandlerFunc, method string, url // HTTPStatusCode asserts that a specified handler returns a specified status code. // -// a.HTTPStatusCode(myHandler, "GET", "/notImplemented", nil, 501) +// a.HTTPStatusCode(myHandler, "GET", "/notImplemented", nil, 501) // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPStatusCode(handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msgAndArgs ...interface{}) bool { @@ -553,7 +637,7 @@ func (a *Assertions) HTTPStatusCode(handler http.HandlerFunc, method string, url // HTTPStatusCodef asserts that a specified handler returns a specified status code. // -// a.HTTPStatusCodef(myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") +// a.HTTPStatusCodef(myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPStatusCodef(handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msg string, args ...interface{}) bool { @@ -565,7 +649,7 @@ func (a *Assertions) HTTPStatusCodef(handler http.HandlerFunc, method string, ur // HTTPSuccess asserts that a specified handler returns a success status code. // -// a.HTTPSuccess(myHandler, "POST", "http://www.google.com", nil) +// a.HTTPSuccess(myHandler, "POST", "http://www.google.com", nil) // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPSuccess(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -577,7 +661,7 @@ func (a *Assertions) HTTPSuccess(handler http.HandlerFunc, method string, url st // HTTPSuccessf asserts that a specified handler returns a success status code. // -// a.HTTPSuccessf(myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") +// a.HTTPSuccessf(myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPSuccessf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -589,7 +673,7 @@ func (a *Assertions) HTTPSuccessf(handler http.HandlerFunc, method string, url s // Implements asserts that an object is implemented by the specified interface. // -// a.Implements((*MyInterface)(nil), new(MyObject)) +// a.Implements((*MyInterface)(nil), new(MyObject)) func (a *Assertions) Implements(interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -599,7 +683,7 @@ func (a *Assertions) Implements(interfaceObject interface{}, object interface{}, // Implementsf asserts that an object is implemented by the specified interface. // -// a.Implementsf((*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// a.Implementsf((*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func (a *Assertions) Implementsf(interfaceObject interface{}, object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -609,7 +693,7 @@ func (a *Assertions) Implementsf(interfaceObject interface{}, object interface{} // InDelta asserts that the two numerals are within delta of each other. // -// a.InDelta(math.Pi, 22/7.0, 0.01) +// a.InDelta(math.Pi, 22/7.0, 0.01) func (a *Assertions) InDelta(expected interface{}, actual interface{}, delta float64, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -651,7 +735,7 @@ func (a *Assertions) InDeltaSlicef(expected interface{}, actual interface{}, del // InDeltaf asserts that the two numerals are within delta of each other. // -// a.InDeltaf(math.Pi, 22/7.0, 0.01, "error message %s", "formatted") +// a.InDeltaf(math.Pi, 22/7.0, 0.01, "error message %s", "formatted") func (a *Assertions) InDeltaf(expected interface{}, actual interface{}, delta float64, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -693,9 +777,9 @@ func (a *Assertions) InEpsilonf(expected interface{}, actual interface{}, epsilo // IsDecreasing asserts that the collection is decreasing // -// a.IsDecreasing([]int{2, 1, 0}) -// a.IsDecreasing([]float{2, 1}) -// a.IsDecreasing([]string{"b", "a"}) +// a.IsDecreasing([]int{2, 1, 0}) +// a.IsDecreasing([]float{2, 1}) +// a.IsDecreasing([]string{"b", "a"}) func (a *Assertions) IsDecreasing(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -705,9 +789,9 @@ func (a *Assertions) IsDecreasing(object interface{}, msgAndArgs ...interface{}) // IsDecreasingf asserts that the collection is decreasing // -// a.IsDecreasingf([]int{2, 1, 0}, "error message %s", "formatted") -// a.IsDecreasingf([]float{2, 1}, "error message %s", "formatted") -// a.IsDecreasingf([]string{"b", "a"}, "error message %s", "formatted") +// a.IsDecreasingf([]int{2, 1, 0}, "error message %s", "formatted") +// a.IsDecreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsDecreasingf([]string{"b", "a"}, "error message %s", "formatted") func (a *Assertions) IsDecreasingf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -717,9 +801,9 @@ func (a *Assertions) IsDecreasingf(object interface{}, msg string, args ...inter // IsIncreasing asserts that the collection is increasing // -// a.IsIncreasing([]int{1, 2, 3}) -// a.IsIncreasing([]float{1, 2}) -// a.IsIncreasing([]string{"a", "b"}) +// a.IsIncreasing([]int{1, 2, 3}) +// a.IsIncreasing([]float{1, 2}) +// a.IsIncreasing([]string{"a", "b"}) func (a *Assertions) IsIncreasing(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -729,9 +813,9 @@ func (a *Assertions) IsIncreasing(object interface{}, msgAndArgs ...interface{}) // IsIncreasingf asserts that the collection is increasing // -// a.IsIncreasingf([]int{1, 2, 3}, "error message %s", "formatted") -// a.IsIncreasingf([]float{1, 2}, "error message %s", "formatted") -// a.IsIncreasingf([]string{"a", "b"}, "error message %s", "formatted") +// a.IsIncreasingf([]int{1, 2, 3}, "error message %s", "formatted") +// a.IsIncreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsIncreasingf([]string{"a", "b"}, "error message %s", "formatted") func (a *Assertions) IsIncreasingf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -741,9 +825,9 @@ func (a *Assertions) IsIncreasingf(object interface{}, msg string, args ...inter // IsNonDecreasing asserts that the collection is not decreasing // -// a.IsNonDecreasing([]int{1, 1, 2}) -// a.IsNonDecreasing([]float{1, 2}) -// a.IsNonDecreasing([]string{"a", "b"}) +// a.IsNonDecreasing([]int{1, 1, 2}) +// a.IsNonDecreasing([]float{1, 2}) +// a.IsNonDecreasing([]string{"a", "b"}) func (a *Assertions) IsNonDecreasing(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -753,9 +837,9 @@ func (a *Assertions) IsNonDecreasing(object interface{}, msgAndArgs ...interface // IsNonDecreasingf asserts that the collection is not decreasing // -// a.IsNonDecreasingf([]int{1, 1, 2}, "error message %s", "formatted") -// a.IsNonDecreasingf([]float{1, 2}, "error message %s", "formatted") -// a.IsNonDecreasingf([]string{"a", "b"}, "error message %s", "formatted") +// a.IsNonDecreasingf([]int{1, 1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]string{"a", "b"}, "error message %s", "formatted") func (a *Assertions) IsNonDecreasingf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -765,9 +849,9 @@ func (a *Assertions) IsNonDecreasingf(object interface{}, msg string, args ...in // IsNonIncreasing asserts that the collection is not increasing // -// a.IsNonIncreasing([]int{2, 1, 1}) -// a.IsNonIncreasing([]float{2, 1}) -// a.IsNonIncreasing([]string{"b", "a"}) +// a.IsNonIncreasing([]int{2, 1, 1}) +// a.IsNonIncreasing([]float{2, 1}) +// a.IsNonIncreasing([]string{"b", "a"}) func (a *Assertions) IsNonIncreasing(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -777,9 +861,9 @@ func (a *Assertions) IsNonIncreasing(object interface{}, msgAndArgs ...interface // IsNonIncreasingf asserts that the collection is not increasing // -// a.IsNonIncreasingf([]int{2, 1, 1}, "error message %s", "formatted") -// a.IsNonIncreasingf([]float{2, 1}, "error message %s", "formatted") -// a.IsNonIncreasingf([]string{"b", "a"}, "error message %s", "formatted") +// a.IsNonIncreasingf([]int{2, 1, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]string{"b", "a"}, "error message %s", "formatted") func (a *Assertions) IsNonIncreasingf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -805,7 +889,7 @@ func (a *Assertions) IsTypef(expectedType interface{}, object interface{}, msg s // JSONEq asserts that two JSON strings are equivalent. // -// a.JSONEq(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) +// a.JSONEq(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) func (a *Assertions) JSONEq(expected string, actual string, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -815,7 +899,7 @@ func (a *Assertions) JSONEq(expected string, actual string, msgAndArgs ...interf // JSONEqf asserts that two JSON strings are equivalent. // -// a.JSONEqf(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") +// a.JSONEqf(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") func (a *Assertions) JSONEqf(expected string, actual string, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -826,7 +910,7 @@ func (a *Assertions) JSONEqf(expected string, actual string, msg string, args .. // Len asserts that the specified object has specific length. // Len also fails if the object has a type that len() not accept. // -// a.Len(mySlice, 3) +// a.Len(mySlice, 3) func (a *Assertions) Len(object interface{}, length int, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -837,7 +921,7 @@ func (a *Assertions) Len(object interface{}, length int, msgAndArgs ...interface // Lenf asserts that the specified object has specific length. // Lenf also fails if the object has a type that len() not accept. // -// a.Lenf(mySlice, 3, "error message %s", "formatted") +// a.Lenf(mySlice, 3, "error message %s", "formatted") func (a *Assertions) Lenf(object interface{}, length int, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -847,9 +931,9 @@ func (a *Assertions) Lenf(object interface{}, length int, msg string, args ...in // Less asserts that the first element is less than the second // -// a.Less(1, 2) -// a.Less(float64(1), float64(2)) -// a.Less("a", "b") +// a.Less(1, 2) +// a.Less(float64(1), float64(2)) +// a.Less("a", "b") func (a *Assertions) Less(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -859,10 +943,10 @@ func (a *Assertions) Less(e1 interface{}, e2 interface{}, msgAndArgs ...interfac // LessOrEqual asserts that the first element is less than or equal to the second // -// a.LessOrEqual(1, 2) -// a.LessOrEqual(2, 2) -// a.LessOrEqual("a", "b") -// a.LessOrEqual("b", "b") +// a.LessOrEqual(1, 2) +// a.LessOrEqual(2, 2) +// a.LessOrEqual("a", "b") +// a.LessOrEqual("b", "b") func (a *Assertions) LessOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -872,10 +956,10 @@ func (a *Assertions) LessOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...i // LessOrEqualf asserts that the first element is less than or equal to the second // -// a.LessOrEqualf(1, 2, "error message %s", "formatted") -// a.LessOrEqualf(2, 2, "error message %s", "formatted") -// a.LessOrEqualf("a", "b", "error message %s", "formatted") -// a.LessOrEqualf("b", "b", "error message %s", "formatted") +// a.LessOrEqualf(1, 2, "error message %s", "formatted") +// a.LessOrEqualf(2, 2, "error message %s", "formatted") +// a.LessOrEqualf("a", "b", "error message %s", "formatted") +// a.LessOrEqualf("b", "b", "error message %s", "formatted") func (a *Assertions) LessOrEqualf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -885,9 +969,9 @@ func (a *Assertions) LessOrEqualf(e1 interface{}, e2 interface{}, msg string, ar // Lessf asserts that the first element is less than the second // -// a.Lessf(1, 2, "error message %s", "formatted") -// a.Lessf(float64(1), float64(2), "error message %s", "formatted") -// a.Lessf("a", "b", "error message %s", "formatted") +// a.Lessf(1, 2, "error message %s", "formatted") +// a.Lessf(float64(1), float64(2), "error message %s", "formatted") +// a.Lessf("a", "b", "error message %s", "formatted") func (a *Assertions) Lessf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -897,8 +981,8 @@ func (a *Assertions) Lessf(e1 interface{}, e2 interface{}, msg string, args ...i // Negative asserts that the specified element is negative // -// a.Negative(-1) -// a.Negative(-1.23) +// a.Negative(-1) +// a.Negative(-1.23) func (a *Assertions) Negative(e interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -908,8 +992,8 @@ func (a *Assertions) Negative(e interface{}, msgAndArgs ...interface{}) bool { // Negativef asserts that the specified element is negative // -// a.Negativef(-1, "error message %s", "formatted") -// a.Negativef(-1.23, "error message %s", "formatted") +// a.Negativef(-1, "error message %s", "formatted") +// a.Negativef(-1.23, "error message %s", "formatted") func (a *Assertions) Negativef(e interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -920,7 +1004,7 @@ func (a *Assertions) Negativef(e interface{}, msg string, args ...interface{}) b // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// a.Never(func() bool { return false; }, time.Second, 10*time.Millisecond) +// a.Never(func() bool { return false; }, time.Second, 10*time.Millisecond) func (a *Assertions) Never(condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -931,7 +1015,7 @@ func (a *Assertions) Never(condition func() bool, waitFor time.Duration, tick ti // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// a.Neverf(func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// a.Neverf(func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func (a *Assertions) Neverf(condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -941,7 +1025,7 @@ func (a *Assertions) Neverf(condition func() bool, waitFor time.Duration, tick t // Nil asserts that the specified object is nil. // -// a.Nil(err) +// a.Nil(err) func (a *Assertions) Nil(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -951,7 +1035,7 @@ func (a *Assertions) Nil(object interface{}, msgAndArgs ...interface{}) bool { // Nilf asserts that the specified object is nil. // -// a.Nilf(err, "error message %s", "formatted") +// a.Nilf(err, "error message %s", "formatted") func (a *Assertions) Nilf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -979,10 +1063,10 @@ func (a *Assertions) NoDirExistsf(path string, msg string, args ...interface{}) // NoError asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if a.NoError(err) { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if a.NoError(err) { +// assert.Equal(t, expectedObj, actualObj) +// } func (a *Assertions) NoError(err error, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -992,10 +1076,10 @@ func (a *Assertions) NoError(err error, msgAndArgs ...interface{}) bool { // NoErrorf asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if a.NoErrorf(err, "error message %s", "formatted") { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if a.NoErrorf(err, "error message %s", "formatted") { +// assert.Equal(t, expectedObj, actualObj) +// } func (a *Assertions) NoErrorf(err error, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1024,9 +1108,9 @@ func (a *Assertions) NoFileExistsf(path string, msg string, args ...interface{}) // NotContains asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// a.NotContains("Hello World", "Earth") -// a.NotContains(["Hello", "World"], "Earth") -// a.NotContains({"Hello": "World"}, "Earth") +// a.NotContains("Hello World", "Earth") +// a.NotContains(["Hello", "World"], "Earth") +// a.NotContains({"Hello": "World"}, "Earth") func (a *Assertions) NotContains(s interface{}, contains interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1037,9 +1121,9 @@ func (a *Assertions) NotContains(s interface{}, contains interface{}, msgAndArgs // NotContainsf asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// a.NotContainsf("Hello World", "Earth", "error message %s", "formatted") -// a.NotContainsf(["Hello", "World"], "Earth", "error message %s", "formatted") -// a.NotContainsf({"Hello": "World"}, "Earth", "error message %s", "formatted") +// a.NotContainsf("Hello World", "Earth", "error message %s", "formatted") +// a.NotContainsf(["Hello", "World"], "Earth", "error message %s", "formatted") +// a.NotContainsf({"Hello": "World"}, "Earth", "error message %s", "formatted") func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1050,9 +1134,9 @@ func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg strin // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if a.NotEmpty(obj) { -// assert.Equal(t, "two", obj[1]) -// } +// if a.NotEmpty(obj) { +// assert.Equal(t, "two", obj[1]) +// } func (a *Assertions) NotEmpty(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1063,9 +1147,9 @@ func (a *Assertions) NotEmpty(object interface{}, msgAndArgs ...interface{}) boo // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if a.NotEmptyf(obj, "error message %s", "formatted") { -// assert.Equal(t, "two", obj[1]) -// } +// if a.NotEmptyf(obj, "error message %s", "formatted") { +// assert.Equal(t, "two", obj[1]) +// } func (a *Assertions) NotEmptyf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1075,7 +1159,7 @@ func (a *Assertions) NotEmptyf(object interface{}, msg string, args ...interface // NotEqual asserts that the specified values are NOT equal. // -// a.NotEqual(obj1, obj2) +// a.NotEqual(obj1, obj2) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1088,7 +1172,7 @@ func (a *Assertions) NotEqual(expected interface{}, actual interface{}, msgAndAr // NotEqualValues asserts that two objects are not equal even when converted to the same type // -// a.NotEqualValues(obj1, obj2) +// a.NotEqualValues(obj1, obj2) func (a *Assertions) NotEqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1098,7 +1182,7 @@ func (a *Assertions) NotEqualValues(expected interface{}, actual interface{}, ms // NotEqualValuesf asserts that two objects are not equal even when converted to the same type // -// a.NotEqualValuesf(obj1, obj2, "error message %s", "formatted") +// a.NotEqualValuesf(obj1, obj2, "error message %s", "formatted") func (a *Assertions) NotEqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1108,7 +1192,7 @@ func (a *Assertions) NotEqualValuesf(expected interface{}, actual interface{}, m // NotEqualf asserts that the specified values are NOT equal. // -// a.NotEqualf(obj1, obj2, "error message %s", "formatted") +// a.NotEqualf(obj1, obj2, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1139,7 +1223,7 @@ func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...in // NotNil asserts that the specified object is not nil. // -// a.NotNil(err) +// a.NotNil(err) func (a *Assertions) NotNil(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1149,7 +1233,7 @@ func (a *Assertions) NotNil(object interface{}, msgAndArgs ...interface{}) bool // NotNilf asserts that the specified object is not nil. // -// a.NotNilf(err, "error message %s", "formatted") +// a.NotNilf(err, "error message %s", "formatted") func (a *Assertions) NotNilf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1159,7 +1243,7 @@ func (a *Assertions) NotNilf(object interface{}, msg string, args ...interface{} // NotPanics asserts that the code inside the specified PanicTestFunc does NOT panic. // -// a.NotPanics(func(){ RemainCalm() }) +// a.NotPanics(func(){ RemainCalm() }) func (a *Assertions) NotPanics(f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1169,7 +1253,7 @@ func (a *Assertions) NotPanics(f PanicTestFunc, msgAndArgs ...interface{}) bool // NotPanicsf asserts that the code inside the specified PanicTestFunc does NOT panic. // -// a.NotPanicsf(func(){ RemainCalm() }, "error message %s", "formatted") +// a.NotPanicsf(func(){ RemainCalm() }, "error message %s", "formatted") func (a *Assertions) NotPanicsf(f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1179,8 +1263,8 @@ func (a *Assertions) NotPanicsf(f PanicTestFunc, msg string, args ...interface{} // NotRegexp asserts that a specified regexp does not match a string. // -// a.NotRegexp(regexp.MustCompile("starts"), "it's starting") -// a.NotRegexp("^start", "it's not starting") +// a.NotRegexp(regexp.MustCompile("starts"), "it's starting") +// a.NotRegexp("^start", "it's not starting") func (a *Assertions) NotRegexp(rx interface{}, str interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1190,8 +1274,8 @@ func (a *Assertions) NotRegexp(rx interface{}, str interface{}, msgAndArgs ...in // NotRegexpf asserts that a specified regexp does not match a string. // -// a.NotRegexpf(regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") -// a.NotRegexpf("^start", "it's not starting", "error message %s", "formatted") +// a.NotRegexpf(regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") +// a.NotRegexpf("^start", "it's not starting", "error message %s", "formatted") func (a *Assertions) NotRegexpf(rx interface{}, str interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1201,7 +1285,7 @@ func (a *Assertions) NotRegexpf(rx interface{}, str interface{}, msg string, arg // NotSame asserts that two pointers do not reference the same object. // -// a.NotSame(ptr1, ptr2) +// a.NotSame(ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1214,7 +1298,7 @@ func (a *Assertions) NotSame(expected interface{}, actual interface{}, msgAndArg // NotSamef asserts that two pointers do not reference the same object. // -// a.NotSamef(ptr1, ptr2, "error message %s", "formatted") +// a.NotSamef(ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1228,7 +1312,7 @@ func (a *Assertions) NotSamef(expected interface{}, actual interface{}, msg stri // NotSubset asserts that the specified list(array, slice...) contains not all // elements given in the specified subset(array, slice...). // -// a.NotSubset([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") +// a.NotSubset([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") func (a *Assertions) NotSubset(list interface{}, subset interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1239,7 +1323,7 @@ func (a *Assertions) NotSubset(list interface{}, subset interface{}, msgAndArgs // NotSubsetf asserts that the specified list(array, slice...) contains not all // elements given in the specified subset(array, slice...). // -// a.NotSubsetf([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") +// a.NotSubsetf([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") func (a *Assertions) NotSubsetf(list interface{}, subset interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1265,7 +1349,7 @@ func (a *Assertions) NotZerof(i interface{}, msg string, args ...interface{}) bo // Panics asserts that the code inside the specified PanicTestFunc panics. // -// a.Panics(func(){ GoCrazy() }) +// a.Panics(func(){ GoCrazy() }) func (a *Assertions) Panics(f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1277,7 +1361,7 @@ func (a *Assertions) Panics(f PanicTestFunc, msgAndArgs ...interface{}) bool { // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// a.PanicsWithError("crazy error", func(){ GoCrazy() }) +// a.PanicsWithError("crazy error", func(){ GoCrazy() }) func (a *Assertions) PanicsWithError(errString string, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1289,7 +1373,7 @@ func (a *Assertions) PanicsWithError(errString string, f PanicTestFunc, msgAndAr // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// a.PanicsWithErrorf("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// a.PanicsWithErrorf("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) PanicsWithErrorf(errString string, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1300,7 +1384,7 @@ func (a *Assertions) PanicsWithErrorf(errString string, f PanicTestFunc, msg str // PanicsWithValue asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// a.PanicsWithValue("crazy error", func(){ GoCrazy() }) +// a.PanicsWithValue("crazy error", func(){ GoCrazy() }) func (a *Assertions) PanicsWithValue(expected interface{}, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1311,7 +1395,7 @@ func (a *Assertions) PanicsWithValue(expected interface{}, f PanicTestFunc, msgA // PanicsWithValuef asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// a.PanicsWithValuef("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// a.PanicsWithValuef("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) PanicsWithValuef(expected interface{}, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1321,7 +1405,7 @@ func (a *Assertions) PanicsWithValuef(expected interface{}, f PanicTestFunc, msg // Panicsf asserts that the code inside the specified PanicTestFunc panics. // -// a.Panicsf(func(){ GoCrazy() }, "error message %s", "formatted") +// a.Panicsf(func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) Panicsf(f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1331,8 +1415,8 @@ func (a *Assertions) Panicsf(f PanicTestFunc, msg string, args ...interface{}) b // Positive asserts that the specified element is positive // -// a.Positive(1) -// a.Positive(1.23) +// a.Positive(1) +// a.Positive(1.23) func (a *Assertions) Positive(e interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1342,8 +1426,8 @@ func (a *Assertions) Positive(e interface{}, msgAndArgs ...interface{}) bool { // Positivef asserts that the specified element is positive // -// a.Positivef(1, "error message %s", "formatted") -// a.Positivef(1.23, "error message %s", "formatted") +// a.Positivef(1, "error message %s", "formatted") +// a.Positivef(1.23, "error message %s", "formatted") func (a *Assertions) Positivef(e interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1353,8 +1437,8 @@ func (a *Assertions) Positivef(e interface{}, msg string, args ...interface{}) b // Regexp asserts that a specified regexp matches a string. // -// a.Regexp(regexp.MustCompile("start"), "it's starting") -// a.Regexp("start...$", "it's not starting") +// a.Regexp(regexp.MustCompile("start"), "it's starting") +// a.Regexp("start...$", "it's not starting") func (a *Assertions) Regexp(rx interface{}, str interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1364,8 +1448,8 @@ func (a *Assertions) Regexp(rx interface{}, str interface{}, msgAndArgs ...inter // Regexpf asserts that a specified regexp matches a string. // -// a.Regexpf(regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") -// a.Regexpf("start...$", "it's not starting", "error message %s", "formatted") +// a.Regexpf(regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") +// a.Regexpf("start...$", "it's not starting", "error message %s", "formatted") func (a *Assertions) Regexpf(rx interface{}, str interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1375,7 +1459,7 @@ func (a *Assertions) Regexpf(rx interface{}, str interface{}, msg string, args . // Same asserts that two pointers reference the same object. // -// a.Same(ptr1, ptr2) +// a.Same(ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1388,7 +1472,7 @@ func (a *Assertions) Same(expected interface{}, actual interface{}, msgAndArgs . // Samef asserts that two pointers reference the same object. // -// a.Samef(ptr1, ptr2, "error message %s", "formatted") +// a.Samef(ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1402,7 +1486,7 @@ func (a *Assertions) Samef(expected interface{}, actual interface{}, msg string, // Subset asserts that the specified list(array, slice...) contains all // elements given in the specified subset(array, slice...). // -// a.Subset([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") +// a.Subset([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") func (a *Assertions) Subset(list interface{}, subset interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1413,7 +1497,7 @@ func (a *Assertions) Subset(list interface{}, subset interface{}, msgAndArgs ... // Subsetf asserts that the specified list(array, slice...) contains all // elements given in the specified subset(array, slice...). // -// a.Subsetf([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") +// a.Subsetf([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") func (a *Assertions) Subsetf(list interface{}, subset interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1423,7 +1507,7 @@ func (a *Assertions) Subsetf(list interface{}, subset interface{}, msg string, a // True asserts that the specified value is true. // -// a.True(myBool) +// a.True(myBool) func (a *Assertions) True(value bool, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1433,7 +1517,7 @@ func (a *Assertions) True(value bool, msgAndArgs ...interface{}) bool { // Truef asserts that the specified value is true. // -// a.Truef(myBool, "error message %s", "formatted") +// a.Truef(myBool, "error message %s", "formatted") func (a *Assertions) Truef(value bool, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1443,7 +1527,7 @@ func (a *Assertions) Truef(value bool, msg string, args ...interface{}) bool { // WithinDuration asserts that the two times are within duration delta of each other. // -// a.WithinDuration(time.Now(), time.Now(), 10*time.Second) +// a.WithinDuration(time.Now(), time.Now(), 10*time.Second) func (a *Assertions) WithinDuration(expected time.Time, actual time.Time, delta time.Duration, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1453,7 +1537,7 @@ func (a *Assertions) WithinDuration(expected time.Time, actual time.Time, delta // WithinDurationf asserts that the two times are within duration delta of each other. // -// a.WithinDurationf(time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") +// a.WithinDurationf(time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") func (a *Assertions) WithinDurationf(expected time.Time, actual time.Time, delta time.Duration, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1463,7 +1547,7 @@ func (a *Assertions) WithinDurationf(expected time.Time, actual time.Time, delta // WithinRange asserts that a time is within a time range (inclusive). // -// a.WithinRange(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) +// a.WithinRange(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) func (a *Assertions) WithinRange(actual time.Time, start time.Time, end time.Time, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1473,7 +1557,7 @@ func (a *Assertions) WithinRange(actual time.Time, start time.Time, end time.Tim // WithinRangef asserts that a time is within a time range (inclusive). // -// a.WithinRangef(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") +// a.WithinRangef(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") func (a *Assertions) WithinRangef(actual time.Time, start time.Time, end time.Time, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/assert/assertion_order.go b/vendor/github.com/stretchr/testify/assert/assertion_order.go index 7594487835..00df62a059 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_order.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_order.go @@ -46,36 +46,36 @@ func isOrdered(t TestingT, object interface{}, allowedComparesResults []CompareT // IsIncreasing asserts that the collection is increasing // -// assert.IsIncreasing(t, []int{1, 2, 3}) -// assert.IsIncreasing(t, []float{1, 2}) -// assert.IsIncreasing(t, []string{"a", "b"}) +// assert.IsIncreasing(t, []int{1, 2, 3}) +// assert.IsIncreasing(t, []float{1, 2}) +// assert.IsIncreasing(t, []string{"a", "b"}) func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { return isOrdered(t, object, []CompareType{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) } // IsNonIncreasing asserts that the collection is not increasing // -// assert.IsNonIncreasing(t, []int{2, 1, 1}) -// assert.IsNonIncreasing(t, []float{2, 1}) -// assert.IsNonIncreasing(t, []string{"b", "a"}) +// assert.IsNonIncreasing(t, []int{2, 1, 1}) +// assert.IsNonIncreasing(t, []float{2, 1}) +// assert.IsNonIncreasing(t, []string{"b", "a"}) func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { return isOrdered(t, object, []CompareType{compareEqual, compareGreater}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) } // IsDecreasing asserts that the collection is decreasing // -// assert.IsDecreasing(t, []int{2, 1, 0}) -// assert.IsDecreasing(t, []float{2, 1}) -// assert.IsDecreasing(t, []string{"b", "a"}) +// assert.IsDecreasing(t, []int{2, 1, 0}) +// assert.IsDecreasing(t, []float{2, 1}) +// assert.IsDecreasing(t, []string{"b", "a"}) func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { return isOrdered(t, object, []CompareType{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) } // IsNonDecreasing asserts that the collection is not decreasing // -// assert.IsNonDecreasing(t, []int{1, 1, 2}) -// assert.IsNonDecreasing(t, []float{1, 2}) -// assert.IsNonDecreasing(t, []string{"a", "b"}) +// assert.IsNonDecreasing(t, []int{1, 1, 2}) +// assert.IsNonDecreasing(t, []float{1, 2}) +// assert.IsNonDecreasing(t, []string{"a", "b"}) func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { return isOrdered(t, object, []CompareType{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) } diff --git a/vendor/github.com/stretchr/testify/assert/assertions.go b/vendor/github.com/stretchr/testify/assert/assertions.go index fa1245b189..a55d1bba92 100644 --- a/vendor/github.com/stretchr/testify/assert/assertions.go +++ b/vendor/github.com/stretchr/testify/assert/assertions.go @@ -8,7 +8,6 @@ import ( "fmt" "math" "os" - "path/filepath" "reflect" "regexp" "runtime" @@ -76,6 +75,77 @@ func ObjectsAreEqual(expected, actual interface{}) bool { return bytes.Equal(exp, act) } +// copyExportedFields iterates downward through nested data structures and creates a copy +// that only contains the exported struct fields. +func copyExportedFields(expected interface{}) interface{} { + if isNil(expected) { + return expected + } + + expectedType := reflect.TypeOf(expected) + expectedKind := expectedType.Kind() + expectedValue := reflect.ValueOf(expected) + + switch expectedKind { + case reflect.Struct: + result := reflect.New(expectedType).Elem() + for i := 0; i < expectedType.NumField(); i++ { + field := expectedType.Field(i) + isExported := field.IsExported() + if isExported { + fieldValue := expectedValue.Field(i) + if isNil(fieldValue) || isNil(fieldValue.Interface()) { + continue + } + newValue := copyExportedFields(fieldValue.Interface()) + result.Field(i).Set(reflect.ValueOf(newValue)) + } + } + return result.Interface() + + case reflect.Ptr: + result := reflect.New(expectedType.Elem()) + unexportedRemoved := copyExportedFields(expectedValue.Elem().Interface()) + result.Elem().Set(reflect.ValueOf(unexportedRemoved)) + return result.Interface() + + case reflect.Array, reflect.Slice: + result := reflect.MakeSlice(expectedType, expectedValue.Len(), expectedValue.Len()) + for i := 0; i < expectedValue.Len(); i++ { + index := expectedValue.Index(i) + if isNil(index) { + continue + } + unexportedRemoved := copyExportedFields(index.Interface()) + result.Index(i).Set(reflect.ValueOf(unexportedRemoved)) + } + return result.Interface() + + case reflect.Map: + result := reflect.MakeMap(expectedType) + for _, k := range expectedValue.MapKeys() { + index := expectedValue.MapIndex(k) + unexportedRemoved := copyExportedFields(index.Interface()) + result.SetMapIndex(k, reflect.ValueOf(unexportedRemoved)) + } + return result.Interface() + + default: + return expected + } +} + +// ObjectsExportedFieldsAreEqual determines if the exported (public) fields of two objects are +// considered equal. This comparison of only exported fields is applied recursively to nested data +// structures. +// +// This function does no assertion of any kind. +func ObjectsExportedFieldsAreEqual(expected, actual interface{}) bool { + expectedCleaned := copyExportedFields(expected) + actualCleaned := copyExportedFields(actual) + return ObjectsAreEqualValues(expectedCleaned, actualCleaned) +} + // ObjectsAreEqualValues gets whether two objects are equal, or if their // values are equal. func ObjectsAreEqualValues(expected, actual interface{}) bool { @@ -141,12 +211,11 @@ func CallerInfo() []string { } parts := strings.Split(file, "/") - file = parts[len(parts)-1] if len(parts) > 1 { + filename := parts[len(parts)-1] dir := parts[len(parts)-2] - if (dir != "assert" && dir != "mock" && dir != "require") || file == "mock_test.go" { - path, _ := filepath.Abs(file) - callers = append(callers, fmt.Sprintf("%s:%d", path, line)) + if (dir != "assert" && dir != "mock" && dir != "require") || filename == "mock_test.go" { + callers = append(callers, fmt.Sprintf("%s:%d", file, line)) } } @@ -273,7 +342,7 @@ type labeledContent struct { // labeledOutput returns a string consisting of the provided labeledContent. Each labeled output is appended in the following manner: // -// \t{{label}}:{{align_spaces}}\t{{content}}\n +// \t{{label}}:{{align_spaces}}\t{{content}}\n // // The initial carriage return is required to undo/erase any padding added by testing.T.Errorf. The "\t{{label}}:" is for the label. // If a label is shorter than the longest label provided, padding spaces are added to make all the labels match in length. Once this @@ -296,7 +365,7 @@ func labeledOutput(content ...labeledContent) string { // Implements asserts that an object is implemented by the specified interface. // -// assert.Implements(t, (*MyInterface)(nil), new(MyObject)) +// assert.Implements(t, (*MyInterface)(nil), new(MyObject)) func Implements(t TestingT, interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -328,7 +397,7 @@ func IsType(t TestingT, expectedType interface{}, object interface{}, msgAndArgs // Equal asserts that two objects are equal. // -// assert.Equal(t, 123, 123) +// assert.Equal(t, 123, 123) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -369,7 +438,7 @@ func validateEqualArgs(expected, actual interface{}) error { // Same asserts that two pointers reference the same object. // -// assert.Same(t, ptr1, ptr2) +// assert.Same(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -389,7 +458,7 @@ func Same(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) b // NotSame asserts that two pointers do not reference the same object. // -// assert.NotSame(t, ptr1, ptr2) +// assert.NotSame(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -457,7 +526,7 @@ func truncatingFormat(data interface{}) string { // EqualValues asserts that two objects are equal or convertable to the same types // and equal. // -// assert.EqualValues(t, uint32(123), int32(123)) +// assert.EqualValues(t, uint32(123), int32(123)) func EqualValues(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -475,9 +544,53 @@ func EqualValues(t TestingT, expected, actual interface{}, msgAndArgs ...interfa } +// EqualExportedValues asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// assert.EqualExportedValues(t, S{1, 2}, S{1, 3}) => true +// assert.EqualExportedValues(t, S{1, 2}, S{2, 3}) => false +func EqualExportedValues(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + + aType := reflect.TypeOf(expected) + bType := reflect.TypeOf(actual) + + if aType != bType { + return Fail(t, fmt.Sprintf("Types expected to match exactly\n\t%v != %v", aType, bType), msgAndArgs...) + } + + if aType.Kind() != reflect.Struct { + return Fail(t, fmt.Sprintf("Types expected to both be struct \n\t%v != %v", aType.Kind(), reflect.Struct), msgAndArgs...) + } + + if bType.Kind() != reflect.Struct { + return Fail(t, fmt.Sprintf("Types expected to both be struct \n\t%v != %v", bType.Kind(), reflect.Struct), msgAndArgs...) + } + + expected = copyExportedFields(expected) + actual = copyExportedFields(actual) + + if !ObjectsAreEqualValues(expected, actual) { + diff := diff(expected, actual) + expected, actual = formatUnequalValues(expected, actual) + return Fail(t, fmt.Sprintf("Not equal (comparing only exported fields): \n"+ + "expected: %s\n"+ + "actual : %s%s", expected, actual, diff), msgAndArgs...) + } + + return true +} + // Exactly asserts that two objects are equal in value and type. // -// assert.Exactly(t, int32(123), int64(123)) +// assert.Exactly(t, int32(123), int64(123)) func Exactly(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -496,7 +609,7 @@ func Exactly(t TestingT, expected, actual interface{}, msgAndArgs ...interface{} // NotNil asserts that the specified object is not nil. // -// assert.NotNil(t, err) +// assert.NotNil(t, err) func NotNil(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { if !isNil(object) { return true @@ -530,7 +643,7 @@ func isNil(object interface{}) bool { []reflect.Kind{ reflect.Chan, reflect.Func, reflect.Interface, reflect.Map, - reflect.Ptr, reflect.Slice}, + reflect.Ptr, reflect.Slice, reflect.UnsafePointer}, kind) if isNilableKind && value.IsNil() { @@ -542,7 +655,7 @@ func isNil(object interface{}) bool { // Nil asserts that the specified object is nil. // -// assert.Nil(t, err) +// assert.Nil(t, err) func Nil(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { if isNil(object) { return true @@ -585,7 +698,7 @@ func isEmpty(object interface{}) bool { // Empty asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Empty(t, obj) +// assert.Empty(t, obj) func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { pass := isEmpty(object) if !pass { @@ -602,9 +715,9 @@ func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmpty(t, obj) { -// assert.Equal(t, "two", obj[1]) -// } +// if assert.NotEmpty(t, obj) { +// assert.Equal(t, "two", obj[1]) +// } func NotEmpty(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { pass := !isEmpty(object) if !pass { @@ -633,7 +746,7 @@ func getLen(x interface{}) (ok bool, length int) { // Len asserts that the specified object has specific length. // Len also fails if the object has a type that len() not accept. // -// assert.Len(t, mySlice, 3) +// assert.Len(t, mySlice, 3) func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -651,7 +764,7 @@ func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) // True asserts that the specified value is true. // -// assert.True(t, myBool) +// assert.True(t, myBool) func True(t TestingT, value bool, msgAndArgs ...interface{}) bool { if !value { if h, ok := t.(tHelper); ok { @@ -666,7 +779,7 @@ func True(t TestingT, value bool, msgAndArgs ...interface{}) bool { // False asserts that the specified value is false. // -// assert.False(t, myBool) +// assert.False(t, myBool) func False(t TestingT, value bool, msgAndArgs ...interface{}) bool { if value { if h, ok := t.(tHelper); ok { @@ -681,7 +794,7 @@ func False(t TestingT, value bool, msgAndArgs ...interface{}) bool { // NotEqual asserts that the specified values are NOT equal. // -// assert.NotEqual(t, obj1, obj2) +// assert.NotEqual(t, obj1, obj2) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -704,7 +817,7 @@ func NotEqual(t TestingT, expected, actual interface{}, msgAndArgs ...interface{ // NotEqualValues asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValues(t, obj1, obj2) +// assert.NotEqualValues(t, obj1, obj2) func NotEqualValues(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -763,9 +876,9 @@ func containsElement(list interface{}, element interface{}) (ok, found bool) { // Contains asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Contains(t, "Hello World", "World") -// assert.Contains(t, ["Hello", "World"], "World") -// assert.Contains(t, {"Hello": "World"}, "Hello") +// assert.Contains(t, "Hello World", "World") +// assert.Contains(t, ["Hello", "World"], "World") +// assert.Contains(t, {"Hello": "World"}, "Hello") func Contains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -786,9 +899,9 @@ func Contains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) bo // NotContains asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContains(t, "Hello World", "Earth") -// assert.NotContains(t, ["Hello", "World"], "Earth") -// assert.NotContains(t, {"Hello": "World"}, "Earth") +// assert.NotContains(t, "Hello World", "Earth") +// assert.NotContains(t, ["Hello", "World"], "Earth") +// assert.NotContains(t, {"Hello": "World"}, "Earth") func NotContains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -796,10 +909,10 @@ func NotContains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) ok, found := containsElement(s, contains) if !ok { - return Fail(t, fmt.Sprintf("\"%s\" could not be applied builtin len()", s), msgAndArgs...) + return Fail(t, fmt.Sprintf("%#v could not be applied builtin len()", s), msgAndArgs...) } if found { - return Fail(t, fmt.Sprintf("\"%s\" should not contain \"%s\"", s, contains), msgAndArgs...) + return Fail(t, fmt.Sprintf("%#v should not contain %#v", s, contains), msgAndArgs...) } return true @@ -809,7 +922,7 @@ func NotContains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) // Subset asserts that the specified list(array, slice...) contains all // elements given in the specified subset(array, slice...). // -// assert.Subset(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") +// assert.Subset(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") func Subset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) (ok bool) { if h, ok := t.(tHelper); ok { h.Helper() @@ -818,49 +931,44 @@ func Subset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) (ok return true // we consider nil to be equal to the nil set } - defer func() { - if e := recover(); e != nil { - ok = false - } - }() - listKind := reflect.TypeOf(list).Kind() - subsetKind := reflect.TypeOf(subset).Kind() - if listKind != reflect.Array && listKind != reflect.Slice && listKind != reflect.Map { return Fail(t, fmt.Sprintf("%q has an unsupported type %s", list, listKind), msgAndArgs...) } + subsetKind := reflect.TypeOf(subset).Kind() if subsetKind != reflect.Array && subsetKind != reflect.Slice && listKind != reflect.Map { return Fail(t, fmt.Sprintf("%q has an unsupported type %s", subset, subsetKind), msgAndArgs...) } - subsetValue := reflect.ValueOf(subset) if subsetKind == reflect.Map && listKind == reflect.Map { - listValue := reflect.ValueOf(list) - subsetKeys := subsetValue.MapKeys() + subsetMap := reflect.ValueOf(subset) + actualMap := reflect.ValueOf(list) - for i := 0; i < len(subsetKeys); i++ { - subsetKey := subsetKeys[i] - subsetElement := subsetValue.MapIndex(subsetKey).Interface() - listElement := listValue.MapIndex(subsetKey).Interface() + for _, k := range subsetMap.MapKeys() { + ev := subsetMap.MapIndex(k) + av := actualMap.MapIndex(k) - if !ObjectsAreEqual(subsetElement, listElement) { - return Fail(t, fmt.Sprintf("\"%s\" does not contain \"%s\"", list, subsetElement), msgAndArgs...) + if !av.IsValid() { + return Fail(t, fmt.Sprintf("%#v does not contain %#v", list, subset), msgAndArgs...) + } + if !ObjectsAreEqual(ev.Interface(), av.Interface()) { + return Fail(t, fmt.Sprintf("%#v does not contain %#v", list, subset), msgAndArgs...) } } return true } - for i := 0; i < subsetValue.Len(); i++ { - element := subsetValue.Index(i).Interface() + subsetList := reflect.ValueOf(subset) + for i := 0; i < subsetList.Len(); i++ { + element := subsetList.Index(i).Interface() ok, found := containsElement(list, element) if !ok { - return Fail(t, fmt.Sprintf("\"%s\" could not be applied builtin len()", list), msgAndArgs...) + return Fail(t, fmt.Sprintf("%#v could not be applied builtin len()", list), msgAndArgs...) } if !found { - return Fail(t, fmt.Sprintf("\"%s\" does not contain \"%s\"", list, element), msgAndArgs...) + return Fail(t, fmt.Sprintf("%#v does not contain %#v", list, element), msgAndArgs...) } } @@ -870,7 +978,7 @@ func Subset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) (ok // NotSubset asserts that the specified list(array, slice...) contains not all // elements given in the specified subset(array, slice...). // -// assert.NotSubset(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") +// assert.NotSubset(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") func NotSubset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) (ok bool) { if h, ok := t.(tHelper); ok { h.Helper() @@ -879,34 +987,28 @@ func NotSubset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) return Fail(t, "nil is the empty set which is a subset of every set", msgAndArgs...) } - defer func() { - if e := recover(); e != nil { - ok = false - } - }() - listKind := reflect.TypeOf(list).Kind() - subsetKind := reflect.TypeOf(subset).Kind() - if listKind != reflect.Array && listKind != reflect.Slice && listKind != reflect.Map { return Fail(t, fmt.Sprintf("%q has an unsupported type %s", list, listKind), msgAndArgs...) } + subsetKind := reflect.TypeOf(subset).Kind() if subsetKind != reflect.Array && subsetKind != reflect.Slice && listKind != reflect.Map { return Fail(t, fmt.Sprintf("%q has an unsupported type %s", subset, subsetKind), msgAndArgs...) } - subsetValue := reflect.ValueOf(subset) if subsetKind == reflect.Map && listKind == reflect.Map { - listValue := reflect.ValueOf(list) - subsetKeys := subsetValue.MapKeys() + subsetMap := reflect.ValueOf(subset) + actualMap := reflect.ValueOf(list) - for i := 0; i < len(subsetKeys); i++ { - subsetKey := subsetKeys[i] - subsetElement := subsetValue.MapIndex(subsetKey).Interface() - listElement := listValue.MapIndex(subsetKey).Interface() + for _, k := range subsetMap.MapKeys() { + ev := subsetMap.MapIndex(k) + av := actualMap.MapIndex(k) - if !ObjectsAreEqual(subsetElement, listElement) { + if !av.IsValid() { + return true + } + if !ObjectsAreEqual(ev.Interface(), av.Interface()) { return true } } @@ -914,8 +1016,9 @@ func NotSubset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) return Fail(t, fmt.Sprintf("%q is a subset of %q", subset, list), msgAndArgs...) } - for i := 0; i < subsetValue.Len(); i++ { - element := subsetValue.Index(i).Interface() + subsetList := reflect.ValueOf(subset) + for i := 0; i < subsetList.Len(); i++ { + element := subsetList.Index(i).Interface() ok, found := containsElement(list, element) if !ok { return Fail(t, fmt.Sprintf("\"%s\" could not be applied builtin len()", list), msgAndArgs...) @@ -1060,7 +1163,7 @@ func didPanic(f PanicTestFunc) (didPanic bool, message interface{}, stack string // Panics asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panics(t, func(){ GoCrazy() }) +// assert.Panics(t, func(){ GoCrazy() }) func Panics(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1076,7 +1179,7 @@ func Panics(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool { // PanicsWithValue asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) +// assert.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) func PanicsWithValue(t TestingT, expected interface{}, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1097,7 +1200,7 @@ func PanicsWithValue(t TestingT, expected interface{}, f PanicTestFunc, msgAndAr // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) +// assert.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) func PanicsWithError(t TestingT, errString string, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1117,7 +1220,7 @@ func PanicsWithError(t TestingT, errString string, f PanicTestFunc, msgAndArgs . // NotPanics asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanics(t, func(){ RemainCalm() }) +// assert.NotPanics(t, func(){ RemainCalm() }) func NotPanics(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1132,7 +1235,7 @@ func NotPanics(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool { // WithinDuration asserts that the two times are within duration delta of each other. // -// assert.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) +// assert.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) func WithinDuration(t TestingT, expected, actual time.Time, delta time.Duration, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1148,7 +1251,7 @@ func WithinDuration(t TestingT, expected, actual time.Time, delta time.Duration, // WithinRange asserts that a time is within a time range (inclusive). // -// assert.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) +// assert.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) func WithinRange(t TestingT, actual, start, end time.Time, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1207,7 +1310,7 @@ func toFloat(x interface{}) (float64, bool) { // InDelta asserts that the two numerals are within delta of each other. // -// assert.InDelta(t, math.Pi, 22/7.0, 0.01) +// assert.InDelta(t, math.Pi, 22/7.0, 0.01) func InDelta(t TestingT, expected, actual interface{}, delta float64, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1380,10 +1483,10 @@ func InEpsilonSlice(t TestingT, expected, actual interface{}, epsilon float64, m // NoError asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if assert.NoError(t, err) { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if assert.NoError(t, err) { +// assert.Equal(t, expectedObj, actualObj) +// } func NoError(t TestingT, err error, msgAndArgs ...interface{}) bool { if err != nil { if h, ok := t.(tHelper); ok { @@ -1397,10 +1500,10 @@ func NoError(t TestingT, err error, msgAndArgs ...interface{}) bool { // Error asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if assert.Error(t, err) { -// assert.Equal(t, expectedError, err) -// } +// actualObj, err := SomeFunction() +// if assert.Error(t, err) { +// assert.Equal(t, expectedError, err) +// } func Error(t TestingT, err error, msgAndArgs ...interface{}) bool { if err == nil { if h, ok := t.(tHelper); ok { @@ -1415,8 +1518,8 @@ func Error(t TestingT, err error, msgAndArgs ...interface{}) bool { // EqualError asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// assert.EqualError(t, err, expectedErrorString) +// actualObj, err := SomeFunction() +// assert.EqualError(t, err, expectedErrorString) func EqualError(t TestingT, theError error, errString string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1438,8 +1541,8 @@ func EqualError(t TestingT, theError error, errString string, msgAndArgs ...inte // ErrorContains asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// assert.ErrorContains(t, err, expectedErrorSubString) +// actualObj, err := SomeFunction() +// assert.ErrorContains(t, err, expectedErrorSubString) func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1472,8 +1575,8 @@ func matchRegexp(rx interface{}, str interface{}) bool { // Regexp asserts that a specified regexp matches a string. // -// assert.Regexp(t, regexp.MustCompile("start"), "it's starting") -// assert.Regexp(t, "start...$", "it's not starting") +// assert.Regexp(t, regexp.MustCompile("start"), "it's starting") +// assert.Regexp(t, "start...$", "it's not starting") func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1490,8 +1593,8 @@ func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface // NotRegexp asserts that a specified regexp does not match a string. // -// assert.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") -// assert.NotRegexp(t, "^start", "it's not starting") +// assert.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") +// assert.NotRegexp(t, "^start", "it's not starting") func NotRegexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1603,7 +1706,7 @@ func NoDirExists(t TestingT, path string, msgAndArgs ...interface{}) bool { // JSONEq asserts that two JSON strings are equivalent. // -// assert.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) +// assert.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) func JSONEq(t TestingT, expected string, actual string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1726,7 +1829,7 @@ type tHelper interface { // Eventually asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) +// assert.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1756,10 +1859,93 @@ func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick t } } +// CollectT implements the TestingT interface and collects all errors. +type CollectT struct { + errors []error +} + +// Errorf collects the error. +func (c *CollectT) Errorf(format string, args ...interface{}) { + c.errors = append(c.errors, fmt.Errorf(format, args...)) +} + +// FailNow panics. +func (c *CollectT) FailNow() { + panic("Assertion failed") +} + +// Reset clears the collected errors. +func (c *CollectT) Reset() { + c.errors = nil +} + +// Copy copies the collected errors to the supplied t. +func (c *CollectT) Copy(t TestingT) { + if tt, ok := t.(tHelper); ok { + tt.Helper() + } + for _, err := range c.errors { + t.Errorf("%v", err) + } +} + +// EventuallyWithT asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// assert.EventuallyWithT(t, func(c *assert.CollectT) { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +func EventuallyWithT(t TestingT, condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + + collect := new(CollectT) + ch := make(chan bool, 1) + + timer := time.NewTimer(waitFor) + defer timer.Stop() + + ticker := time.NewTicker(tick) + defer ticker.Stop() + + for tick := ticker.C; ; { + select { + case <-timer.C: + collect.Copy(t) + return Fail(t, "Condition never satisfied", msgAndArgs...) + case <-tick: + tick = nil + collect.Reset() + go func() { + condition(collect) + ch <- len(collect.errors) == 0 + }() + case v := <-ch: + if v { + return true + } + tick = ticker.C + } + } +} + // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) +// assert.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) func Never(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/assert/doc.go b/vendor/github.com/stretchr/testify/assert/doc.go index c9dccc4d6c..4953981d38 100644 --- a/vendor/github.com/stretchr/testify/assert/doc.go +++ b/vendor/github.com/stretchr/testify/assert/doc.go @@ -1,39 +1,40 @@ // Package assert provides a set of comprehensive testing tools for use with the normal Go testing system. // -// Example Usage +// # Example Usage // // The following is a complete example using assert in a standard test function: -// import ( -// "testing" -// "github.com/stretchr/testify/assert" -// ) // -// func TestSomething(t *testing.T) { +// import ( +// "testing" +// "github.com/stretchr/testify/assert" +// ) // -// var a string = "Hello" -// var b string = "Hello" +// func TestSomething(t *testing.T) { // -// assert.Equal(t, a, b, "The two words should be the same.") +// var a string = "Hello" +// var b string = "Hello" // -// } +// assert.Equal(t, a, b, "The two words should be the same.") +// +// } // // if you assert many times, use the format below: // -// import ( -// "testing" -// "github.com/stretchr/testify/assert" -// ) +// import ( +// "testing" +// "github.com/stretchr/testify/assert" +// ) // -// func TestSomething(t *testing.T) { -// assert := assert.New(t) +// func TestSomething(t *testing.T) { +// assert := assert.New(t) // -// var a string = "Hello" -// var b string = "Hello" +// var a string = "Hello" +// var b string = "Hello" // -// assert.Equal(a, b, "The two words should be the same.") -// } +// assert.Equal(a, b, "The two words should be the same.") +// } // -// Assertions +// # Assertions // // Assertions allow you to easily write test code, and are global funcs in the `assert` package. // All assertion functions take, as the first argument, the `*testing.T` object provided by the diff --git a/vendor/github.com/stretchr/testify/assert/http_assertions.go b/vendor/github.com/stretchr/testify/assert/http_assertions.go index 4ed341dd28..d8038c28a7 100644 --- a/vendor/github.com/stretchr/testify/assert/http_assertions.go +++ b/vendor/github.com/stretchr/testify/assert/http_assertions.go @@ -23,7 +23,7 @@ func httpCode(handler http.HandlerFunc, method, url string, values url.Values) ( // HTTPSuccess asserts that a specified handler returns a success status code. // -// assert.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) +// assert.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccess(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -45,7 +45,7 @@ func HTTPSuccess(t TestingT, handler http.HandlerFunc, method, url string, value // HTTPRedirect asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirect(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -67,7 +67,7 @@ func HTTPRedirect(t TestingT, handler http.HandlerFunc, method, url string, valu // HTTPError asserts that a specified handler returns an error status code. // -// assert.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPError(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -89,7 +89,7 @@ func HTTPError(t TestingT, handler http.HandlerFunc, method, url string, values // HTTPStatusCode asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) +// assert.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, statuscode int, msgAndArgs ...interface{}) bool { @@ -124,7 +124,7 @@ func HTTPBody(handler http.HandlerFunc, method, url string, values url.Values) s // HTTPBodyContains asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// assert.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) bool { @@ -144,7 +144,7 @@ func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method, url string, // HTTPBodyNotContains asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// assert.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContains(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) bool { diff --git a/vendor/github.com/stretchr/testify/require/doc.go b/vendor/github.com/stretchr/testify/require/doc.go index 169de39221..9684347245 100644 --- a/vendor/github.com/stretchr/testify/require/doc.go +++ b/vendor/github.com/stretchr/testify/require/doc.go @@ -1,24 +1,25 @@ // Package require implements the same assertions as the `assert` package but // stops test execution when a test fails. // -// Example Usage +// # Example Usage // // The following is a complete example using require in a standard test function: -// import ( -// "testing" -// "github.com/stretchr/testify/require" -// ) // -// func TestSomething(t *testing.T) { +// import ( +// "testing" +// "github.com/stretchr/testify/require" +// ) // -// var a string = "Hello" -// var b string = "Hello" +// func TestSomething(t *testing.T) { // -// require.Equal(t, a, b, "The two words should be the same.") +// var a string = "Hello" +// var b string = "Hello" // -// } +// require.Equal(t, a, b, "The two words should be the same.") // -// Assertions +// } +// +// # Assertions // // The `require` package have same global functions as in the `assert` package, // but instead of returning a boolean result they call `t.FailNow()`. diff --git a/vendor/github.com/stretchr/testify/require/require.go b/vendor/github.com/stretchr/testify/require/require.go index 880853f5a2..63f8521476 100644 --- a/vendor/github.com/stretchr/testify/require/require.go +++ b/vendor/github.com/stretchr/testify/require/require.go @@ -37,9 +37,9 @@ func Conditionf(t TestingT, comp assert.Comparison, msg string, args ...interfac // Contains asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Contains(t, "Hello World", "World") -// assert.Contains(t, ["Hello", "World"], "World") -// assert.Contains(t, {"Hello": "World"}, "Hello") +// assert.Contains(t, "Hello World", "World") +// assert.Contains(t, ["Hello", "World"], "World") +// assert.Contains(t, {"Hello": "World"}, "Hello") func Contains(t TestingT, s interface{}, contains interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -53,9 +53,9 @@ func Contains(t TestingT, s interface{}, contains interface{}, msgAndArgs ...int // Containsf asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Containsf(t, "Hello World", "World", "error message %s", "formatted") -// assert.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") -// assert.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") +// assert.Containsf(t, "Hello World", "World", "error message %s", "formatted") +// assert.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") +// assert.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") func Containsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -123,7 +123,7 @@ func ElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string // Empty asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Empty(t, obj) +// assert.Empty(t, obj) func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -137,7 +137,7 @@ func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) { // Emptyf asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Emptyf(t, obj, "error message %s", "formatted") +// assert.Emptyf(t, obj, "error message %s", "formatted") func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -150,7 +150,7 @@ func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) { // Equal asserts that two objects are equal. // -// assert.Equal(t, 123, 123) +// assert.Equal(t, 123, 123) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -168,8 +168,8 @@ func Equal(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...i // EqualError asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// assert.EqualError(t, err, expectedErrorString) +// actualObj, err := SomeFunction() +// assert.EqualError(t, err, expectedErrorString) func EqualError(t TestingT, theError error, errString string, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -183,8 +183,8 @@ func EqualError(t TestingT, theError error, errString string, msgAndArgs ...inte // EqualErrorf asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// assert.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// assert.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") func EqualErrorf(t TestingT, theError error, errString string, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -195,10 +195,50 @@ func EqualErrorf(t TestingT, theError error, errString string, msg string, args t.FailNow() } +// EqualExportedValues asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// assert.EqualExportedValues(t, S{1, 2}, S{1, 3}) => true +// assert.EqualExportedValues(t, S{1, 2}, S{2, 3}) => false +func EqualExportedValues(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.EqualExportedValues(t, expected, actual, msgAndArgs...) { + return + } + t.FailNow() +} + +// EqualExportedValuesf asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// assert.EqualExportedValuesf(t, S{1, 2}, S{1, 3}, "error message %s", "formatted") => true +// assert.EqualExportedValuesf(t, S{1, 2}, S{2, 3}, "error message %s", "formatted") => false +func EqualExportedValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.EqualExportedValuesf(t, expected, actual, msg, args...) { + return + } + t.FailNow() +} + // EqualValues asserts that two objects are equal or convertable to the same types // and equal. // -// assert.EqualValues(t, uint32(123), int32(123)) +// assert.EqualValues(t, uint32(123), int32(123)) func EqualValues(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -212,7 +252,7 @@ func EqualValues(t TestingT, expected interface{}, actual interface{}, msgAndArg // EqualValuesf asserts that two objects are equal or convertable to the same types // and equal. // -// assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") +// assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -225,7 +265,7 @@ func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg stri // Equalf asserts that two objects are equal. // -// assert.Equalf(t, 123, 123, "error message %s", "formatted") +// assert.Equalf(t, 123, 123, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -242,10 +282,10 @@ func Equalf(t TestingT, expected interface{}, actual interface{}, msg string, ar // Error asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if assert.Error(t, err) { -// assert.Equal(t, expectedError, err) -// } +// actualObj, err := SomeFunction() +// if assert.Error(t, err) { +// assert.Equal(t, expectedError, err) +// } func Error(t TestingT, err error, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -283,8 +323,8 @@ func ErrorAsf(t TestingT, err error, target interface{}, msg string, args ...int // ErrorContains asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// assert.ErrorContains(t, err, expectedErrorSubString) +// actualObj, err := SomeFunction() +// assert.ErrorContains(t, err, expectedErrorSubString) func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -298,8 +338,8 @@ func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...in // ErrorContainsf asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// assert.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// assert.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") func ErrorContainsf(t TestingT, theError error, contains string, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -336,10 +376,10 @@ func ErrorIsf(t TestingT, err error, target error, msg string, args ...interface // Errorf asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if assert.Errorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedErrorf, err) -// } +// actualObj, err := SomeFunction() +// if assert.Errorf(t, err, "error message %s", "formatted") { +// assert.Equal(t, expectedErrorf, err) +// } func Errorf(t TestingT, err error, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -353,7 +393,7 @@ func Errorf(t TestingT, err error, msg string, args ...interface{}) { // Eventually asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) +// assert.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -364,10 +404,66 @@ func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick t t.FailNow() } +// EventuallyWithT asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// assert.EventuallyWithT(t, func(c *assert.CollectT) { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +func EventuallyWithT(t TestingT, condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.EventuallyWithT(t, condition, waitFor, tick, msgAndArgs...) { + return + } + t.FailNow() +} + +// EventuallyWithTf asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// assert.EventuallyWithTf(t, func(c *assert.CollectT, "error message %s", "formatted") { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +func EventuallyWithTf(t TestingT, condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.EventuallyWithTf(t, condition, waitFor, tick, msg, args...) { + return + } + t.FailNow() +} + // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// assert.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -380,7 +476,7 @@ func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick // Exactly asserts that two objects are equal in value and type. // -// assert.Exactly(t, int32(123), int64(123)) +// assert.Exactly(t, int32(123), int64(123)) func Exactly(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -393,7 +489,7 @@ func Exactly(t TestingT, expected interface{}, actual interface{}, msgAndArgs .. // Exactlyf asserts that two objects are equal in value and type. // -// assert.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") +// assert.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") func Exactlyf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -450,7 +546,7 @@ func Failf(t TestingT, failureMessage string, msg string, args ...interface{}) { // False asserts that the specified value is false. // -// assert.False(t, myBool) +// assert.False(t, myBool) func False(t TestingT, value bool, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -463,7 +559,7 @@ func False(t TestingT, value bool, msgAndArgs ...interface{}) { // Falsef asserts that the specified value is false. // -// assert.Falsef(t, myBool, "error message %s", "formatted") +// assert.Falsef(t, myBool, "error message %s", "formatted") func Falsef(t TestingT, value bool, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -500,9 +596,9 @@ func FileExistsf(t TestingT, path string, msg string, args ...interface{}) { // Greater asserts that the first element is greater than the second // -// assert.Greater(t, 2, 1) -// assert.Greater(t, float64(2), float64(1)) -// assert.Greater(t, "b", "a") +// assert.Greater(t, 2, 1) +// assert.Greater(t, float64(2), float64(1)) +// assert.Greater(t, "b", "a") func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -515,10 +611,10 @@ func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface // GreaterOrEqual asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqual(t, 2, 1) -// assert.GreaterOrEqual(t, 2, 2) -// assert.GreaterOrEqual(t, "b", "a") -// assert.GreaterOrEqual(t, "b", "b") +// assert.GreaterOrEqual(t, 2, 1) +// assert.GreaterOrEqual(t, 2, 2) +// assert.GreaterOrEqual(t, "b", "a") +// assert.GreaterOrEqual(t, "b", "b") func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -531,10 +627,10 @@ func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...in // GreaterOrEqualf asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") +// assert.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") +// assert.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") +// assert.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") +// assert.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -547,9 +643,9 @@ func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, arg // Greaterf asserts that the first element is greater than the second // -// assert.Greaterf(t, 2, 1, "error message %s", "formatted") -// assert.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") -// assert.Greaterf(t, "b", "a", "error message %s", "formatted") +// assert.Greaterf(t, 2, 1, "error message %s", "formatted") +// assert.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") +// assert.Greaterf(t, "b", "a", "error message %s", "formatted") func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -563,7 +659,7 @@ func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...in // HTTPBodyContains asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// assert.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) { @@ -579,7 +675,7 @@ func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method string, url s // HTTPBodyContainsf asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// assert.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) { @@ -595,7 +691,7 @@ func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url // HTTPBodyNotContains asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// assert.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContains(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) { @@ -611,7 +707,7 @@ func HTTPBodyNotContains(t TestingT, handler http.HandlerFunc, method string, ur // HTTPBodyNotContainsf asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// assert.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) { @@ -626,7 +722,7 @@ func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, u // HTTPError asserts that a specified handler returns an error status code. // -// assert.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPError(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -641,7 +737,7 @@ func HTTPError(t TestingT, handler http.HandlerFunc, method string, url string, // HTTPErrorf asserts that a specified handler returns an error status code. // -// assert.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -656,7 +752,7 @@ func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, // HTTPRedirect asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirect(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -671,7 +767,7 @@ func HTTPRedirect(t TestingT, handler http.HandlerFunc, method string, url strin // HTTPRedirectf asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -686,7 +782,7 @@ func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url stri // HTTPStatusCode asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) +// assert.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msgAndArgs ...interface{}) { @@ -701,7 +797,7 @@ func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method string, url str // HTTPStatusCodef asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") +// assert.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msg string, args ...interface{}) { @@ -716,7 +812,7 @@ func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url st // HTTPSuccess asserts that a specified handler returns a success status code. // -// assert.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) +// assert.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccess(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -731,7 +827,7 @@ func HTTPSuccess(t TestingT, handler http.HandlerFunc, method string, url string // HTTPSuccessf asserts that a specified handler returns a success status code. // -// assert.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") +// assert.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -746,7 +842,7 @@ func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url strin // Implements asserts that an object is implemented by the specified interface. // -// assert.Implements(t, (*MyInterface)(nil), new(MyObject)) +// assert.Implements(t, (*MyInterface)(nil), new(MyObject)) func Implements(t TestingT, interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -759,7 +855,7 @@ func Implements(t TestingT, interfaceObject interface{}, object interface{}, msg // Implementsf asserts that an object is implemented by the specified interface. // -// assert.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// assert.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -772,7 +868,7 @@ func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, ms // InDelta asserts that the two numerals are within delta of each other. // -// assert.InDelta(t, math.Pi, 22/7.0, 0.01) +// assert.InDelta(t, math.Pi, 22/7.0, 0.01) func InDelta(t TestingT, expected interface{}, actual interface{}, delta float64, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -829,7 +925,7 @@ func InDeltaSlicef(t TestingT, expected interface{}, actual interface{}, delta f // InDeltaf asserts that the two numerals are within delta of each other. // -// assert.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") +// assert.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") func InDeltaf(t TestingT, expected interface{}, actual interface{}, delta float64, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -886,9 +982,9 @@ func InEpsilonf(t TestingT, expected interface{}, actual interface{}, epsilon fl // IsDecreasing asserts that the collection is decreasing // -// assert.IsDecreasing(t, []int{2, 1, 0}) -// assert.IsDecreasing(t, []float{2, 1}) -// assert.IsDecreasing(t, []string{"b", "a"}) +// assert.IsDecreasing(t, []int{2, 1, 0}) +// assert.IsDecreasing(t, []float{2, 1}) +// assert.IsDecreasing(t, []string{"b", "a"}) func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -901,9 +997,9 @@ func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { // IsDecreasingf asserts that the collection is decreasing // -// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -916,9 +1012,9 @@ func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface // IsIncreasing asserts that the collection is increasing // -// assert.IsIncreasing(t, []int{1, 2, 3}) -// assert.IsIncreasing(t, []float{1, 2}) -// assert.IsIncreasing(t, []string{"a", "b"}) +// assert.IsIncreasing(t, []int{1, 2, 3}) +// assert.IsIncreasing(t, []float{1, 2}) +// assert.IsIncreasing(t, []string{"a", "b"}) func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -931,9 +1027,9 @@ func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { // IsIncreasingf asserts that the collection is increasing // -// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -946,9 +1042,9 @@ func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface // IsNonDecreasing asserts that the collection is not decreasing // -// assert.IsNonDecreasing(t, []int{1, 1, 2}) -// assert.IsNonDecreasing(t, []float{1, 2}) -// assert.IsNonDecreasing(t, []string{"a", "b"}) +// assert.IsNonDecreasing(t, []int{1, 1, 2}) +// assert.IsNonDecreasing(t, []float{1, 2}) +// assert.IsNonDecreasing(t, []string{"a", "b"}) func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -961,9 +1057,9 @@ func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) // IsNonDecreasingf asserts that the collection is not decreasing // -// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -976,9 +1072,9 @@ func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interf // IsNonIncreasing asserts that the collection is not increasing // -// assert.IsNonIncreasing(t, []int{2, 1, 1}) -// assert.IsNonIncreasing(t, []float{2, 1}) -// assert.IsNonIncreasing(t, []string{"b", "a"}) +// assert.IsNonIncreasing(t, []int{2, 1, 1}) +// assert.IsNonIncreasing(t, []float{2, 1}) +// assert.IsNonIncreasing(t, []string{"b", "a"}) func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -991,9 +1087,9 @@ func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) // IsNonIncreasingf asserts that the collection is not increasing // -// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsNonIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1028,7 +1124,7 @@ func IsTypef(t TestingT, expectedType interface{}, object interface{}, msg strin // JSONEq asserts that two JSON strings are equivalent. // -// assert.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) +// assert.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) func JSONEq(t TestingT, expected string, actual string, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1041,7 +1137,7 @@ func JSONEq(t TestingT, expected string, actual string, msgAndArgs ...interface{ // JSONEqf asserts that two JSON strings are equivalent. // -// assert.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") +// assert.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") func JSONEqf(t TestingT, expected string, actual string, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1055,7 +1151,7 @@ func JSONEqf(t TestingT, expected string, actual string, msg string, args ...int // Len asserts that the specified object has specific length. // Len also fails if the object has a type that len() not accept. // -// assert.Len(t, mySlice, 3) +// assert.Len(t, mySlice, 3) func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1069,7 +1165,7 @@ func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) // Lenf asserts that the specified object has specific length. // Lenf also fails if the object has a type that len() not accept. // -// assert.Lenf(t, mySlice, 3, "error message %s", "formatted") +// assert.Lenf(t, mySlice, 3, "error message %s", "formatted") func Lenf(t TestingT, object interface{}, length int, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1082,9 +1178,9 @@ func Lenf(t TestingT, object interface{}, length int, msg string, args ...interf // Less asserts that the first element is less than the second // -// assert.Less(t, 1, 2) -// assert.Less(t, float64(1), float64(2)) -// assert.Less(t, "a", "b") +// assert.Less(t, 1, 2) +// assert.Less(t, float64(1), float64(2)) +// assert.Less(t, "a", "b") func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1097,10 +1193,10 @@ func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) // LessOrEqual asserts that the first element is less than or equal to the second // -// assert.LessOrEqual(t, 1, 2) -// assert.LessOrEqual(t, 2, 2) -// assert.LessOrEqual(t, "a", "b") -// assert.LessOrEqual(t, "b", "b") +// assert.LessOrEqual(t, 1, 2) +// assert.LessOrEqual(t, 2, 2) +// assert.LessOrEqual(t, "a", "b") +// assert.LessOrEqual(t, "b", "b") func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1113,10 +1209,10 @@ func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...inter // LessOrEqualf asserts that the first element is less than or equal to the second // -// assert.LessOrEqualf(t, 1, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, "a", "b", "error message %s", "formatted") -// assert.LessOrEqualf(t, "b", "b", "error message %s", "formatted") +// assert.LessOrEqualf(t, 1, 2, "error message %s", "formatted") +// assert.LessOrEqualf(t, 2, 2, "error message %s", "formatted") +// assert.LessOrEqualf(t, "a", "b", "error message %s", "formatted") +// assert.LessOrEqualf(t, "b", "b", "error message %s", "formatted") func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1129,9 +1225,9 @@ func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args . // Lessf asserts that the first element is less than the second // -// assert.Lessf(t, 1, 2, "error message %s", "formatted") -// assert.Lessf(t, float64(1), float64(2), "error message %s", "formatted") -// assert.Lessf(t, "a", "b", "error message %s", "formatted") +// assert.Lessf(t, 1, 2, "error message %s", "formatted") +// assert.Lessf(t, float64(1), float64(2), "error message %s", "formatted") +// assert.Lessf(t, "a", "b", "error message %s", "formatted") func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1144,8 +1240,8 @@ func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...inter // Negative asserts that the specified element is negative // -// assert.Negative(t, -1) -// assert.Negative(t, -1.23) +// assert.Negative(t, -1) +// assert.Negative(t, -1.23) func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1158,8 +1254,8 @@ func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) { // Negativef asserts that the specified element is negative // -// assert.Negativef(t, -1, "error message %s", "formatted") -// assert.Negativef(t, -1.23, "error message %s", "formatted") +// assert.Negativef(t, -1, "error message %s", "formatted") +// assert.Negativef(t, -1.23, "error message %s", "formatted") func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1173,7 +1269,7 @@ func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) { // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) +// assert.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) func Never(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1187,7 +1283,7 @@ func Never(t TestingT, condition func() bool, waitFor time.Duration, tick time.D // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// assert.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1200,7 +1296,7 @@ func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time. // Nil asserts that the specified object is nil. // -// assert.Nil(t, err) +// assert.Nil(t, err) func Nil(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1213,7 +1309,7 @@ func Nil(t TestingT, object interface{}, msgAndArgs ...interface{}) { // Nilf asserts that the specified object is nil. // -// assert.Nilf(t, err, "error message %s", "formatted") +// assert.Nilf(t, err, "error message %s", "formatted") func Nilf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1250,10 +1346,10 @@ func NoDirExistsf(t TestingT, path string, msg string, args ...interface{}) { // NoError asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if assert.NoError(t, err) { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if assert.NoError(t, err) { +// assert.Equal(t, expectedObj, actualObj) +// } func NoError(t TestingT, err error, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1266,10 +1362,10 @@ func NoError(t TestingT, err error, msgAndArgs ...interface{}) { // NoErrorf asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if assert.NoErrorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if assert.NoErrorf(t, err, "error message %s", "formatted") { +// assert.Equal(t, expectedObj, actualObj) +// } func NoErrorf(t TestingT, err error, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1307,9 +1403,9 @@ func NoFileExistsf(t TestingT, path string, msg string, args ...interface{}) { // NotContains asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContains(t, "Hello World", "Earth") -// assert.NotContains(t, ["Hello", "World"], "Earth") -// assert.NotContains(t, {"Hello": "World"}, "Earth") +// assert.NotContains(t, "Hello World", "Earth") +// assert.NotContains(t, ["Hello", "World"], "Earth") +// assert.NotContains(t, {"Hello": "World"}, "Earth") func NotContains(t TestingT, s interface{}, contains interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1323,9 +1419,9 @@ func NotContains(t TestingT, s interface{}, contains interface{}, msgAndArgs ... // NotContainsf asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") +// assert.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") +// assert.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") +// assert.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1339,9 +1435,9 @@ func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, a // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmpty(t, obj) { -// assert.Equal(t, "two", obj[1]) -// } +// if assert.NotEmpty(t, obj) { +// assert.Equal(t, "two", obj[1]) +// } func NotEmpty(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1355,9 +1451,9 @@ func NotEmpty(t TestingT, object interface{}, msgAndArgs ...interface{}) { // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmptyf(t, obj, "error message %s", "formatted") { -// assert.Equal(t, "two", obj[1]) -// } +// if assert.NotEmptyf(t, obj, "error message %s", "formatted") { +// assert.Equal(t, "two", obj[1]) +// } func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1370,7 +1466,7 @@ func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) // NotEqual asserts that the specified values are NOT equal. // -// assert.NotEqual(t, obj1, obj2) +// assert.NotEqual(t, obj1, obj2) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1386,7 +1482,7 @@ func NotEqual(t TestingT, expected interface{}, actual interface{}, msgAndArgs . // NotEqualValues asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValues(t, obj1, obj2) +// assert.NotEqualValues(t, obj1, obj2) func NotEqualValues(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1399,7 +1495,7 @@ func NotEqualValues(t TestingT, expected interface{}, actual interface{}, msgAnd // NotEqualValuesf asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") +// assert.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1412,7 +1508,7 @@ func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg s // NotEqualf asserts that the specified values are NOT equal. // -// assert.NotEqualf(t, obj1, obj2, "error message %s", "formatted") +// assert.NotEqualf(t, obj1, obj2, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1452,7 +1548,7 @@ func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interf // NotNil asserts that the specified object is not nil. // -// assert.NotNil(t, err) +// assert.NotNil(t, err) func NotNil(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1465,7 +1561,7 @@ func NotNil(t TestingT, object interface{}, msgAndArgs ...interface{}) { // NotNilf asserts that the specified object is not nil. // -// assert.NotNilf(t, err, "error message %s", "formatted") +// assert.NotNilf(t, err, "error message %s", "formatted") func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1478,7 +1574,7 @@ func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) { // NotPanics asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanics(t, func(){ RemainCalm() }) +// assert.NotPanics(t, func(){ RemainCalm() }) func NotPanics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1491,7 +1587,7 @@ func NotPanics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { // NotPanicsf asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") +// assert.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") func NotPanicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1504,8 +1600,8 @@ func NotPanicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interfac // NotRegexp asserts that a specified regexp does not match a string. // -// assert.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") -// assert.NotRegexp(t, "^start", "it's not starting") +// assert.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") +// assert.NotRegexp(t, "^start", "it's not starting") func NotRegexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1518,8 +1614,8 @@ func NotRegexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interf // NotRegexpf asserts that a specified regexp does not match a string. // -// assert.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") -// assert.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") +// assert.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") +// assert.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1532,7 +1628,7 @@ func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args .. // NotSame asserts that two pointers do not reference the same object. // -// assert.NotSame(t, ptr1, ptr2) +// assert.NotSame(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1548,7 +1644,7 @@ func NotSame(t TestingT, expected interface{}, actual interface{}, msgAndArgs .. // NotSamef asserts that two pointers do not reference the same object. // -// assert.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") +// assert.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1565,7 +1661,7 @@ func NotSamef(t TestingT, expected interface{}, actual interface{}, msg string, // NotSubset asserts that the specified list(array, slice...) contains not all // elements given in the specified subset(array, slice...). // -// assert.NotSubset(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") +// assert.NotSubset(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") func NotSubset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1579,7 +1675,7 @@ func NotSubset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...i // NotSubsetf asserts that the specified list(array, slice...) contains not all // elements given in the specified subset(array, slice...). // -// assert.NotSubsetf(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") +// assert.NotSubsetf(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") func NotSubsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1614,7 +1710,7 @@ func NotZerof(t TestingT, i interface{}, msg string, args ...interface{}) { // Panics asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panics(t, func(){ GoCrazy() }) +// assert.Panics(t, func(){ GoCrazy() }) func Panics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1629,7 +1725,7 @@ func Panics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) +// assert.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) func PanicsWithError(t TestingT, errString string, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1644,7 +1740,7 @@ func PanicsWithError(t TestingT, errString string, f assert.PanicTestFunc, msgAn // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// assert.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithErrorf(t TestingT, errString string, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1658,7 +1754,7 @@ func PanicsWithErrorf(t TestingT, errString string, f assert.PanicTestFunc, msg // PanicsWithValue asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) +// assert.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) func PanicsWithValue(t TestingT, expected interface{}, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1672,7 +1768,7 @@ func PanicsWithValue(t TestingT, expected interface{}, f assert.PanicTestFunc, m // PanicsWithValuef asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// assert.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithValuef(t TestingT, expected interface{}, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1685,7 +1781,7 @@ func PanicsWithValuef(t TestingT, expected interface{}, f assert.PanicTestFunc, // Panicsf asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") +// assert.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") func Panicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1698,8 +1794,8 @@ func Panicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{} // Positive asserts that the specified element is positive // -// assert.Positive(t, 1) -// assert.Positive(t, 1.23) +// assert.Positive(t, 1) +// assert.Positive(t, 1.23) func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1712,8 +1808,8 @@ func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) { // Positivef asserts that the specified element is positive // -// assert.Positivef(t, 1, "error message %s", "formatted") -// assert.Positivef(t, 1.23, "error message %s", "formatted") +// assert.Positivef(t, 1, "error message %s", "formatted") +// assert.Positivef(t, 1.23, "error message %s", "formatted") func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1726,8 +1822,8 @@ func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) { // Regexp asserts that a specified regexp matches a string. // -// assert.Regexp(t, regexp.MustCompile("start"), "it's starting") -// assert.Regexp(t, "start...$", "it's not starting") +// assert.Regexp(t, regexp.MustCompile("start"), "it's starting") +// assert.Regexp(t, "start...$", "it's not starting") func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1740,8 +1836,8 @@ func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface // Regexpf asserts that a specified regexp matches a string. // -// assert.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") -// assert.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") +// assert.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") +// assert.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1754,7 +1850,7 @@ func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...in // Same asserts that two pointers reference the same object. // -// assert.Same(t, ptr1, ptr2) +// assert.Same(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1770,7 +1866,7 @@ func Same(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...in // Samef asserts that two pointers reference the same object. // -// assert.Samef(t, ptr1, ptr2, "error message %s", "formatted") +// assert.Samef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1787,7 +1883,7 @@ func Samef(t TestingT, expected interface{}, actual interface{}, msg string, arg // Subset asserts that the specified list(array, slice...) contains all // elements given in the specified subset(array, slice...). // -// assert.Subset(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") +// assert.Subset(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") func Subset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1801,7 +1897,7 @@ func Subset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...inte // Subsetf asserts that the specified list(array, slice...) contains all // elements given in the specified subset(array, slice...). // -// assert.Subsetf(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") +// assert.Subsetf(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1814,7 +1910,7 @@ func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args // True asserts that the specified value is true. // -// assert.True(t, myBool) +// assert.True(t, myBool) func True(t TestingT, value bool, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1827,7 +1923,7 @@ func True(t TestingT, value bool, msgAndArgs ...interface{}) { // Truef asserts that the specified value is true. // -// assert.Truef(t, myBool, "error message %s", "formatted") +// assert.Truef(t, myBool, "error message %s", "formatted") func Truef(t TestingT, value bool, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1840,7 +1936,7 @@ func Truef(t TestingT, value bool, msg string, args ...interface{}) { // WithinDuration asserts that the two times are within duration delta of each other. // -// assert.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) +// assert.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) func WithinDuration(t TestingT, expected time.Time, actual time.Time, delta time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1853,7 +1949,7 @@ func WithinDuration(t TestingT, expected time.Time, actual time.Time, delta time // WithinDurationf asserts that the two times are within duration delta of each other. // -// assert.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") +// assert.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1866,7 +1962,7 @@ func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta tim // WithinRange asserts that a time is within a time range (inclusive). // -// assert.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) +// assert.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) func WithinRange(t TestingT, actual time.Time, start time.Time, end time.Time, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1879,7 +1975,7 @@ func WithinRange(t TestingT, actual time.Time, start time.Time, end time.Time, m // WithinRangef asserts that a time is within a time range (inclusive). // -// assert.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") +// assert.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") func WithinRangef(t TestingT, actual time.Time, start time.Time, end time.Time, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/require/require_forward.go b/vendor/github.com/stretchr/testify/require/require_forward.go index 960bf6f2ca..3b5b09330a 100644 --- a/vendor/github.com/stretchr/testify/require/require_forward.go +++ b/vendor/github.com/stretchr/testify/require/require_forward.go @@ -31,9 +31,9 @@ func (a *Assertions) Conditionf(comp assert.Comparison, msg string, args ...inte // Contains asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// a.Contains("Hello World", "World") -// a.Contains(["Hello", "World"], "World") -// a.Contains({"Hello": "World"}, "Hello") +// a.Contains("Hello World", "World") +// a.Contains(["Hello", "World"], "World") +// a.Contains({"Hello": "World"}, "Hello") func (a *Assertions) Contains(s interface{}, contains interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -44,9 +44,9 @@ func (a *Assertions) Contains(s interface{}, contains interface{}, msgAndArgs .. // Containsf asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// a.Containsf("Hello World", "World", "error message %s", "formatted") -// a.Containsf(["Hello", "World"], "World", "error message %s", "formatted") -// a.Containsf({"Hello": "World"}, "Hello", "error message %s", "formatted") +// a.Containsf("Hello World", "World", "error message %s", "formatted") +// a.Containsf(["Hello", "World"], "World", "error message %s", "formatted") +// a.Containsf({"Hello": "World"}, "Hello", "error message %s", "formatted") func (a *Assertions) Containsf(s interface{}, contains interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -99,7 +99,7 @@ func (a *Assertions) ElementsMatchf(listA interface{}, listB interface{}, msg st // Empty asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// a.Empty(obj) +// a.Empty(obj) func (a *Assertions) Empty(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -110,7 +110,7 @@ func (a *Assertions) Empty(object interface{}, msgAndArgs ...interface{}) { // Emptyf asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// a.Emptyf(obj, "error message %s", "formatted") +// a.Emptyf(obj, "error message %s", "formatted") func (a *Assertions) Emptyf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -120,7 +120,7 @@ func (a *Assertions) Emptyf(object interface{}, msg string, args ...interface{}) // Equal asserts that two objects are equal. // -// a.Equal(123, 123) +// a.Equal(123, 123) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -135,8 +135,8 @@ func (a *Assertions) Equal(expected interface{}, actual interface{}, msgAndArgs // EqualError asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// a.EqualError(err, expectedErrorString) +// actualObj, err := SomeFunction() +// a.EqualError(err, expectedErrorString) func (a *Assertions) EqualError(theError error, errString string, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -147,8 +147,8 @@ func (a *Assertions) EqualError(theError error, errString string, msgAndArgs ... // EqualErrorf asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// a.EqualErrorf(err, expectedErrorString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// a.EqualErrorf(err, expectedErrorString, "error message %s", "formatted") func (a *Assertions) EqualErrorf(theError error, errString string, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -156,10 +156,44 @@ func (a *Assertions) EqualErrorf(theError error, errString string, msg string, a EqualErrorf(a.t, theError, errString, msg, args...) } +// EqualExportedValues asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// a.EqualExportedValues(S{1, 2}, S{1, 3}) => true +// a.EqualExportedValues(S{1, 2}, S{2, 3}) => false +func (a *Assertions) EqualExportedValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + EqualExportedValues(a.t, expected, actual, msgAndArgs...) +} + +// EqualExportedValuesf asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// a.EqualExportedValuesf(S{1, 2}, S{1, 3}, "error message %s", "formatted") => true +// a.EqualExportedValuesf(S{1, 2}, S{2, 3}, "error message %s", "formatted") => false +func (a *Assertions) EqualExportedValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + EqualExportedValuesf(a.t, expected, actual, msg, args...) +} + // EqualValues asserts that two objects are equal or convertable to the same types // and equal. // -// a.EqualValues(uint32(123), int32(123)) +// a.EqualValues(uint32(123), int32(123)) func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -170,7 +204,7 @@ func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAn // EqualValuesf asserts that two objects are equal or convertable to the same types // and equal. // -// a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") +// a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -180,7 +214,7 @@ func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg // Equalf asserts that two objects are equal. // -// a.Equalf(123, 123, "error message %s", "formatted") +// a.Equalf(123, 123, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -194,10 +228,10 @@ func (a *Assertions) Equalf(expected interface{}, actual interface{}, msg string // Error asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if a.Error(err) { -// assert.Equal(t, expectedError, err) -// } +// actualObj, err := SomeFunction() +// if a.Error(err) { +// assert.Equal(t, expectedError, err) +// } func (a *Assertions) Error(err error, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -226,8 +260,8 @@ func (a *Assertions) ErrorAsf(err error, target interface{}, msg string, args .. // ErrorContains asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// a.ErrorContains(err, expectedErrorSubString) +// actualObj, err := SomeFunction() +// a.ErrorContains(err, expectedErrorSubString) func (a *Assertions) ErrorContains(theError error, contains string, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -238,8 +272,8 @@ func (a *Assertions) ErrorContains(theError error, contains string, msgAndArgs . // ErrorContainsf asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// a.ErrorContainsf(err, expectedErrorSubString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// a.ErrorContainsf(err, expectedErrorSubString, "error message %s", "formatted") func (a *Assertions) ErrorContainsf(theError error, contains string, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -267,10 +301,10 @@ func (a *Assertions) ErrorIsf(err error, target error, msg string, args ...inter // Errorf asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if a.Errorf(err, "error message %s", "formatted") { -// assert.Equal(t, expectedErrorf, err) -// } +// actualObj, err := SomeFunction() +// if a.Errorf(err, "error message %s", "formatted") { +// assert.Equal(t, expectedErrorf, err) +// } func (a *Assertions) Errorf(err error, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -281,7 +315,7 @@ func (a *Assertions) Errorf(err error, msg string, args ...interface{}) { // Eventually asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// a.Eventually(func() bool { return true; }, time.Second, 10*time.Millisecond) +// a.Eventually(func() bool { return true; }, time.Second, 10*time.Millisecond) func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -289,10 +323,60 @@ func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, ti Eventually(a.t, condition, waitFor, tick, msgAndArgs...) } +// EventuallyWithT asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// a.EventuallyWithT(func(c *assert.CollectT) { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +func (a *Assertions) EventuallyWithT(condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + EventuallyWithT(a.t, condition, waitFor, tick, msgAndArgs...) +} + +// EventuallyWithTf asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// a.EventuallyWithTf(func(c *assert.CollectT, "error message %s", "formatted") { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +func (a *Assertions) EventuallyWithTf(condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + EventuallyWithTf(a.t, condition, waitFor, tick, msg, args...) +} + // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// a.Eventuallyf(func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// a.Eventuallyf(func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func (a *Assertions) Eventuallyf(condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -302,7 +386,7 @@ func (a *Assertions) Eventuallyf(condition func() bool, waitFor time.Duration, t // Exactly asserts that two objects are equal in value and type. // -// a.Exactly(int32(123), int64(123)) +// a.Exactly(int32(123), int64(123)) func (a *Assertions) Exactly(expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -312,7 +396,7 @@ func (a *Assertions) Exactly(expected interface{}, actual interface{}, msgAndArg // Exactlyf asserts that two objects are equal in value and type. // -// a.Exactlyf(int32(123), int64(123), "error message %s", "formatted") +// a.Exactlyf(int32(123), int64(123), "error message %s", "formatted") func (a *Assertions) Exactlyf(expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -354,7 +438,7 @@ func (a *Assertions) Failf(failureMessage string, msg string, args ...interface{ // False asserts that the specified value is false. // -// a.False(myBool) +// a.False(myBool) func (a *Assertions) False(value bool, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -364,7 +448,7 @@ func (a *Assertions) False(value bool, msgAndArgs ...interface{}) { // Falsef asserts that the specified value is false. // -// a.Falsef(myBool, "error message %s", "formatted") +// a.Falsef(myBool, "error message %s", "formatted") func (a *Assertions) Falsef(value bool, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -392,9 +476,9 @@ func (a *Assertions) FileExistsf(path string, msg string, args ...interface{}) { // Greater asserts that the first element is greater than the second // -// a.Greater(2, 1) -// a.Greater(float64(2), float64(1)) -// a.Greater("b", "a") +// a.Greater(2, 1) +// a.Greater(float64(2), float64(1)) +// a.Greater("b", "a") func (a *Assertions) Greater(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -404,10 +488,10 @@ func (a *Assertions) Greater(e1 interface{}, e2 interface{}, msgAndArgs ...inter // GreaterOrEqual asserts that the first element is greater than or equal to the second // -// a.GreaterOrEqual(2, 1) -// a.GreaterOrEqual(2, 2) -// a.GreaterOrEqual("b", "a") -// a.GreaterOrEqual("b", "b") +// a.GreaterOrEqual(2, 1) +// a.GreaterOrEqual(2, 2) +// a.GreaterOrEqual("b", "a") +// a.GreaterOrEqual("b", "b") func (a *Assertions) GreaterOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -417,10 +501,10 @@ func (a *Assertions) GreaterOrEqual(e1 interface{}, e2 interface{}, msgAndArgs . // GreaterOrEqualf asserts that the first element is greater than or equal to the second // -// a.GreaterOrEqualf(2, 1, "error message %s", "formatted") -// a.GreaterOrEqualf(2, 2, "error message %s", "formatted") -// a.GreaterOrEqualf("b", "a", "error message %s", "formatted") -// a.GreaterOrEqualf("b", "b", "error message %s", "formatted") +// a.GreaterOrEqualf(2, 1, "error message %s", "formatted") +// a.GreaterOrEqualf(2, 2, "error message %s", "formatted") +// a.GreaterOrEqualf("b", "a", "error message %s", "formatted") +// a.GreaterOrEqualf("b", "b", "error message %s", "formatted") func (a *Assertions) GreaterOrEqualf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -430,9 +514,9 @@ func (a *Assertions) GreaterOrEqualf(e1 interface{}, e2 interface{}, msg string, // Greaterf asserts that the first element is greater than the second // -// a.Greaterf(2, 1, "error message %s", "formatted") -// a.Greaterf(float64(2), float64(1), "error message %s", "formatted") -// a.Greaterf("b", "a", "error message %s", "formatted") +// a.Greaterf(2, 1, "error message %s", "formatted") +// a.Greaterf(float64(2), float64(1), "error message %s", "formatted") +// a.Greaterf("b", "a", "error message %s", "formatted") func (a *Assertions) Greaterf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -443,7 +527,7 @@ func (a *Assertions) Greaterf(e1 interface{}, e2 interface{}, msg string, args . // HTTPBodyContains asserts that a specified handler returns a // body that contains a string. // -// a.HTTPBodyContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// a.HTTPBodyContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyContains(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) { @@ -456,7 +540,7 @@ func (a *Assertions) HTTPBodyContains(handler http.HandlerFunc, method string, u // HTTPBodyContainsf asserts that a specified handler returns a // body that contains a string. // -// a.HTTPBodyContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// a.HTTPBodyContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyContainsf(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) { @@ -469,7 +553,7 @@ func (a *Assertions) HTTPBodyContainsf(handler http.HandlerFunc, method string, // HTTPBodyNotContains asserts that a specified handler returns a // body that does not contain a string. // -// a.HTTPBodyNotContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// a.HTTPBodyNotContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyNotContains(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) { @@ -482,7 +566,7 @@ func (a *Assertions) HTTPBodyNotContains(handler http.HandlerFunc, method string // HTTPBodyNotContainsf asserts that a specified handler returns a // body that does not contain a string. // -// a.HTTPBodyNotContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// a.HTTPBodyNotContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyNotContainsf(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) { @@ -494,7 +578,7 @@ func (a *Assertions) HTTPBodyNotContainsf(handler http.HandlerFunc, method strin // HTTPError asserts that a specified handler returns an error status code. // -// a.HTTPError(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPError(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPError(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -506,7 +590,7 @@ func (a *Assertions) HTTPError(handler http.HandlerFunc, method string, url stri // HTTPErrorf asserts that a specified handler returns an error status code. // -// a.HTTPErrorf(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPErrorf(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPErrorf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -518,7 +602,7 @@ func (a *Assertions) HTTPErrorf(handler http.HandlerFunc, method string, url str // HTTPRedirect asserts that a specified handler returns a redirect status code. // -// a.HTTPRedirect(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPRedirect(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPRedirect(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -530,7 +614,7 @@ func (a *Assertions) HTTPRedirect(handler http.HandlerFunc, method string, url s // HTTPRedirectf asserts that a specified handler returns a redirect status code. // -// a.HTTPRedirectf(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPRedirectf(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPRedirectf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -542,7 +626,7 @@ func (a *Assertions) HTTPRedirectf(handler http.HandlerFunc, method string, url // HTTPStatusCode asserts that a specified handler returns a specified status code. // -// a.HTTPStatusCode(myHandler, "GET", "/notImplemented", nil, 501) +// a.HTTPStatusCode(myHandler, "GET", "/notImplemented", nil, 501) // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPStatusCode(handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msgAndArgs ...interface{}) { @@ -554,7 +638,7 @@ func (a *Assertions) HTTPStatusCode(handler http.HandlerFunc, method string, url // HTTPStatusCodef asserts that a specified handler returns a specified status code. // -// a.HTTPStatusCodef(myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") +// a.HTTPStatusCodef(myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPStatusCodef(handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msg string, args ...interface{}) { @@ -566,7 +650,7 @@ func (a *Assertions) HTTPStatusCodef(handler http.HandlerFunc, method string, ur // HTTPSuccess asserts that a specified handler returns a success status code. // -// a.HTTPSuccess(myHandler, "POST", "http://www.google.com", nil) +// a.HTTPSuccess(myHandler, "POST", "http://www.google.com", nil) // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPSuccess(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -578,7 +662,7 @@ func (a *Assertions) HTTPSuccess(handler http.HandlerFunc, method string, url st // HTTPSuccessf asserts that a specified handler returns a success status code. // -// a.HTTPSuccessf(myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") +// a.HTTPSuccessf(myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPSuccessf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -590,7 +674,7 @@ func (a *Assertions) HTTPSuccessf(handler http.HandlerFunc, method string, url s // Implements asserts that an object is implemented by the specified interface. // -// a.Implements((*MyInterface)(nil), new(MyObject)) +// a.Implements((*MyInterface)(nil), new(MyObject)) func (a *Assertions) Implements(interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -600,7 +684,7 @@ func (a *Assertions) Implements(interfaceObject interface{}, object interface{}, // Implementsf asserts that an object is implemented by the specified interface. // -// a.Implementsf((*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// a.Implementsf((*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func (a *Assertions) Implementsf(interfaceObject interface{}, object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -610,7 +694,7 @@ func (a *Assertions) Implementsf(interfaceObject interface{}, object interface{} // InDelta asserts that the two numerals are within delta of each other. // -// a.InDelta(math.Pi, 22/7.0, 0.01) +// a.InDelta(math.Pi, 22/7.0, 0.01) func (a *Assertions) InDelta(expected interface{}, actual interface{}, delta float64, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -652,7 +736,7 @@ func (a *Assertions) InDeltaSlicef(expected interface{}, actual interface{}, del // InDeltaf asserts that the two numerals are within delta of each other. // -// a.InDeltaf(math.Pi, 22/7.0, 0.01, "error message %s", "formatted") +// a.InDeltaf(math.Pi, 22/7.0, 0.01, "error message %s", "formatted") func (a *Assertions) InDeltaf(expected interface{}, actual interface{}, delta float64, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -694,9 +778,9 @@ func (a *Assertions) InEpsilonf(expected interface{}, actual interface{}, epsilo // IsDecreasing asserts that the collection is decreasing // -// a.IsDecreasing([]int{2, 1, 0}) -// a.IsDecreasing([]float{2, 1}) -// a.IsDecreasing([]string{"b", "a"}) +// a.IsDecreasing([]int{2, 1, 0}) +// a.IsDecreasing([]float{2, 1}) +// a.IsDecreasing([]string{"b", "a"}) func (a *Assertions) IsDecreasing(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -706,9 +790,9 @@ func (a *Assertions) IsDecreasing(object interface{}, msgAndArgs ...interface{}) // IsDecreasingf asserts that the collection is decreasing // -// a.IsDecreasingf([]int{2, 1, 0}, "error message %s", "formatted") -// a.IsDecreasingf([]float{2, 1}, "error message %s", "formatted") -// a.IsDecreasingf([]string{"b", "a"}, "error message %s", "formatted") +// a.IsDecreasingf([]int{2, 1, 0}, "error message %s", "formatted") +// a.IsDecreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsDecreasingf([]string{"b", "a"}, "error message %s", "formatted") func (a *Assertions) IsDecreasingf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -718,9 +802,9 @@ func (a *Assertions) IsDecreasingf(object interface{}, msg string, args ...inter // IsIncreasing asserts that the collection is increasing // -// a.IsIncreasing([]int{1, 2, 3}) -// a.IsIncreasing([]float{1, 2}) -// a.IsIncreasing([]string{"a", "b"}) +// a.IsIncreasing([]int{1, 2, 3}) +// a.IsIncreasing([]float{1, 2}) +// a.IsIncreasing([]string{"a", "b"}) func (a *Assertions) IsIncreasing(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -730,9 +814,9 @@ func (a *Assertions) IsIncreasing(object interface{}, msgAndArgs ...interface{}) // IsIncreasingf asserts that the collection is increasing // -// a.IsIncreasingf([]int{1, 2, 3}, "error message %s", "formatted") -// a.IsIncreasingf([]float{1, 2}, "error message %s", "formatted") -// a.IsIncreasingf([]string{"a", "b"}, "error message %s", "formatted") +// a.IsIncreasingf([]int{1, 2, 3}, "error message %s", "formatted") +// a.IsIncreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsIncreasingf([]string{"a", "b"}, "error message %s", "formatted") func (a *Assertions) IsIncreasingf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -742,9 +826,9 @@ func (a *Assertions) IsIncreasingf(object interface{}, msg string, args ...inter // IsNonDecreasing asserts that the collection is not decreasing // -// a.IsNonDecreasing([]int{1, 1, 2}) -// a.IsNonDecreasing([]float{1, 2}) -// a.IsNonDecreasing([]string{"a", "b"}) +// a.IsNonDecreasing([]int{1, 1, 2}) +// a.IsNonDecreasing([]float{1, 2}) +// a.IsNonDecreasing([]string{"a", "b"}) func (a *Assertions) IsNonDecreasing(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -754,9 +838,9 @@ func (a *Assertions) IsNonDecreasing(object interface{}, msgAndArgs ...interface // IsNonDecreasingf asserts that the collection is not decreasing // -// a.IsNonDecreasingf([]int{1, 1, 2}, "error message %s", "formatted") -// a.IsNonDecreasingf([]float{1, 2}, "error message %s", "formatted") -// a.IsNonDecreasingf([]string{"a", "b"}, "error message %s", "formatted") +// a.IsNonDecreasingf([]int{1, 1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]string{"a", "b"}, "error message %s", "formatted") func (a *Assertions) IsNonDecreasingf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -766,9 +850,9 @@ func (a *Assertions) IsNonDecreasingf(object interface{}, msg string, args ...in // IsNonIncreasing asserts that the collection is not increasing // -// a.IsNonIncreasing([]int{2, 1, 1}) -// a.IsNonIncreasing([]float{2, 1}) -// a.IsNonIncreasing([]string{"b", "a"}) +// a.IsNonIncreasing([]int{2, 1, 1}) +// a.IsNonIncreasing([]float{2, 1}) +// a.IsNonIncreasing([]string{"b", "a"}) func (a *Assertions) IsNonIncreasing(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -778,9 +862,9 @@ func (a *Assertions) IsNonIncreasing(object interface{}, msgAndArgs ...interface // IsNonIncreasingf asserts that the collection is not increasing // -// a.IsNonIncreasingf([]int{2, 1, 1}, "error message %s", "formatted") -// a.IsNonIncreasingf([]float{2, 1}, "error message %s", "formatted") -// a.IsNonIncreasingf([]string{"b", "a"}, "error message %s", "formatted") +// a.IsNonIncreasingf([]int{2, 1, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]string{"b", "a"}, "error message %s", "formatted") func (a *Assertions) IsNonIncreasingf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -806,7 +890,7 @@ func (a *Assertions) IsTypef(expectedType interface{}, object interface{}, msg s // JSONEq asserts that two JSON strings are equivalent. // -// a.JSONEq(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) +// a.JSONEq(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) func (a *Assertions) JSONEq(expected string, actual string, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -816,7 +900,7 @@ func (a *Assertions) JSONEq(expected string, actual string, msgAndArgs ...interf // JSONEqf asserts that two JSON strings are equivalent. // -// a.JSONEqf(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") +// a.JSONEqf(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") func (a *Assertions) JSONEqf(expected string, actual string, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -827,7 +911,7 @@ func (a *Assertions) JSONEqf(expected string, actual string, msg string, args .. // Len asserts that the specified object has specific length. // Len also fails if the object has a type that len() not accept. // -// a.Len(mySlice, 3) +// a.Len(mySlice, 3) func (a *Assertions) Len(object interface{}, length int, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -838,7 +922,7 @@ func (a *Assertions) Len(object interface{}, length int, msgAndArgs ...interface // Lenf asserts that the specified object has specific length. // Lenf also fails if the object has a type that len() not accept. // -// a.Lenf(mySlice, 3, "error message %s", "formatted") +// a.Lenf(mySlice, 3, "error message %s", "formatted") func (a *Assertions) Lenf(object interface{}, length int, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -848,9 +932,9 @@ func (a *Assertions) Lenf(object interface{}, length int, msg string, args ...in // Less asserts that the first element is less than the second // -// a.Less(1, 2) -// a.Less(float64(1), float64(2)) -// a.Less("a", "b") +// a.Less(1, 2) +// a.Less(float64(1), float64(2)) +// a.Less("a", "b") func (a *Assertions) Less(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -860,10 +944,10 @@ func (a *Assertions) Less(e1 interface{}, e2 interface{}, msgAndArgs ...interfac // LessOrEqual asserts that the first element is less than or equal to the second // -// a.LessOrEqual(1, 2) -// a.LessOrEqual(2, 2) -// a.LessOrEqual("a", "b") -// a.LessOrEqual("b", "b") +// a.LessOrEqual(1, 2) +// a.LessOrEqual(2, 2) +// a.LessOrEqual("a", "b") +// a.LessOrEqual("b", "b") func (a *Assertions) LessOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -873,10 +957,10 @@ func (a *Assertions) LessOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...i // LessOrEqualf asserts that the first element is less than or equal to the second // -// a.LessOrEqualf(1, 2, "error message %s", "formatted") -// a.LessOrEqualf(2, 2, "error message %s", "formatted") -// a.LessOrEqualf("a", "b", "error message %s", "formatted") -// a.LessOrEqualf("b", "b", "error message %s", "formatted") +// a.LessOrEqualf(1, 2, "error message %s", "formatted") +// a.LessOrEqualf(2, 2, "error message %s", "formatted") +// a.LessOrEqualf("a", "b", "error message %s", "formatted") +// a.LessOrEqualf("b", "b", "error message %s", "formatted") func (a *Assertions) LessOrEqualf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -886,9 +970,9 @@ func (a *Assertions) LessOrEqualf(e1 interface{}, e2 interface{}, msg string, ar // Lessf asserts that the first element is less than the second // -// a.Lessf(1, 2, "error message %s", "formatted") -// a.Lessf(float64(1), float64(2), "error message %s", "formatted") -// a.Lessf("a", "b", "error message %s", "formatted") +// a.Lessf(1, 2, "error message %s", "formatted") +// a.Lessf(float64(1), float64(2), "error message %s", "formatted") +// a.Lessf("a", "b", "error message %s", "formatted") func (a *Assertions) Lessf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -898,8 +982,8 @@ func (a *Assertions) Lessf(e1 interface{}, e2 interface{}, msg string, args ...i // Negative asserts that the specified element is negative // -// a.Negative(-1) -// a.Negative(-1.23) +// a.Negative(-1) +// a.Negative(-1.23) func (a *Assertions) Negative(e interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -909,8 +993,8 @@ func (a *Assertions) Negative(e interface{}, msgAndArgs ...interface{}) { // Negativef asserts that the specified element is negative // -// a.Negativef(-1, "error message %s", "formatted") -// a.Negativef(-1.23, "error message %s", "formatted") +// a.Negativef(-1, "error message %s", "formatted") +// a.Negativef(-1.23, "error message %s", "formatted") func (a *Assertions) Negativef(e interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -921,7 +1005,7 @@ func (a *Assertions) Negativef(e interface{}, msg string, args ...interface{}) { // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// a.Never(func() bool { return false; }, time.Second, 10*time.Millisecond) +// a.Never(func() bool { return false; }, time.Second, 10*time.Millisecond) func (a *Assertions) Never(condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -932,7 +1016,7 @@ func (a *Assertions) Never(condition func() bool, waitFor time.Duration, tick ti // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// a.Neverf(func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// a.Neverf(func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func (a *Assertions) Neverf(condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -942,7 +1026,7 @@ func (a *Assertions) Neverf(condition func() bool, waitFor time.Duration, tick t // Nil asserts that the specified object is nil. // -// a.Nil(err) +// a.Nil(err) func (a *Assertions) Nil(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -952,7 +1036,7 @@ func (a *Assertions) Nil(object interface{}, msgAndArgs ...interface{}) { // Nilf asserts that the specified object is nil. // -// a.Nilf(err, "error message %s", "formatted") +// a.Nilf(err, "error message %s", "formatted") func (a *Assertions) Nilf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -980,10 +1064,10 @@ func (a *Assertions) NoDirExistsf(path string, msg string, args ...interface{}) // NoError asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if a.NoError(err) { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if a.NoError(err) { +// assert.Equal(t, expectedObj, actualObj) +// } func (a *Assertions) NoError(err error, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -993,10 +1077,10 @@ func (a *Assertions) NoError(err error, msgAndArgs ...interface{}) { // NoErrorf asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if a.NoErrorf(err, "error message %s", "formatted") { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if a.NoErrorf(err, "error message %s", "formatted") { +// assert.Equal(t, expectedObj, actualObj) +// } func (a *Assertions) NoErrorf(err error, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1025,9 +1109,9 @@ func (a *Assertions) NoFileExistsf(path string, msg string, args ...interface{}) // NotContains asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// a.NotContains("Hello World", "Earth") -// a.NotContains(["Hello", "World"], "Earth") -// a.NotContains({"Hello": "World"}, "Earth") +// a.NotContains("Hello World", "Earth") +// a.NotContains(["Hello", "World"], "Earth") +// a.NotContains({"Hello": "World"}, "Earth") func (a *Assertions) NotContains(s interface{}, contains interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1038,9 +1122,9 @@ func (a *Assertions) NotContains(s interface{}, contains interface{}, msgAndArgs // NotContainsf asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// a.NotContainsf("Hello World", "Earth", "error message %s", "formatted") -// a.NotContainsf(["Hello", "World"], "Earth", "error message %s", "formatted") -// a.NotContainsf({"Hello": "World"}, "Earth", "error message %s", "formatted") +// a.NotContainsf("Hello World", "Earth", "error message %s", "formatted") +// a.NotContainsf(["Hello", "World"], "Earth", "error message %s", "formatted") +// a.NotContainsf({"Hello": "World"}, "Earth", "error message %s", "formatted") func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1051,9 +1135,9 @@ func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg strin // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if a.NotEmpty(obj) { -// assert.Equal(t, "two", obj[1]) -// } +// if a.NotEmpty(obj) { +// assert.Equal(t, "two", obj[1]) +// } func (a *Assertions) NotEmpty(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1064,9 +1148,9 @@ func (a *Assertions) NotEmpty(object interface{}, msgAndArgs ...interface{}) { // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if a.NotEmptyf(obj, "error message %s", "formatted") { -// assert.Equal(t, "two", obj[1]) -// } +// if a.NotEmptyf(obj, "error message %s", "formatted") { +// assert.Equal(t, "two", obj[1]) +// } func (a *Assertions) NotEmptyf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1076,7 +1160,7 @@ func (a *Assertions) NotEmptyf(object interface{}, msg string, args ...interface // NotEqual asserts that the specified values are NOT equal. // -// a.NotEqual(obj1, obj2) +// a.NotEqual(obj1, obj2) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1089,7 +1173,7 @@ func (a *Assertions) NotEqual(expected interface{}, actual interface{}, msgAndAr // NotEqualValues asserts that two objects are not equal even when converted to the same type // -// a.NotEqualValues(obj1, obj2) +// a.NotEqualValues(obj1, obj2) func (a *Assertions) NotEqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1099,7 +1183,7 @@ func (a *Assertions) NotEqualValues(expected interface{}, actual interface{}, ms // NotEqualValuesf asserts that two objects are not equal even when converted to the same type // -// a.NotEqualValuesf(obj1, obj2, "error message %s", "formatted") +// a.NotEqualValuesf(obj1, obj2, "error message %s", "formatted") func (a *Assertions) NotEqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1109,7 +1193,7 @@ func (a *Assertions) NotEqualValuesf(expected interface{}, actual interface{}, m // NotEqualf asserts that the specified values are NOT equal. // -// a.NotEqualf(obj1, obj2, "error message %s", "formatted") +// a.NotEqualf(obj1, obj2, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1140,7 +1224,7 @@ func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...in // NotNil asserts that the specified object is not nil. // -// a.NotNil(err) +// a.NotNil(err) func (a *Assertions) NotNil(object interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1150,7 +1234,7 @@ func (a *Assertions) NotNil(object interface{}, msgAndArgs ...interface{}) { // NotNilf asserts that the specified object is not nil. // -// a.NotNilf(err, "error message %s", "formatted") +// a.NotNilf(err, "error message %s", "formatted") func (a *Assertions) NotNilf(object interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1160,7 +1244,7 @@ func (a *Assertions) NotNilf(object interface{}, msg string, args ...interface{} // NotPanics asserts that the code inside the specified PanicTestFunc does NOT panic. // -// a.NotPanics(func(){ RemainCalm() }) +// a.NotPanics(func(){ RemainCalm() }) func (a *Assertions) NotPanics(f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1170,7 +1254,7 @@ func (a *Assertions) NotPanics(f assert.PanicTestFunc, msgAndArgs ...interface{} // NotPanicsf asserts that the code inside the specified PanicTestFunc does NOT panic. // -// a.NotPanicsf(func(){ RemainCalm() }, "error message %s", "formatted") +// a.NotPanicsf(func(){ RemainCalm() }, "error message %s", "formatted") func (a *Assertions) NotPanicsf(f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1180,8 +1264,8 @@ func (a *Assertions) NotPanicsf(f assert.PanicTestFunc, msg string, args ...inte // NotRegexp asserts that a specified regexp does not match a string. // -// a.NotRegexp(regexp.MustCompile("starts"), "it's starting") -// a.NotRegexp("^start", "it's not starting") +// a.NotRegexp(regexp.MustCompile("starts"), "it's starting") +// a.NotRegexp("^start", "it's not starting") func (a *Assertions) NotRegexp(rx interface{}, str interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1191,8 +1275,8 @@ func (a *Assertions) NotRegexp(rx interface{}, str interface{}, msgAndArgs ...in // NotRegexpf asserts that a specified regexp does not match a string. // -// a.NotRegexpf(regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") -// a.NotRegexpf("^start", "it's not starting", "error message %s", "formatted") +// a.NotRegexpf(regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") +// a.NotRegexpf("^start", "it's not starting", "error message %s", "formatted") func (a *Assertions) NotRegexpf(rx interface{}, str interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1202,7 +1286,7 @@ func (a *Assertions) NotRegexpf(rx interface{}, str interface{}, msg string, arg // NotSame asserts that two pointers do not reference the same object. // -// a.NotSame(ptr1, ptr2) +// a.NotSame(ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1215,7 +1299,7 @@ func (a *Assertions) NotSame(expected interface{}, actual interface{}, msgAndArg // NotSamef asserts that two pointers do not reference the same object. // -// a.NotSamef(ptr1, ptr2, "error message %s", "formatted") +// a.NotSamef(ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1229,7 +1313,7 @@ func (a *Assertions) NotSamef(expected interface{}, actual interface{}, msg stri // NotSubset asserts that the specified list(array, slice...) contains not all // elements given in the specified subset(array, slice...). // -// a.NotSubset([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") +// a.NotSubset([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") func (a *Assertions) NotSubset(list interface{}, subset interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1240,7 +1324,7 @@ func (a *Assertions) NotSubset(list interface{}, subset interface{}, msgAndArgs // NotSubsetf asserts that the specified list(array, slice...) contains not all // elements given in the specified subset(array, slice...). // -// a.NotSubsetf([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") +// a.NotSubsetf([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") func (a *Assertions) NotSubsetf(list interface{}, subset interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1266,7 +1350,7 @@ func (a *Assertions) NotZerof(i interface{}, msg string, args ...interface{}) { // Panics asserts that the code inside the specified PanicTestFunc panics. // -// a.Panics(func(){ GoCrazy() }) +// a.Panics(func(){ GoCrazy() }) func (a *Assertions) Panics(f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1278,7 +1362,7 @@ func (a *Assertions) Panics(f assert.PanicTestFunc, msgAndArgs ...interface{}) { // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// a.PanicsWithError("crazy error", func(){ GoCrazy() }) +// a.PanicsWithError("crazy error", func(){ GoCrazy() }) func (a *Assertions) PanicsWithError(errString string, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1290,7 +1374,7 @@ func (a *Assertions) PanicsWithError(errString string, f assert.PanicTestFunc, m // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// a.PanicsWithErrorf("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// a.PanicsWithErrorf("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) PanicsWithErrorf(errString string, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1301,7 +1385,7 @@ func (a *Assertions) PanicsWithErrorf(errString string, f assert.PanicTestFunc, // PanicsWithValue asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// a.PanicsWithValue("crazy error", func(){ GoCrazy() }) +// a.PanicsWithValue("crazy error", func(){ GoCrazy() }) func (a *Assertions) PanicsWithValue(expected interface{}, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1312,7 +1396,7 @@ func (a *Assertions) PanicsWithValue(expected interface{}, f assert.PanicTestFun // PanicsWithValuef asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// a.PanicsWithValuef("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// a.PanicsWithValuef("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) PanicsWithValuef(expected interface{}, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1322,7 +1406,7 @@ func (a *Assertions) PanicsWithValuef(expected interface{}, f assert.PanicTestFu // Panicsf asserts that the code inside the specified PanicTestFunc panics. // -// a.Panicsf(func(){ GoCrazy() }, "error message %s", "formatted") +// a.Panicsf(func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) Panicsf(f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1332,8 +1416,8 @@ func (a *Assertions) Panicsf(f assert.PanicTestFunc, msg string, args ...interfa // Positive asserts that the specified element is positive // -// a.Positive(1) -// a.Positive(1.23) +// a.Positive(1) +// a.Positive(1.23) func (a *Assertions) Positive(e interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1343,8 +1427,8 @@ func (a *Assertions) Positive(e interface{}, msgAndArgs ...interface{}) { // Positivef asserts that the specified element is positive // -// a.Positivef(1, "error message %s", "formatted") -// a.Positivef(1.23, "error message %s", "formatted") +// a.Positivef(1, "error message %s", "formatted") +// a.Positivef(1.23, "error message %s", "formatted") func (a *Assertions) Positivef(e interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1354,8 +1438,8 @@ func (a *Assertions) Positivef(e interface{}, msg string, args ...interface{}) { // Regexp asserts that a specified regexp matches a string. // -// a.Regexp(regexp.MustCompile("start"), "it's starting") -// a.Regexp("start...$", "it's not starting") +// a.Regexp(regexp.MustCompile("start"), "it's starting") +// a.Regexp("start...$", "it's not starting") func (a *Assertions) Regexp(rx interface{}, str interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1365,8 +1449,8 @@ func (a *Assertions) Regexp(rx interface{}, str interface{}, msgAndArgs ...inter // Regexpf asserts that a specified regexp matches a string. // -// a.Regexpf(regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") -// a.Regexpf("start...$", "it's not starting", "error message %s", "formatted") +// a.Regexpf(regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") +// a.Regexpf("start...$", "it's not starting", "error message %s", "formatted") func (a *Assertions) Regexpf(rx interface{}, str interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1376,7 +1460,7 @@ func (a *Assertions) Regexpf(rx interface{}, str interface{}, msg string, args . // Same asserts that two pointers reference the same object. // -// a.Same(ptr1, ptr2) +// a.Same(ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1389,7 +1473,7 @@ func (a *Assertions) Same(expected interface{}, actual interface{}, msgAndArgs . // Samef asserts that two pointers reference the same object. // -// a.Samef(ptr1, ptr2, "error message %s", "formatted") +// a.Samef(ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1403,7 +1487,7 @@ func (a *Assertions) Samef(expected interface{}, actual interface{}, msg string, // Subset asserts that the specified list(array, slice...) contains all // elements given in the specified subset(array, slice...). // -// a.Subset([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") +// a.Subset([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") func (a *Assertions) Subset(list interface{}, subset interface{}, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1414,7 +1498,7 @@ func (a *Assertions) Subset(list interface{}, subset interface{}, msgAndArgs ... // Subsetf asserts that the specified list(array, slice...) contains all // elements given in the specified subset(array, slice...). // -// a.Subsetf([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") +// a.Subsetf([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") func (a *Assertions) Subsetf(list interface{}, subset interface{}, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1424,7 +1508,7 @@ func (a *Assertions) Subsetf(list interface{}, subset interface{}, msg string, a // True asserts that the specified value is true. // -// a.True(myBool) +// a.True(myBool) func (a *Assertions) True(value bool, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1434,7 +1518,7 @@ func (a *Assertions) True(value bool, msgAndArgs ...interface{}) { // Truef asserts that the specified value is true. // -// a.Truef(myBool, "error message %s", "formatted") +// a.Truef(myBool, "error message %s", "formatted") func (a *Assertions) Truef(value bool, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1444,7 +1528,7 @@ func (a *Assertions) Truef(value bool, msg string, args ...interface{}) { // WithinDuration asserts that the two times are within duration delta of each other. // -// a.WithinDuration(time.Now(), time.Now(), 10*time.Second) +// a.WithinDuration(time.Now(), time.Now(), 10*time.Second) func (a *Assertions) WithinDuration(expected time.Time, actual time.Time, delta time.Duration, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1454,7 +1538,7 @@ func (a *Assertions) WithinDuration(expected time.Time, actual time.Time, delta // WithinDurationf asserts that the two times are within duration delta of each other. // -// a.WithinDurationf(time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") +// a.WithinDurationf(time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") func (a *Assertions) WithinDurationf(expected time.Time, actual time.Time, delta time.Duration, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1464,7 +1548,7 @@ func (a *Assertions) WithinDurationf(expected time.Time, actual time.Time, delta // WithinRange asserts that a time is within a time range (inclusive). // -// a.WithinRange(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) +// a.WithinRange(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) func (a *Assertions) WithinRange(actual time.Time, start time.Time, end time.Time, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1474,7 +1558,7 @@ func (a *Assertions) WithinRange(actual time.Time, start time.Time, end time.Tim // WithinRangef asserts that a time is within a time range (inclusive). // -// a.WithinRangef(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") +// a.WithinRangef(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") func (a *Assertions) WithinRangef(actual time.Time, start time.Time, end time.Time, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/thanos-io/thanos/pkg/errutil/multierror.go b/vendor/github.com/thanos-io/thanos/pkg/errutil/multierror.go index aa53706dde..40bce8a36a 100644 --- a/vendor/github.com/thanos-io/thanos/pkg/errutil/multierror.go +++ b/vendor/github.com/thanos-io/thanos/pkg/errutil/multierror.go @@ -6,6 +6,7 @@ package errutil import ( "bytes" "fmt" + "sync" ) // The MultiError type implements the error interface, and contains the @@ -32,6 +33,31 @@ func (es MultiError) Err() error { return NonNilMultiError(es) } +// SyncMultiError is a thread-safe implementation of MultiError. +type SyncMultiError struct { + mtx sync.Mutex + es MultiError +} + +// Add adds the error to the error list if it is not nil. +func (es *SyncMultiError) Add(err error) { + if err == nil { + return + } + es.mtx.Lock() + defer es.mtx.Unlock() + + es.Add(err) +} + +// Err returns the error list as an error or nil if it is empty. +func (es *SyncMultiError) Err() error { + es.mtx.Lock() + defer es.mtx.Unlock() + + return es.es.Err() +} + type NonNilMultiError MultiError // Returns a concatenated string of the contained errors. diff --git a/vendor/github.com/thanos-io/thanos/pkg/reloader/reloader.go b/vendor/github.com/thanos-io/thanos/pkg/reloader/reloader.go index 6303bba564..2057ea5f75 100644 --- a/vendor/github.com/thanos-io/thanos/pkg/reloader/reloader.go +++ b/vendor/github.com/thanos-io/thanos/pkg/reloader/reloader.go @@ -6,60 +6,58 @@ // // Reloader type is useful when you want to: // -// * Watch on changes against certain file e.g (`cfgFile`). -// * Optionally, specify different output file for watched `cfgFile` (`cfgOutputFile`). -// This will also try decompress the `cfgFile` if needed and substitute ALL the envvars using Kubernetes substitution format: (`$(var)`) -// * Watch on changes against certain directories (`watchedDirs`). +// - Watch on changes against certain file e.g (`cfgFile`). +// - Optionally, specify different output file for watched `cfgFile` (`cfgOutputFile`). +// This will also try decompress the `cfgFile` if needed and substitute ALL the envvars using Kubernetes substitution format: (`$(var)`) +// - Watch on changes against certain directories (`watchedDirs`). // // Once any of those two changes, Prometheus on given `reloadURL` will be notified, causing Prometheus to reload configuration and rules. // // This and below for reloader: // -// u, _ := url.Parse("http://localhost:9090") -// rl := reloader.New(nil, nil, &reloader.Options{ -// ReloadURL: reloader.ReloadURLFromBase(u), -// CfgFile: "/path/to/cfg", -// CfgOutputFile: "/path/to/cfg.out", -// WatchedDirs: []string{"/path/to/dirs"}, -// WatchInterval: 3 * time.Minute, -// RetryInterval: 5 * time.Second, -// }) +// u, _ := url.Parse("http://localhost:9090") +// rl := reloader.New(nil, nil, &reloader.Options{ +// ReloadURL: reloader.ReloadURLFromBase(u), +// CfgFile: "/path/to/cfg", +// CfgOutputFile: "/path/to/cfg.out", +// WatchedDirs: []string{"/path/to/dirs"}, +// WatchInterval: 3 * time.Minute, +// RetryInterval: 5 * time.Second, +// }) // // The url of reloads can be generated with function ReloadURLFromBase(). // It will append the default path of reload into the given url: // -// u, _ := url.Parse("http://localhost:9090") -// reloader.ReloadURLFromBase(u) // It will return "http://localhost:9090/-/reload" +// u, _ := url.Parse("http://localhost:9090") +// reloader.ReloadURLFromBase(u) // It will return "http://localhost:9090/-/reload" // // Start watching changes and stopped until the context gets canceled: // -// ctx, cancel := context.WithCancel(context.Background()) -// go func() { -// if err := rl.Watch(ctx); err != nil { -// log.Fatal(err) -// } -// }() -// // ... -// cancel() +// ctx, cancel := context.WithCancel(context.Background()) +// go func() { +// if err := rl.Watch(ctx); err != nil { +// log.Fatal(err) +// } +// }() +// // ... +// cancel() // // Reloader will make a schedule to check the given config files and dirs of sum of hash with the last result, // even if it is no changes. // // A basic example of configuration template with environment variables: // -// global: -// external_labels: -// replica: '$(HOSTNAME)' +// global: +// external_labels: +// replica: '$(HOSTNAME)' package reloader import ( "bytes" "compress/gzip" "context" - "crypto/sha256" "hash" "io" - "io/ioutil" "net/http" "net/url" "os" @@ -73,6 +71,7 @@ import ( "github.com/fsnotify/fsnotify" "github.com/go-kit/log" "github.com/go-kit/log/level" + "github.com/minio/sha256-simd" "github.com/pkg/errors" "github.com/prometheus/client_golang/prometheus" "github.com/prometheus/client_golang/prometheus/promauto" @@ -96,6 +95,7 @@ type Reloader struct { lastCfgHash []byte lastWatchedDirsHash []byte + forceReload bool reloads prometheus.Counter reloadErrors prometheus.Counter @@ -207,8 +207,10 @@ func (r *Reloader) Watch(ctx context.Context) error { if err := r.watcher.addFile(r.cfgFile); err != nil { return errors.Wrapf(err, "add config file %s to watcher", r.cfgFile) } - - if err := r.apply(ctx); err != nil { + initialSyncCtx, initialSyncCancel := context.WithTimeout(ctx, r.watchInterval) + err := r.apply(initialSyncCtx) + initialSyncCancel() + if err != nil { return err } } @@ -279,7 +281,7 @@ func (r *Reloader) apply(ctx context.Context) error { } cfgHash = h.Sum(nil) if r.cfgOutputFile != "" { - b, err := ioutil.ReadFile(r.cfgFile) + b, err := os.ReadFile(r.cfgFile) if err != nil { return errors.Wrap(err, "read file") } @@ -292,7 +294,7 @@ func (r *Reloader) apply(ctx context.Context) error { } defer runutil.CloseWithLogOnErr(r.logger, zr, "gzip reader close") - b, err = ioutil.ReadAll(zr) + b, err = io.ReadAll(zr) if err != nil { return errors.Wrap(err, "read compressed config file") } @@ -307,7 +309,7 @@ func (r *Reloader) apply(ctx context.Context) error { defer func() { _ = os.Remove(tmpFile) }() - if err := ioutil.WriteFile(tmpFile, b, 0644); err != nil { + if err := os.WriteFile(tmpFile, b, 0644); err != nil { return errors.Wrap(err, "write file") } if err := os.Rename(tmpFile, r.cfgOutputFile); err != nil { @@ -352,7 +354,7 @@ func (r *Reloader) apply(ctx context.Context) error { watchedDirsHash = h.Sum(nil) } - if bytes.Equal(r.lastCfgHash, cfgHash) && bytes.Equal(r.lastWatchedDirsHash, watchedDirsHash) { + if !r.forceReload && bytes.Equal(r.lastCfgHash, cfgHash) && bytes.Equal(r.lastWatchedDirsHash, watchedDirsHash) { // Nothing to do. return nil } @@ -368,6 +370,7 @@ func (r *Reloader) apply(ctx context.Context) error { return errors.Wrap(err, "trigger reload") } + r.forceReload = false r.lastCfgHash = cfgHash r.lastWatchedDirsHash = watchedDirsHash level.Info(r.logger).Log( @@ -379,6 +382,7 @@ func (r *Reloader) apply(ctx context.Context) error { r.lastReloadSuccessTimestamp.SetToCurrentTime() return nil }); err != nil { + r.forceReload = true level.Error(r.logger).Log("msg", "Failed to trigger reload. Retrying.", "err", err) } diff --git a/vendor/github.com/thanos-io/thanos/pkg/runutil/runutil.go b/vendor/github.com/thanos-io/thanos/pkg/runutil/runutil.go index 05b4bd46ea..ab8665f451 100644 --- a/vendor/github.com/thanos-io/thanos/pkg/runutil/runutil.go +++ b/vendor/github.com/thanos-io/thanos/pkg/runutil/runutil.go @@ -9,36 +9,36 @@ // // For repeat executes, use Repeat: // -// err := runutil.Repeat(10*time.Second, stopc, func() error { -// // ... -// }) +// err := runutil.Repeat(10*time.Second, stopc, func() error { +// // ... +// }) // // Retry starts executing closure function f until no error is returned from f: // -// err := runutil.Retry(10*time.Second, stopc, func() error { -// // ... -// }) +// err := runutil.Retry(10*time.Second, stopc, func() error { +// // ... +// }) // // For logging an error on each f error, use RetryWithLog: // -// err := runutil.RetryWithLog(logger, 10*time.Second, stopc, func() error { -// // ... -// }) +// err := runutil.RetryWithLog(logger, 10*time.Second, stopc, func() error { +// // ... +// }) // // Another use case for runutil package is when you want to close a `Closer` interface. As we all know, we should close all implements of `Closer`, such as *os.File. Commonly we will use: // -// defer closer.Close() +// defer closer.Close() // // The problem is that Close() usually can return important error e.g for os.File the actual file flush might happen (and fail) on `Close` method. It's important to *always* check error. Thanos provides utility functions to log every error like those, allowing to put them in convenient `defer`: // -// defer runutil.CloseWithLogOnErr(logger, closer, "log format message") +// defer runutil.CloseWithLogOnErr(logger, closer, "log format message") // // For capturing error, use CloseWithErrCapture: // -// var err error -// defer runutil.CloseWithErrCapture(&err, closer, "log format message") +// var err error +// defer runutil.CloseWithErrCapture(&err, closer, "log format message") // -// // ... +// // ... // // If Close() returns error, err will capture it and return by argument. // @@ -52,7 +52,6 @@ package runutil import ( "fmt" "io" - "io/ioutil" "os" "path/filepath" "strings" @@ -128,7 +127,7 @@ func CloseWithLogOnErr(logger log.Logger, closer io.Closer, format string, a ... // ExhaustCloseWithLogOnErr closes the io.ReadCloser with a log message on error but exhausts the reader before. func ExhaustCloseWithLogOnErr(logger log.Logger, r io.ReadCloser, format string, a ...interface{}) { - _, err := io.Copy(ioutil.Discard, r) + _, err := io.Copy(io.Discard, r) if err != nil { level.Warn(logger).Log("msg", "failed to exhaust reader, performance may be impeded", "err", err) } @@ -149,7 +148,7 @@ func CloseWithErrCapture(err *error, closer io.Closer, format string, a ...inter // ExhaustCloseWithErrCapture closes the io.ReadCloser with error capture but exhausts the reader before. func ExhaustCloseWithErrCapture(err *error, r io.ReadCloser, format string, a ...interface{}) { - _, copyErr := io.Copy(ioutil.Discard, r) + _, copyErr := io.Copy(io.Discard, r) CloseWithErrCapture(err, r, format, a...) @@ -165,7 +164,7 @@ func ExhaustCloseWithErrCapture(err *error, r io.ReadCloser, format string, a .. // dir except for the ignoreDirs directories. // NOTE: DeleteAll is not idempotent. func DeleteAll(dir string, ignoreDirs ...string) error { - entries, err := ioutil.ReadDir(dir) + entries, err := os.ReadDir(dir) if os.IsNotExist(err) { return nil } diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/array_codec.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/array_codec.go index 4e24f9eed6..6ca8d9ad6c 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/array_codec.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/array_codec.go @@ -14,17 +14,23 @@ import ( ) // ArrayCodec is the Codec used for bsoncore.Array values. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// ArrayCodec registered. type ArrayCodec struct{} var defaultArrayCodec = NewArrayCodec() // NewArrayCodec returns an ArrayCodec. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// ArrayCodec registered. func NewArrayCodec() *ArrayCodec { return &ArrayCodec{} } // EncodeValue is the ValueEncoder for bsoncore.Array values. -func (ac *ArrayCodec) EncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +func (ac *ArrayCodec) EncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tCoreArray { return ValueEncoderError{Name: "CoreArrayEncodeValue", Types: []reflect.Type{tCoreArray}, Received: val} } @@ -34,7 +40,7 @@ func (ac *ArrayCodec) EncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val r } // DecodeValue is the ValueDecoder for bsoncore.Array values. -func (ac *ArrayCodec) DecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { +func (ac *ArrayCodec) DecodeValue(_ DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tCoreArray { return ValueDecoderError{Name: "CoreArrayDecodeValue", Types: []reflect.Type{tCoreArray}, Received: val} } diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/bsoncodec.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/bsoncodec.go index 098ed69f98..0693bd432f 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/bsoncodec.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/bsoncodec.go @@ -23,6 +23,8 @@ var ( // Marshaler is an interface implemented by types that can marshal themselves // into a BSON document represented as bytes. The bytes returned must be a valid // BSON document if the error is nil. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Marshaler] instead. type Marshaler interface { MarshalBSON() ([]byte, error) } @@ -31,6 +33,8 @@ type Marshaler interface { // themselves into a BSON value as bytes. The type must be the valid type for // the bytes returned. The bytes and byte type together must be valid if the // error is nil. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.ValueMarshaler] instead. type ValueMarshaler interface { MarshalBSONValue() (bsontype.Type, []byte, error) } @@ -39,6 +43,8 @@ type ValueMarshaler interface { // document representation of themselves. The BSON bytes can be assumed to be // valid. UnmarshalBSON must copy the BSON bytes if it wishes to retain the data // after returning. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Unmarshaler] instead. type Unmarshaler interface { UnmarshalBSON([]byte) error } @@ -47,6 +53,8 @@ type Unmarshaler interface { // BSON value representation of themselves. The BSON bytes and type can be // assumed to be valid. UnmarshalBSONValue must copy the BSON value bytes if it // wishes to retain the data after returning. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.ValueUnmarshaler] instead. type ValueUnmarshaler interface { UnmarshalBSONValue(bsontype.Type, []byte) error } @@ -111,13 +119,93 @@ func (vde ValueDecoderError) Error() string { // value. type EncodeContext struct { *Registry + + // MinSize causes the Encoder to marshal Go integer values (int, int8, int16, int32, int64, + // uint, uint8, uint16, uint32, or uint64) as the minimum BSON int size (either 32 or 64 bits) + // that can represent the integer value. + // + // Deprecated: Use bson.Encoder.IntMinSize instead. MinSize bool + + errorOnInlineDuplicates bool + stringifyMapKeysWithFmt bool + nilMapAsEmpty bool + nilSliceAsEmpty bool + nilByteSliceAsEmpty bool + omitZeroStruct bool + useJSONStructTags bool +} + +// ErrorOnInlineDuplicates causes the Encoder to return an error if there is a duplicate field in +// the marshaled BSON when the "inline" struct tag option is set. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.ErrorOnInlineDuplicates] instead. +func (ec *EncodeContext) ErrorOnInlineDuplicates() { + ec.errorOnInlineDuplicates = true +} + +// StringifyMapKeysWithFmt causes the Encoder to convert Go map keys to BSON document field name +// strings using fmt.Sprintf() instead of the default string conversion logic. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.StringifyMapKeysWithFmt] instead. +func (ec *EncodeContext) StringifyMapKeysWithFmt() { + ec.stringifyMapKeysWithFmt = true +} + +// NilMapAsEmpty causes the Encoder to marshal nil Go maps as empty BSON documents instead of BSON +// null. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.NilMapAsEmpty] instead. +func (ec *EncodeContext) NilMapAsEmpty() { + ec.nilMapAsEmpty = true +} + +// NilSliceAsEmpty causes the Encoder to marshal nil Go slices as empty BSON arrays instead of BSON +// null. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.NilSliceAsEmpty] instead. +func (ec *EncodeContext) NilSliceAsEmpty() { + ec.nilSliceAsEmpty = true +} + +// NilByteSliceAsEmpty causes the Encoder to marshal nil Go byte slices as empty BSON binary values +// instead of BSON null. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.NilByteSliceAsEmpty] instead. +func (ec *EncodeContext) NilByteSliceAsEmpty() { + ec.nilByteSliceAsEmpty = true +} + +// OmitZeroStruct causes the Encoder to consider the zero value for a struct (e.g. MyStruct{}) +// as empty and omit it from the marshaled BSON when the "omitempty" struct tag option is set. +// +// Note that the Encoder only examines exported struct fields when determining if a struct is the +// zero value. It considers pointers to a zero struct value (e.g. &MyStruct{}) not empty. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.OmitZeroStruct] instead. +func (ec *EncodeContext) OmitZeroStruct() { + ec.omitZeroStruct = true +} + +// UseJSONStructTags causes the Encoder to fall back to using the "json" struct tag if a "bson" +// struct tag is not specified. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.UseJSONStructTags] instead. +func (ec *EncodeContext) UseJSONStructTags() { + ec.useJSONStructTags = true } // DecodeContext is the contextual information required for a Codec to decode a // value. type DecodeContext struct { *Registry + + // Truncate, if true, instructs decoders to to truncate the fractional part of BSON "double" + // values when attempting to unmarshal them into a Go integer (int, int8, int16, int32, int64, + // uint, uint8, uint16, uint32, or uint64) struct field. The truncation logic does not apply to + // BSON "decimal128" values. + // + // Deprecated: Use bson.Decoder.AllowTruncatingDoubles instead. Truncate bool // Ancestor is the type of a containing document. This is mainly used to determine what type @@ -125,7 +213,7 @@ type DecodeContext struct { // Ancestor is a bson.M, BSON embedded document values being decoded into an empty interface // will be decoded into a bson.M. // - // Deprecated: Use DefaultDocumentM or DefaultDocumentD instead. + // Deprecated: Use bson.Decoder.DefaultDocumentM or bson.Decoder.DefaultDocumentD instead. Ancestor reflect.Type // defaultDocumentType specifies the Go type to decode top-level and nested BSON documents into. In particular, the @@ -133,22 +221,74 @@ type DecodeContext struct { // set to a type that a BSON document cannot be unmarshaled into (e.g. "string"), unmarshalling will result in an // error. DocumentType overrides the Ancestor field. defaultDocumentType reflect.Type + + binaryAsSlice bool + useJSONStructTags bool + useLocalTimeZone bool + zeroMaps bool + zeroStructs bool } -// DefaultDocumentM will decode empty documents using the primitive.M type. This behavior is restricted to data typed as -// "interface{}" or "map[string]interface{}". +// BinaryAsSlice causes the Decoder to unmarshal BSON binary field values that are the "Generic" or +// "Old" BSON binary subtype as a Go byte slice instead of a primitive.Binary. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Decoder.BinaryAsSlice] instead. +func (dc *DecodeContext) BinaryAsSlice() { + dc.binaryAsSlice = true +} + +// UseJSONStructTags causes the Decoder to fall back to using the "json" struct tag if a "bson" +// struct tag is not specified. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Decoder.UseJSONStructTags] instead. +func (dc *DecodeContext) UseJSONStructTags() { + dc.useJSONStructTags = true +} + +// UseLocalTimeZone causes the Decoder to unmarshal time.Time values in the local timezone instead +// of the UTC timezone. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Decoder.UseLocalTimeZone] instead. +func (dc *DecodeContext) UseLocalTimeZone() { + dc.useLocalTimeZone = true +} + +// ZeroMaps causes the Decoder to delete any existing values from Go maps in the destination value +// passed to Decode before unmarshaling BSON documents into them. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Decoder.ZeroMaps] instead. +func (dc *DecodeContext) ZeroMaps() { + dc.zeroMaps = true +} + +// ZeroStructs causes the Decoder to delete any existing values from Go structs in the destination +// value passed to Decode before unmarshaling BSON documents into them. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Decoder.ZeroStructs] instead. +func (dc *DecodeContext) ZeroStructs() { + dc.zeroStructs = true +} + +// DefaultDocumentM causes the Decoder to always unmarshal documents into the primitive.M type. This +// behavior is restricted to data typed as "interface{}" or "map[string]interface{}". +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Decoder.DefaultDocumentM] instead. func (dc *DecodeContext) DefaultDocumentM() { dc.defaultDocumentType = reflect.TypeOf(primitive.M{}) } -// DefaultDocumentD will decode empty documents using the primitive.D type. This behavior is restricted to data typed as -// "interface{}" or "map[string]interface{}". +// DefaultDocumentD causes the Decoder to always unmarshal documents into the primitive.D type. This +// behavior is restricted to data typed as "interface{}" or "map[string]interface{}". +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Decoder.DefaultDocumentD] instead. func (dc *DecodeContext) DefaultDocumentD() { dc.defaultDocumentType = reflect.TypeOf(primitive.D{}) } -// ValueCodec is the interface that groups the methods to encode and decode +// ValueCodec is an interface for encoding and decoding a reflect.Value. // values. +// +// Deprecated: Use [ValueEncoder] and [ValueDecoder] instead. type ValueCodec interface { ValueEncoder ValueDecoder @@ -233,6 +373,10 @@ func decodeTypeOrValueWithInfo(vd ValueDecoder, td typeDecoder, dc DecodeContext // CodecZeroer is the interface implemented by Codecs that can also determine if // a value of the type that would be encoded is zero. +// +// Deprecated: Defining custom rules for the zero/empty value will not be supported in Go Driver +// 2.0. Users who want to omit empty complex values should use a pointer field and set the value to +// nil instead. type CodecZeroer interface { IsTypeZero(interface{}) bool } diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/byte_slice_codec.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/byte_slice_codec.go index 5a916cc159..dde3e76815 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/byte_slice_codec.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/byte_slice_codec.go @@ -16,18 +16,30 @@ import ( ) // ByteSliceCodec is the Codec used for []byte values. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// ByteSliceCodec registered. type ByteSliceCodec struct { + // EncodeNilAsEmpty causes EncodeValue to marshal nil Go byte slices as empty BSON binary values + // instead of BSON null. + // + // Deprecated: Use bson.Encoder.NilByteSliceAsEmpty instead. EncodeNilAsEmpty bool } var ( defaultByteSliceCodec = NewByteSliceCodec() - _ ValueCodec = defaultByteSliceCodec + // Assert that defaultByteSliceCodec satisfies the typeDecoder interface, which allows it to be + // used by collection type decoders (e.g. map, slice, etc) to set individual values in a + // collection. _ typeDecoder = defaultByteSliceCodec ) -// NewByteSliceCodec returns a StringCodec with options opts. +// NewByteSliceCodec returns a ByteSliceCodec with options opts. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// ByteSliceCodec registered. func NewByteSliceCodec(opts ...*bsonoptions.ByteSliceCodecOptions) *ByteSliceCodec { byteSliceOpt := bsonoptions.MergeByteSliceCodecOptions(opts...) codec := ByteSliceCodec{} @@ -42,13 +54,13 @@ func (bsc *ByteSliceCodec) EncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, if !val.IsValid() || val.Type() != tByteSlice { return ValueEncoderError{Name: "ByteSliceEncodeValue", Types: []reflect.Type{tByteSlice}, Received: val} } - if val.IsNil() && !bsc.EncodeNilAsEmpty { + if val.IsNil() && !bsc.EncodeNilAsEmpty && !ec.nilByteSliceAsEmpty { return vw.WriteNull() } return vw.WriteBinary(val.Interface().([]byte)) } -func (bsc *ByteSliceCodec) decodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (bsc *ByteSliceCodec) decodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tByteSlice { return emptyValue, ValueDecoderError{ Name: "ByteSliceDecodeValue", diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/default_value_decoders.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/default_value_decoders.go index e95cab585f..b5e22c498a 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/default_value_decoders.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/default_value_decoders.go @@ -48,6 +48,9 @@ func newDefaultStructCodec() *StructCodec { // DefaultValueDecoders is a namespace type for the default ValueDecoders used // when creating a registry. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. type DefaultValueDecoders struct{} // RegisterDefaultDecoders will register the decoder methods attached to DefaultValueDecoders with @@ -56,6 +59,9 @@ type DefaultValueDecoders struct{} // There is no support for decoding map[string]interface{} because there is no decoder for // interface{}, so users must either register this decoder themselves or use the // EmptyInterfaceDecoder available in the bson package. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) RegisterDefaultDecoders(rb *RegistryBuilder) { if rb == nil { panic(errors.New("argument to RegisterDefaultDecoders must not be nil")) @@ -132,6 +138,9 @@ func (dvd DefaultValueDecoders) RegisterDefaultDecoders(rb *RegistryBuilder) { } // DDecodeValue is the ValueDecoderFunc for primitive.D instances. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) DDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.IsValid() || !val.CanSet() || val.Type() != tD { return ValueDecoderError{Name: "DDecodeValue", Kinds: []reflect.Kind{reflect.Slice}, Received: val} @@ -188,7 +197,7 @@ func (dvd DefaultValueDecoders) DDecodeValue(dc DecodeContext, vr bsonrw.ValueRe return nil } -func (dvd DefaultValueDecoders) booleanDecodeType(dctx DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (dvd DefaultValueDecoders) booleanDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t.Kind() != reflect.Bool { return emptyValue, ValueDecoderError{ Name: "BooleanDecodeValue", @@ -235,6 +244,9 @@ func (dvd DefaultValueDecoders) booleanDecodeType(dctx DecodeContext, vr bsonrw. } // BooleanDecodeValue is the ValueDecoderFunc for bool types. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) BooleanDecodeValue(dctx DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.IsValid() || !val.CanSet() || val.Kind() != reflect.Bool { return ValueDecoderError{Name: "BooleanDecodeValue", Kinds: []reflect.Kind{reflect.Bool}, Received: val} @@ -333,6 +345,9 @@ func (DefaultValueDecoders) intDecodeType(dc DecodeContext, vr bsonrw.ValueReade } // IntDecodeValue is the ValueDecoderFunc for int types. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) IntDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() { return ValueDecoderError{ @@ -434,7 +449,7 @@ func (dvd DefaultValueDecoders) UintDecodeValue(dc DecodeContext, vr bsonrw.Valu return nil } -func (dvd DefaultValueDecoders) floatDecodeType(ec DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (dvd DefaultValueDecoders) floatDecodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { var f float64 var err error switch vrType := vr.Type(); vrType { @@ -477,7 +492,7 @@ func (dvd DefaultValueDecoders) floatDecodeType(ec DecodeContext, vr bsonrw.Valu switch t.Kind() { case reflect.Float32: - if !ec.Truncate && float64(float32(f)) != f { + if !dc.Truncate && float64(float32(f)) != f { return emptyValue, errCannotTruncate } @@ -494,6 +509,9 @@ func (dvd DefaultValueDecoders) floatDecodeType(ec DecodeContext, vr bsonrw.Valu } // FloatDecodeValue is the ValueDecoderFunc for float types. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) FloatDecodeValue(ec DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() { return ValueDecoderError{ @@ -515,7 +533,7 @@ func (dvd DefaultValueDecoders) FloatDecodeValue(ec DecodeContext, vr bsonrw.Val // StringDecodeValue is the ValueDecoderFunc for string types. // // Deprecated: StringDecodeValue is not registered by default. Use StringCodec.DecodeValue instead. -func (dvd DefaultValueDecoders) StringDecodeValue(dctx DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { +func (dvd DefaultValueDecoders) StringDecodeValue(_ DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { var str string var err error switch vr.Type() { @@ -536,7 +554,7 @@ func (dvd DefaultValueDecoders) StringDecodeValue(dctx DecodeContext, vr bsonrw. return nil } -func (DefaultValueDecoders) javaScriptDecodeType(dctx DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (DefaultValueDecoders) javaScriptDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tJavaScript { return emptyValue, ValueDecoderError{ Name: "JavaScriptDecodeValue", @@ -565,6 +583,9 @@ func (DefaultValueDecoders) javaScriptDecodeType(dctx DecodeContext, vr bsonrw.V } // JavaScriptDecodeValue is the ValueDecoderFunc for the primitive.JavaScript type. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) JavaScriptDecodeValue(dctx DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tJavaScript { return ValueDecoderError{Name: "JavaScriptDecodeValue", Types: []reflect.Type{tJavaScript}, Received: val} @@ -579,7 +600,7 @@ func (dvd DefaultValueDecoders) JavaScriptDecodeValue(dctx DecodeContext, vr bso return nil } -func (DefaultValueDecoders) symbolDecodeType(dctx DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (DefaultValueDecoders) symbolDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tSymbol { return emptyValue, ValueDecoderError{ Name: "SymbolDecodeValue", @@ -620,6 +641,9 @@ func (DefaultValueDecoders) symbolDecodeType(dctx DecodeContext, vr bsonrw.Value } // SymbolDecodeValue is the ValueDecoderFunc for the primitive.Symbol type. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) SymbolDecodeValue(dctx DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tSymbol { return ValueDecoderError{Name: "SymbolDecodeValue", Types: []reflect.Type{tSymbol}, Received: val} @@ -634,7 +658,7 @@ func (dvd DefaultValueDecoders) SymbolDecodeValue(dctx DecodeContext, vr bsonrw. return nil } -func (DefaultValueDecoders) binaryDecodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (DefaultValueDecoders) binaryDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tBinary { return emptyValue, ValueDecoderError{ Name: "BinaryDecodeValue", @@ -664,6 +688,9 @@ func (DefaultValueDecoders) binaryDecodeType(dc DecodeContext, vr bsonrw.ValueRe } // BinaryDecodeValue is the ValueDecoderFunc for Binary. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) BinaryDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tBinary { return ValueDecoderError{Name: "BinaryDecodeValue", Types: []reflect.Type{tBinary}, Received: val} @@ -678,7 +705,7 @@ func (dvd DefaultValueDecoders) BinaryDecodeValue(dc DecodeContext, vr bsonrw.Va return nil } -func (DefaultValueDecoders) undefinedDecodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (DefaultValueDecoders) undefinedDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tUndefined { return emptyValue, ValueDecoderError{ Name: "UndefinedDecodeValue", @@ -704,6 +731,9 @@ func (DefaultValueDecoders) undefinedDecodeType(dc DecodeContext, vr bsonrw.Valu } // UndefinedDecodeValue is the ValueDecoderFunc for Undefined. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) UndefinedDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tUndefined { return ValueDecoderError{Name: "UndefinedDecodeValue", Types: []reflect.Type{tUndefined}, Received: val} @@ -719,7 +749,7 @@ func (dvd DefaultValueDecoders) UndefinedDecodeValue(dc DecodeContext, vr bsonrw } // Accept both 12-byte string and pretty-printed 24-byte hex string formats. -func (dvd DefaultValueDecoders) objectIDDecodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (dvd DefaultValueDecoders) objectIDDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tOID { return emptyValue, ValueDecoderError{ Name: "ObjectIDDecodeValue", @@ -765,6 +795,9 @@ func (dvd DefaultValueDecoders) objectIDDecodeType(dc DecodeContext, vr bsonrw.V } // ObjectIDDecodeValue is the ValueDecoderFunc for primitive.ObjectID. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) ObjectIDDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tOID { return ValueDecoderError{Name: "ObjectIDDecodeValue", Types: []reflect.Type{tOID}, Received: val} @@ -779,7 +812,7 @@ func (dvd DefaultValueDecoders) ObjectIDDecodeValue(dc DecodeContext, vr bsonrw. return nil } -func (DefaultValueDecoders) dateTimeDecodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (DefaultValueDecoders) dateTimeDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tDateTime { return emptyValue, ValueDecoderError{ Name: "DateTimeDecodeValue", @@ -808,6 +841,9 @@ func (DefaultValueDecoders) dateTimeDecodeType(dc DecodeContext, vr bsonrw.Value } // DateTimeDecodeValue is the ValueDecoderFunc for DateTime. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) DateTimeDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tDateTime { return ValueDecoderError{Name: "DateTimeDecodeValue", Types: []reflect.Type{tDateTime}, Received: val} @@ -822,7 +858,7 @@ func (dvd DefaultValueDecoders) DateTimeDecodeValue(dc DecodeContext, vr bsonrw. return nil } -func (DefaultValueDecoders) nullDecodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (DefaultValueDecoders) nullDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tNull { return emptyValue, ValueDecoderError{ Name: "NullDecodeValue", @@ -848,6 +884,9 @@ func (DefaultValueDecoders) nullDecodeType(dc DecodeContext, vr bsonrw.ValueRead } // NullDecodeValue is the ValueDecoderFunc for Null. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) NullDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tNull { return ValueDecoderError{Name: "NullDecodeValue", Types: []reflect.Type{tNull}, Received: val} @@ -862,7 +901,7 @@ func (dvd DefaultValueDecoders) NullDecodeValue(dc DecodeContext, vr bsonrw.Valu return nil } -func (DefaultValueDecoders) regexDecodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (DefaultValueDecoders) regexDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tRegex { return emptyValue, ValueDecoderError{ Name: "RegexDecodeValue", @@ -891,6 +930,9 @@ func (DefaultValueDecoders) regexDecodeType(dc DecodeContext, vr bsonrw.ValueRea } // RegexDecodeValue is the ValueDecoderFunc for Regex. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) RegexDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tRegex { return ValueDecoderError{Name: "RegexDecodeValue", Types: []reflect.Type{tRegex}, Received: val} @@ -905,7 +947,7 @@ func (dvd DefaultValueDecoders) RegexDecodeValue(dc DecodeContext, vr bsonrw.Val return nil } -func (DefaultValueDecoders) dBPointerDecodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (DefaultValueDecoders) dBPointerDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tDBPointer { return emptyValue, ValueDecoderError{ Name: "DBPointerDecodeValue", @@ -935,6 +977,9 @@ func (DefaultValueDecoders) dBPointerDecodeType(dc DecodeContext, vr bsonrw.Valu } // DBPointerDecodeValue is the ValueDecoderFunc for DBPointer. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) DBPointerDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tDBPointer { return ValueDecoderError{Name: "DBPointerDecodeValue", Types: []reflect.Type{tDBPointer}, Received: val} @@ -949,7 +994,7 @@ func (dvd DefaultValueDecoders) DBPointerDecodeValue(dc DecodeContext, vr bsonrw return nil } -func (DefaultValueDecoders) timestampDecodeType(dc DecodeContext, vr bsonrw.ValueReader, reflectType reflect.Type) (reflect.Value, error) { +func (DefaultValueDecoders) timestampDecodeType(_ DecodeContext, vr bsonrw.ValueReader, reflectType reflect.Type) (reflect.Value, error) { if reflectType != tTimestamp { return emptyValue, ValueDecoderError{ Name: "TimestampDecodeValue", @@ -978,6 +1023,9 @@ func (DefaultValueDecoders) timestampDecodeType(dc DecodeContext, vr bsonrw.Valu } // TimestampDecodeValue is the ValueDecoderFunc for Timestamp. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) TimestampDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tTimestamp { return ValueDecoderError{Name: "TimestampDecodeValue", Types: []reflect.Type{tTimestamp}, Received: val} @@ -992,7 +1040,7 @@ func (dvd DefaultValueDecoders) TimestampDecodeValue(dc DecodeContext, vr bsonrw return nil } -func (DefaultValueDecoders) minKeyDecodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (DefaultValueDecoders) minKeyDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tMinKey { return emptyValue, ValueDecoderError{ Name: "MinKeyDecodeValue", @@ -1020,6 +1068,9 @@ func (DefaultValueDecoders) minKeyDecodeType(dc DecodeContext, vr bsonrw.ValueRe } // MinKeyDecodeValue is the ValueDecoderFunc for MinKey. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) MinKeyDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tMinKey { return ValueDecoderError{Name: "MinKeyDecodeValue", Types: []reflect.Type{tMinKey}, Received: val} @@ -1034,7 +1085,7 @@ func (dvd DefaultValueDecoders) MinKeyDecodeValue(dc DecodeContext, vr bsonrw.Va return nil } -func (DefaultValueDecoders) maxKeyDecodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (DefaultValueDecoders) maxKeyDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tMaxKey { return emptyValue, ValueDecoderError{ Name: "MaxKeyDecodeValue", @@ -1062,6 +1113,9 @@ func (DefaultValueDecoders) maxKeyDecodeType(dc DecodeContext, vr bsonrw.ValueRe } // MaxKeyDecodeValue is the ValueDecoderFunc for MaxKey. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) MaxKeyDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tMaxKey { return ValueDecoderError{Name: "MaxKeyDecodeValue", Types: []reflect.Type{tMaxKey}, Received: val} @@ -1076,7 +1130,7 @@ func (dvd DefaultValueDecoders) MaxKeyDecodeValue(dc DecodeContext, vr bsonrw.Va return nil } -func (dvd DefaultValueDecoders) decimal128DecodeType(dctx DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (dvd DefaultValueDecoders) decimal128DecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tDecimal { return emptyValue, ValueDecoderError{ Name: "Decimal128DecodeValue", @@ -1105,6 +1159,9 @@ func (dvd DefaultValueDecoders) decimal128DecodeType(dctx DecodeContext, vr bson } // Decimal128DecodeValue is the ValueDecoderFunc for primitive.Decimal128. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) Decimal128DecodeValue(dctx DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tDecimal { return ValueDecoderError{Name: "Decimal128DecodeValue", Types: []reflect.Type{tDecimal}, Received: val} @@ -1119,7 +1176,7 @@ func (dvd DefaultValueDecoders) Decimal128DecodeValue(dctx DecodeContext, vr bso return nil } -func (dvd DefaultValueDecoders) jsonNumberDecodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (dvd DefaultValueDecoders) jsonNumberDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tJSONNumber { return emptyValue, ValueDecoderError{ Name: "JSONNumberDecodeValue", @@ -1164,6 +1221,9 @@ func (dvd DefaultValueDecoders) jsonNumberDecodeType(dc DecodeContext, vr bsonrw } // JSONNumberDecodeValue is the ValueDecoderFunc for json.Number. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) JSONNumberDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tJSONNumber { return ValueDecoderError{Name: "JSONNumberDecodeValue", Types: []reflect.Type{tJSONNumber}, Received: val} @@ -1178,7 +1238,7 @@ func (dvd DefaultValueDecoders) JSONNumberDecodeValue(dc DecodeContext, vr bsonr return nil } -func (dvd DefaultValueDecoders) urlDecodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (dvd DefaultValueDecoders) urlDecodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t != tURL { return emptyValue, ValueDecoderError{ Name: "URLDecodeValue", @@ -1213,6 +1273,9 @@ func (dvd DefaultValueDecoders) urlDecodeType(dc DecodeContext, vr bsonrw.ValueR } // URLDecodeValue is the ValueDecoderFunc for url.URL. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) URLDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tURL { return ValueDecoderError{Name: "URLDecodeValue", Types: []reflect.Type{tURL}, Received: val} @@ -1230,7 +1293,7 @@ func (dvd DefaultValueDecoders) URLDecodeValue(dc DecodeContext, vr bsonrw.Value // TimeDecodeValue is the ValueDecoderFunc for time.Time. // // Deprecated: TimeDecodeValue is not registered by default. Use TimeCodec.DecodeValue instead. -func (dvd DefaultValueDecoders) TimeDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { +func (dvd DefaultValueDecoders) TimeDecodeValue(_ DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if vr.Type() != bsontype.DateTime { return fmt.Errorf("cannot decode %v into a time.Time", vr.Type()) } @@ -1251,7 +1314,7 @@ func (dvd DefaultValueDecoders) TimeDecodeValue(dc DecodeContext, vr bsonrw.Valu // ByteSliceDecodeValue is the ValueDecoderFunc for []byte. // // Deprecated: ByteSliceDecodeValue is not registered by default. Use ByteSliceCodec.DecodeValue instead. -func (dvd DefaultValueDecoders) ByteSliceDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { +func (dvd DefaultValueDecoders) ByteSliceDecodeValue(_ DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if vr.Type() != bsontype.Binary && vr.Type() != bsontype.Null { return fmt.Errorf("cannot decode %v into a []byte", vr.Type()) } @@ -1336,6 +1399,9 @@ func (dvd DefaultValueDecoders) MapDecodeValue(dc DecodeContext, vr bsonrw.Value } // ArrayDecodeValue is the ValueDecoderFunc for array types. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) ArrayDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.IsValid() || val.Kind() != reflect.Array { return ValueDecoderError{Name: "ArrayDecodeValue", Kinds: []reflect.Kind{reflect.Array}, Received: val} @@ -1447,7 +1513,10 @@ func (dvd DefaultValueDecoders) SliceDecodeValue(dc DecodeContext, vr bsonrw.Val } // ValueUnmarshalerDecodeValue is the ValueDecoderFunc for ValueUnmarshaler implementations. -func (dvd DefaultValueDecoders) ValueUnmarshalerDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. +func (dvd DefaultValueDecoders) ValueUnmarshalerDecodeValue(_ DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.IsValid() || (!val.Type().Implements(tValueUnmarshaler) && !reflect.PtrTo(val.Type()).Implements(tValueUnmarshaler)) { return ValueDecoderError{Name: "ValueUnmarshalerDecodeValue", Types: []reflect.Type{tValueUnmarshaler}, Received: val} } @@ -1480,7 +1549,10 @@ func (dvd DefaultValueDecoders) ValueUnmarshalerDecodeValue(dc DecodeContext, vr } // UnmarshalerDecodeValue is the ValueDecoderFunc for Unmarshaler implementations. -func (dvd DefaultValueDecoders) UnmarshalerDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. +func (dvd DefaultValueDecoders) UnmarshalerDecodeValue(_ DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.IsValid() || (!val.Type().Implements(tUnmarshaler) && !reflect.PtrTo(val.Type()).Implements(tUnmarshaler)) { return ValueDecoderError{Name: "UnmarshalerDecodeValue", Types: []reflect.Type{tUnmarshaler}, Received: val} } @@ -1565,7 +1637,10 @@ func (dvd DefaultValueDecoders) EmptyInterfaceDecodeValue(dc DecodeContext, vr b } // CoreDocumentDecodeValue is the ValueDecoderFunc for bsoncore.Document. -func (DefaultValueDecoders) CoreDocumentDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. +func (DefaultValueDecoders) CoreDocumentDecodeValue(_ DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tCoreDocument { return ValueDecoderError{Name: "CoreDocumentDecodeValue", Types: []reflect.Type{tCoreDocument}, Received: val} } @@ -1671,6 +1746,9 @@ func (dvd DefaultValueDecoders) codeWithScopeDecodeType(dc DecodeContext, vr bso } // CodeWithScopeDecodeValue is the ValueDecoderFunc for CodeWithScope. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value decoders registered. func (dvd DefaultValueDecoders) CodeWithScopeDecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tCodeWithScope { return ValueDecoderError{Name: "CodeWithScopeDecodeValue", Types: []reflect.Type{tCodeWithScope}, Received: val} diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/default_value_encoders.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/default_value_encoders.go index 6bdb43cb43..7d526c4ef8 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/default_value_encoders.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/default_value_encoders.go @@ -58,10 +58,16 @@ func encodeElement(ec EncodeContext, dw bsonrw.DocumentWriter, e primitive.E) er // DefaultValueEncoders is a namespace type for the default ValueEncoders used // when creating a registry. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. type DefaultValueEncoders struct{} // RegisterDefaultEncoders will register the encoder methods attached to DefaultValueEncoders with // the provided RegistryBuilder. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. func (dve DefaultValueEncoders) RegisterDefaultEncoders(rb *RegistryBuilder) { if rb == nil { panic(errors.New("argument to RegisterDefaultEncoders must not be nil")) @@ -113,7 +119,10 @@ func (dve DefaultValueEncoders) RegisterDefaultEncoders(rb *RegistryBuilder) { } // BooleanEncodeValue is the ValueEncoderFunc for bool types. -func (dve DefaultValueEncoders) BooleanEncodeValue(ectx EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (dve DefaultValueEncoders) BooleanEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Kind() != reflect.Bool { return ValueEncoderError{Name: "BooleanEncodeValue", Kinds: []reflect.Kind{reflect.Bool}, Received: val} } @@ -125,6 +134,9 @@ func fitsIn32Bits(i int64) bool { } // IntEncodeValue is the ValueEncoderFunc for int types. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. func (dve DefaultValueEncoders) IntEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { switch val.Kind() { case reflect.Int8, reflect.Int16, reflect.Int32: @@ -176,7 +188,10 @@ func (dve DefaultValueEncoders) UintEncodeValue(ec EncodeContext, vw bsonrw.Valu } // FloatEncodeValue is the ValueEncoderFunc for float types. -func (dve DefaultValueEncoders) FloatEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (dve DefaultValueEncoders) FloatEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { switch val.Kind() { case reflect.Float32, reflect.Float64: return vw.WriteDouble(val.Float()) @@ -188,7 +203,7 @@ func (dve DefaultValueEncoders) FloatEncodeValue(ec EncodeContext, vw bsonrw.Val // StringEncodeValue is the ValueEncoderFunc for string types. // // Deprecated: StringEncodeValue is not registered by default. Use StringCodec.EncodeValue instead. -func (dve DefaultValueEncoders) StringEncodeValue(ectx EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +func (dve DefaultValueEncoders) StringEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if val.Kind() != reflect.String { return ValueEncoderError{ Name: "StringEncodeValue", @@ -201,7 +216,10 @@ func (dve DefaultValueEncoders) StringEncodeValue(ectx EncodeContext, vw bsonrw. } // ObjectIDEncodeValue is the ValueEncoderFunc for primitive.ObjectID. -func (dve DefaultValueEncoders) ObjectIDEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (dve DefaultValueEncoders) ObjectIDEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tOID { return ValueEncoderError{Name: "ObjectIDEncodeValue", Types: []reflect.Type{tOID}, Received: val} } @@ -209,7 +227,10 @@ func (dve DefaultValueEncoders) ObjectIDEncodeValue(ec EncodeContext, vw bsonrw. } // Decimal128EncodeValue is the ValueEncoderFunc for primitive.Decimal128. -func (dve DefaultValueEncoders) Decimal128EncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (dve DefaultValueEncoders) Decimal128EncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tDecimal { return ValueEncoderError{Name: "Decimal128EncodeValue", Types: []reflect.Type{tDecimal}, Received: val} } @@ -217,6 +238,9 @@ func (dve DefaultValueEncoders) Decimal128EncodeValue(ec EncodeContext, vw bsonr } // JSONNumberEncodeValue is the ValueEncoderFunc for json.Number. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. func (dve DefaultValueEncoders) JSONNumberEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tJSONNumber { return ValueEncoderError{Name: "JSONNumberEncodeValue", Types: []reflect.Type{tJSONNumber}, Received: val} @@ -237,7 +261,10 @@ func (dve DefaultValueEncoders) JSONNumberEncodeValue(ec EncodeContext, vw bsonr } // URLEncodeValue is the ValueEncoderFunc for url.URL. -func (dve DefaultValueEncoders) URLEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (dve DefaultValueEncoders) URLEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tURL { return ValueEncoderError{Name: "URLEncodeValue", Types: []reflect.Type{tURL}, Received: val} } @@ -248,7 +275,7 @@ func (dve DefaultValueEncoders) URLEncodeValue(ec EncodeContext, vw bsonrw.Value // TimeEncodeValue is the ValueEncoderFunc for time.TIme. // // Deprecated: TimeEncodeValue is not registered by default. Use TimeCodec.EncodeValue instead. -func (dve DefaultValueEncoders) TimeEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +func (dve DefaultValueEncoders) TimeEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tTime { return ValueEncoderError{Name: "TimeEncodeValue", Types: []reflect.Type{tTime}, Received: val} } @@ -260,7 +287,7 @@ func (dve DefaultValueEncoders) TimeEncodeValue(ec EncodeContext, vw bsonrw.Valu // ByteSliceEncodeValue is the ValueEncoderFunc for []byte. // // Deprecated: ByteSliceEncodeValue is not registered by default. Use ByteSliceCodec.EncodeValue instead. -func (dve DefaultValueEncoders) ByteSliceEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +func (dve DefaultValueEncoders) ByteSliceEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tByteSlice { return ValueEncoderError{Name: "ByteSliceEncodeValue", Types: []reflect.Type{tByteSlice}, Received: val} } @@ -343,6 +370,9 @@ func (dve DefaultValueEncoders) mapEncodeValue(ec EncodeContext, dw bsonrw.Docum } // ArrayEncodeValue is the ValueEncoderFunc for array types. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. func (dve DefaultValueEncoders) ArrayEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Kind() != reflect.Array { return ValueEncoderError{Name: "ArrayEncodeValue", Kinds: []reflect.Kind{reflect.Array}, Received: val} @@ -515,7 +545,10 @@ func (dve DefaultValueEncoders) EmptyInterfaceEncodeValue(ec EncodeContext, vw b } // ValueMarshalerEncodeValue is the ValueEncoderFunc for ValueMarshaler implementations. -func (dve DefaultValueEncoders) ValueMarshalerEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (dve DefaultValueEncoders) ValueMarshalerEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { // Either val or a pointer to val must implement ValueMarshaler switch { case !val.IsValid(): @@ -541,7 +574,10 @@ func (dve DefaultValueEncoders) ValueMarshalerEncodeValue(ec EncodeContext, vw b } // MarshalerEncodeValue is the ValueEncoderFunc for Marshaler implementations. -func (dve DefaultValueEncoders) MarshalerEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (dve DefaultValueEncoders) MarshalerEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { // Either val or a pointer to val must implement Marshaler switch { case !val.IsValid(): @@ -567,6 +603,9 @@ func (dve DefaultValueEncoders) MarshalerEncodeValue(ec EncodeContext, vw bsonrw } // ProxyEncodeValue is the ValueEncoderFunc for Proxy implementations. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. func (dve DefaultValueEncoders) ProxyEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { // Either val or a pointer to val must implement Proxy switch { @@ -603,7 +642,10 @@ func (dve DefaultValueEncoders) ProxyEncodeValue(ec EncodeContext, vw bsonrw.Val } // JavaScriptEncodeValue is the ValueEncoderFunc for the primitive.JavaScript type. -func (DefaultValueEncoders) JavaScriptEncodeValue(ectx EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (DefaultValueEncoders) JavaScriptEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tJavaScript { return ValueEncoderError{Name: "JavaScriptEncodeValue", Types: []reflect.Type{tJavaScript}, Received: val} } @@ -612,7 +654,10 @@ func (DefaultValueEncoders) JavaScriptEncodeValue(ectx EncodeContext, vw bsonrw. } // SymbolEncodeValue is the ValueEncoderFunc for the primitive.Symbol type. -func (DefaultValueEncoders) SymbolEncodeValue(ectx EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (DefaultValueEncoders) SymbolEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tSymbol { return ValueEncoderError{Name: "SymbolEncodeValue", Types: []reflect.Type{tSymbol}, Received: val} } @@ -621,7 +666,10 @@ func (DefaultValueEncoders) SymbolEncodeValue(ectx EncodeContext, vw bsonrw.Valu } // BinaryEncodeValue is the ValueEncoderFunc for Binary. -func (DefaultValueEncoders) BinaryEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (DefaultValueEncoders) BinaryEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tBinary { return ValueEncoderError{Name: "BinaryEncodeValue", Types: []reflect.Type{tBinary}, Received: val} } @@ -631,7 +679,10 @@ func (DefaultValueEncoders) BinaryEncodeValue(ec EncodeContext, vw bsonrw.ValueW } // UndefinedEncodeValue is the ValueEncoderFunc for Undefined. -func (DefaultValueEncoders) UndefinedEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (DefaultValueEncoders) UndefinedEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tUndefined { return ValueEncoderError{Name: "UndefinedEncodeValue", Types: []reflect.Type{tUndefined}, Received: val} } @@ -640,7 +691,10 @@ func (DefaultValueEncoders) UndefinedEncodeValue(ec EncodeContext, vw bsonrw.Val } // DateTimeEncodeValue is the ValueEncoderFunc for DateTime. -func (DefaultValueEncoders) DateTimeEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (DefaultValueEncoders) DateTimeEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tDateTime { return ValueEncoderError{Name: "DateTimeEncodeValue", Types: []reflect.Type{tDateTime}, Received: val} } @@ -649,7 +703,10 @@ func (DefaultValueEncoders) DateTimeEncodeValue(ec EncodeContext, vw bsonrw.Valu } // NullEncodeValue is the ValueEncoderFunc for Null. -func (DefaultValueEncoders) NullEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (DefaultValueEncoders) NullEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tNull { return ValueEncoderError{Name: "NullEncodeValue", Types: []reflect.Type{tNull}, Received: val} } @@ -658,7 +715,10 @@ func (DefaultValueEncoders) NullEncodeValue(ec EncodeContext, vw bsonrw.ValueWri } // RegexEncodeValue is the ValueEncoderFunc for Regex. -func (DefaultValueEncoders) RegexEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (DefaultValueEncoders) RegexEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tRegex { return ValueEncoderError{Name: "RegexEncodeValue", Types: []reflect.Type{tRegex}, Received: val} } @@ -669,7 +729,10 @@ func (DefaultValueEncoders) RegexEncodeValue(ec EncodeContext, vw bsonrw.ValueWr } // DBPointerEncodeValue is the ValueEncoderFunc for DBPointer. -func (DefaultValueEncoders) DBPointerEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (DefaultValueEncoders) DBPointerEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tDBPointer { return ValueEncoderError{Name: "DBPointerEncodeValue", Types: []reflect.Type{tDBPointer}, Received: val} } @@ -680,7 +743,10 @@ func (DefaultValueEncoders) DBPointerEncodeValue(ec EncodeContext, vw bsonrw.Val } // TimestampEncodeValue is the ValueEncoderFunc for Timestamp. -func (DefaultValueEncoders) TimestampEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (DefaultValueEncoders) TimestampEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tTimestamp { return ValueEncoderError{Name: "TimestampEncodeValue", Types: []reflect.Type{tTimestamp}, Received: val} } @@ -691,7 +757,10 @@ func (DefaultValueEncoders) TimestampEncodeValue(ec EncodeContext, vw bsonrw.Val } // MinKeyEncodeValue is the ValueEncoderFunc for MinKey. -func (DefaultValueEncoders) MinKeyEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (DefaultValueEncoders) MinKeyEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tMinKey { return ValueEncoderError{Name: "MinKeyEncodeValue", Types: []reflect.Type{tMinKey}, Received: val} } @@ -700,7 +769,10 @@ func (DefaultValueEncoders) MinKeyEncodeValue(ec EncodeContext, vw bsonrw.ValueW } // MaxKeyEncodeValue is the ValueEncoderFunc for MaxKey. -func (DefaultValueEncoders) MaxKeyEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (DefaultValueEncoders) MaxKeyEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tMaxKey { return ValueEncoderError{Name: "MaxKeyEncodeValue", Types: []reflect.Type{tMaxKey}, Received: val} } @@ -709,7 +781,10 @@ func (DefaultValueEncoders) MaxKeyEncodeValue(ec EncodeContext, vw bsonrw.ValueW } // CoreDocumentEncodeValue is the ValueEncoderFunc for bsoncore.Document. -func (DefaultValueEncoders) CoreDocumentEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. +func (DefaultValueEncoders) CoreDocumentEncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tCoreDocument { return ValueEncoderError{Name: "CoreDocumentEncodeValue", Types: []reflect.Type{tCoreDocument}, Received: val} } @@ -720,6 +795,9 @@ func (DefaultValueEncoders) CoreDocumentEncodeValue(ec EncodeContext, vw bsonrw. } // CodeWithScopeEncodeValue is the ValueEncoderFunc for CodeWithScope. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with all default +// value encoders registered. func (dve DefaultValueEncoders) CodeWithScopeEncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tCodeWithScope { return ValueEncoderError{Name: "CodeWithScopeEncodeValue", Types: []reflect.Type{tCodeWithScope}, Received: val} diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/doc.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/doc.go index 5f903ebea6..4613e5a1ec 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/doc.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/doc.go @@ -31,35 +31,39 @@ // allow the use of a function with the correct signature as a ValueDecoder. A DecodeContext // instance is provided and serves similar functionality to the EncodeContext. // -// # Registry and RegistryBuilder -// -// A Registry is an immutable store for ValueEncoders, ValueDecoders, and a type map. See the Registry type -// documentation for examples of registering various custom encoders and decoders. A Registry can be constructed using a -// RegistryBuilder, which handles three main types of codecs: -// -// 1. Type encoders/decoders - These can be registered using the RegisterTypeEncoder and RegisterTypeDecoder methods. -// The registered codec will be invoked when encoding/decoding a value whose type matches the registered type exactly. -// If the registered type is an interface, the codec will be invoked when encoding or decoding values whose type is the -// interface, but not for values with concrete types that implement the interface. -// -// 2. Hook encoders/decoders - These can be registered using the RegisterHookEncoder and RegisterHookDecoder methods. -// These methods only accept interface types and the registered codecs will be invoked when encoding or decoding values -// whose types implement the interface. An example of a hook defined by the driver is bson.Marshaler. The driver will -// call the MarshalBSON method for any value whose type implements bson.Marshaler, regardless of the value's concrete -// type. -// -// 3. Type map entries - This can be used to associate a BSON type with a Go type. These type associations are used when -// decoding into a bson.D/bson.M or a struct field of type interface{}. For example, by default, BSON int32 and int64 -// values decode as Go int32 and int64 instances, respectively, when decoding into a bson.D. The following code would -// change the behavior so these values decode as Go int instances instead: +// # Registry +// +// A Registry is a store for ValueEncoders, ValueDecoders, and a type map. See the Registry type +// documentation for examples of registering various custom encoders and decoders. A Registry can +// have three main types of codecs: +// +// 1. Type encoders/decoders - These can be registered using the RegisterTypeEncoder and +// RegisterTypeDecoder methods. The registered codec will be invoked when encoding/decoding a value +// whose type matches the registered type exactly. +// If the registered type is an interface, the codec will be invoked when encoding or decoding +// values whose type is the interface, but not for values with concrete types that implement the +// interface. +// +// 2. Hook encoders/decoders - These can be registered using the RegisterHookEncoder and +// RegisterHookDecoder methods. These methods only accept interface types and the registered codecs +// will be invoked when encoding or decoding values whose types implement the interface. An example +// of a hook defined by the driver is bson.Marshaler. The driver will call the MarshalBSON method +// for any value whose type implements bson.Marshaler, regardless of the value's concrete type. +// +// 3. Type map entries - This can be used to associate a BSON type with a Go type. These type +// associations are used when decoding into a bson.D/bson.M or a struct field of type interface{}. +// For example, by default, BSON int32 and int64 values decode as Go int32 and int64 instances, +// respectively, when decoding into a bson.D. The following code would change the behavior so these +// values decode as Go int instances instead: // // intType := reflect.TypeOf(int(0)) -// registryBuilder.RegisterTypeMapEntry(bsontype.Int32, intType).RegisterTypeMapEntry(bsontype.Int64, intType) +// registry.RegisterTypeMapEntry(bsontype.Int32, intType).RegisterTypeMapEntry(bsontype.Int64, intType) // -// 4. Kind encoder/decoders - These can be registered using the RegisterDefaultEncoder and RegisterDefaultDecoder -// methods. The registered codec will be invoked when encoding or decoding values whose reflect.Kind matches the -// registered reflect.Kind as long as the value's type doesn't match a registered type or hook encoder/decoder first. -// These methods should be used to change the behavior for all values for a specific kind. +// 4. Kind encoder/decoders - These can be registered using the RegisterDefaultEncoder and +// RegisterDefaultDecoder methods. The registered codec will be invoked when encoding or decoding +// values whose reflect.Kind matches the registered reflect.Kind as long as the value's type doesn't +// match a registered type or hook encoder/decoder first. These methods should be used to change the +// behavior for all values for a specific kind. // // # Registry Lookup Procedure // @@ -67,17 +71,18 @@ // // 1. A type encoder registered for the exact type of the value. // -// 2. A hook encoder registered for an interface that is implemented by the value or by a pointer to the value. If the -// value matches multiple hooks (e.g. the type implements bsoncodec.Marshaler and bsoncodec.ValueMarshaler), the first -// one registered will be selected. Note that registries constructed using bson.NewRegistryBuilder have driver-defined -// hooks registered for the bsoncodec.Marshaler, bsoncodec.ValueMarshaler, and bsoncodec.Proxy interfaces, so those -// will take precedence over any new hooks. +// 2. A hook encoder registered for an interface that is implemented by the value or by a pointer to +// the value. If the value matches multiple hooks (e.g. the type implements bsoncodec.Marshaler and +// bsoncodec.ValueMarshaler), the first one registered will be selected. Note that registries +// constructed using bson.NewRegistry have driver-defined hooks registered for the +// bsoncodec.Marshaler, bsoncodec.ValueMarshaler, and bsoncodec.Proxy interfaces, so those will take +// precedence over any new hooks. // // 3. A kind encoder registered for the value's kind. // -// If all of these lookups fail to find an encoder, an error of type ErrNoEncoder is returned. The same precedence -// rules apply for decoders, with the exception that an error of type ErrNoDecoder will be returned if no decoder is -// found. +// If all of these lookups fail to find an encoder, an error of type ErrNoEncoder is returned. The +// same precedence rules apply for decoders, with the exception that an error of type ErrNoDecoder +// will be returned if no decoder is found. // // # DefaultValueEncoders and DefaultValueDecoders // diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/empty_interface_codec.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/empty_interface_codec.go index eda417cff8..94f7dcf1eb 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/empty_interface_codec.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/empty_interface_codec.go @@ -16,18 +16,30 @@ import ( ) // EmptyInterfaceCodec is the Codec used for interface{} values. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// EmptyInterfaceCodec registered. type EmptyInterfaceCodec struct { + // DecodeBinaryAsSlice causes DecodeValue to unmarshal BSON binary field values that are the + // "Generic" or "Old" BSON binary subtype as a Go byte slice instead of a primitive.Binary. + // + // Deprecated: Use bson.Decoder.BinaryAsSlice instead. DecodeBinaryAsSlice bool } var ( defaultEmptyInterfaceCodec = NewEmptyInterfaceCodec() - _ ValueCodec = defaultEmptyInterfaceCodec + // Assert that defaultEmptyInterfaceCodec satisfies the typeDecoder interface, which allows it + // to be used by collection type decoders (e.g. map, slice, etc) to set individual values in a + // collection. _ typeDecoder = defaultEmptyInterfaceCodec ) // NewEmptyInterfaceCodec returns a EmptyInterfaceCodec with options opts. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// EmptyInterfaceCodec registered. func NewEmptyInterfaceCodec(opts ...*bsonoptions.EmptyInterfaceCodecOptions) *EmptyInterfaceCodec { interfaceOpt := bsonoptions.MergeEmptyInterfaceCodecOptions(opts...) @@ -121,7 +133,7 @@ func (eic EmptyInterfaceCodec) decodeType(dc DecodeContext, vr bsonrw.ValueReade return emptyValue, err } - if eic.DecodeBinaryAsSlice && rtype == tBinary { + if (eic.DecodeBinaryAsSlice || dc.binaryAsSlice) && rtype == tBinary { binElem := elem.Interface().(primitive.Binary) if binElem.Subtype == bsontype.BinaryGeneric || binElem.Subtype == bsontype.BinaryBinaryOld { elem = reflect.ValueOf(binElem.Data) diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/map_codec.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/map_codec.go index e1fbef9c6c..325c1738ab 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/map_codec.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/map_codec.go @@ -20,14 +20,29 @@ import ( var defaultMapCodec = NewMapCodec() // MapCodec is the Codec used for map values. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// MapCodec registered. type MapCodec struct { - DecodeZerosMap bool - EncodeNilAsEmpty bool + // DecodeZerosMap causes DecodeValue to delete any existing values from Go maps in the destination + // value passed to Decode before unmarshaling BSON documents into them. + // + // Deprecated: Use bson.Decoder.ZeroMaps instead. + DecodeZerosMap bool + + // EncodeNilAsEmpty causes EncodeValue to marshal nil Go maps as empty BSON documents instead of + // BSON null. + // + // Deprecated: Use bson.Encoder.NilMapAsEmpty instead. + EncodeNilAsEmpty bool + + // EncodeKeysWithStringer causes the Encoder to convert Go map keys to BSON document field name + // strings using fmt.Sprintf() instead of the default string conversion logic. + // + // Deprecated: Use bson.Encoder.StringifyMapKeysWithFmt instead. EncodeKeysWithStringer bool } -var _ ValueCodec = &MapCodec{} - // KeyMarshaler is the interface implemented by an object that can marshal itself into a string key. // This applies to types used as map keys and is similar to encoding.TextMarshaler. type KeyMarshaler interface { @@ -45,6 +60,9 @@ type KeyUnmarshaler interface { } // NewMapCodec returns a MapCodec with options opts. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// MapCodec registered. func NewMapCodec(opts ...*bsonoptions.MapCodecOptions) *MapCodec { mapOpt := bsonoptions.MergeMapCodecOptions(opts...) @@ -67,7 +85,7 @@ func (mc *MapCodec) EncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val ref return ValueEncoderError{Name: "MapEncodeValue", Kinds: []reflect.Kind{reflect.Map}, Received: val} } - if val.IsNil() && !mc.EncodeNilAsEmpty { + if val.IsNil() && !mc.EncodeNilAsEmpty && !ec.nilMapAsEmpty { // If we have a nil map but we can't WriteNull, that means we're probably trying to encode // to a TopLevel document. We can't currently tell if this is what actually happened, but if // there's a deeper underlying problem, the error will also be returned from WriteDocument, @@ -100,7 +118,7 @@ func (mc *MapCodec) mapEncodeValue(ec EncodeContext, dw bsonrw.DocumentWriter, v keys := val.MapKeys() for _, key := range keys { - keyStr, err := mc.encodeKey(key) + keyStr, err := mc.encodeKey(key, ec.stringifyMapKeysWithFmt) if err != nil { return err } @@ -163,7 +181,7 @@ func (mc *MapCodec) DecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val ref val.Set(reflect.MakeMap(val.Type())) } - if val.Len() > 0 && mc.DecodeZerosMap { + if val.Len() > 0 && (mc.DecodeZerosMap || dc.zeroMaps) { clearMap(val) } @@ -211,8 +229,8 @@ func clearMap(m reflect.Value) { } } -func (mc *MapCodec) encodeKey(val reflect.Value) (string, error) { - if mc.EncodeKeysWithStringer { +func (mc *MapCodec) encodeKey(val reflect.Value, encodeKeysWithStringer bool) (string, error) { + if mc.EncodeKeysWithStringer || encodeKeysWithStringer { return fmt.Sprint(val), nil } diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/pointer_codec.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/pointer_codec.go index 616a3e701b..a1bf9c3e2b 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/pointer_codec.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/pointer_codec.go @@ -18,6 +18,9 @@ var _ ValueEncoder = &PointerCodec{} var _ ValueDecoder = &PointerCodec{} // PointerCodec is the Codec used for pointers. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// PointerCodec registered. type PointerCodec struct { ecache map[reflect.Type]ValueEncoder dcache map[reflect.Type]ValueDecoder @@ -25,6 +28,9 @@ type PointerCodec struct { } // NewPointerCodec returns a PointerCodec that has been initialized. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// PointerCodec registered. func NewPointerCodec() *PointerCodec { return &PointerCodec{ ecache: make(map[reflect.Type]ValueEncoder), diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/registry.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/registry.go index 80644023c2..930de28490 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/registry.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/registry.go @@ -16,12 +16,18 @@ import ( ) // ErrNilType is returned when nil is passed to either LookupEncoder or LookupDecoder. +// +// Deprecated: ErrNilType will not be supported in Go Driver 2.0. var ErrNilType = errors.New("cannot perform a decoder lookup on <nil>") // ErrNotPointer is returned when a non-pointer type is provided to LookupDecoder. +// +// Deprecated: ErrNotPointer will not be supported in Go Driver 2.0. var ErrNotPointer = errors.New("non-pointer provided to LookupDecoder") // ErrNoEncoder is returned when there wasn't an encoder available for a type. +// +// Deprecated: ErrNoEncoder will not be supported in Go Driver 2.0. type ErrNoEncoder struct { Type reflect.Type } @@ -34,6 +40,8 @@ func (ene ErrNoEncoder) Error() string { } // ErrNoDecoder is returned when there wasn't a decoder available for a type. +// +// Deprecated: ErrNoDecoder will not be supported in Go Driver 2.0. type ErrNoDecoder struct { Type reflect.Type } @@ -43,6 +51,8 @@ func (end ErrNoDecoder) Error() string { } // ErrNoTypeMapEntry is returned when there wasn't a type available for the provided BSON type. +// +// Deprecated: ErrNoTypeMapEntry will not be supported in Go Driver 2.0. type ErrNoTypeMapEntry struct { Type bsontype.Type } @@ -52,63 +62,30 @@ func (entme ErrNoTypeMapEntry) Error() string { } // ErrNotInterface is returned when the provided type is not an interface. +// +// Deprecated: ErrNotInterface will not be supported in Go Driver 2.0. var ErrNotInterface = errors.New("The provided type is not an interface") // A RegistryBuilder is used to build a Registry. This type is not goroutine // safe. +// +// Deprecated: Use Registry instead. type RegistryBuilder struct { - typeEncoders map[reflect.Type]ValueEncoder - interfaceEncoders []interfaceValueEncoder - kindEncoders map[reflect.Kind]ValueEncoder - - typeDecoders map[reflect.Type]ValueDecoder - interfaceDecoders []interfaceValueDecoder - kindDecoders map[reflect.Kind]ValueDecoder - - typeMap map[bsontype.Type]reflect.Type -} - -// A Registry is used to store and retrieve codecs for types and interfaces. This type is the main -// typed passed around and Encoders and Decoders are constructed from it. -type Registry struct { - typeEncoders map[reflect.Type]ValueEncoder - typeDecoders map[reflect.Type]ValueDecoder - - interfaceEncoders []interfaceValueEncoder - interfaceDecoders []interfaceValueDecoder - - kindEncoders map[reflect.Kind]ValueEncoder - kindDecoders map[reflect.Kind]ValueDecoder - - typeMap map[bsontype.Type]reflect.Type - - mu sync.RWMutex + registry *Registry } // NewRegistryBuilder creates a new empty RegistryBuilder. +// +// Deprecated: Use NewRegistry instead. func NewRegistryBuilder() *RegistryBuilder { return &RegistryBuilder{ - typeEncoders: make(map[reflect.Type]ValueEncoder), - typeDecoders: make(map[reflect.Type]ValueDecoder), - - interfaceEncoders: make([]interfaceValueEncoder, 0), - interfaceDecoders: make([]interfaceValueDecoder, 0), - - kindEncoders: make(map[reflect.Kind]ValueEncoder), - kindDecoders: make(map[reflect.Kind]ValueDecoder), - - typeMap: make(map[bsontype.Type]reflect.Type), + registry: NewRegistry(), } } -func buildDefaultRegistry() *Registry { - rb := NewRegistryBuilder() - defaultValueEncoders.RegisterDefaultEncoders(rb) - defaultValueDecoders.RegisterDefaultDecoders(rb) - return rb.Build() -} - // RegisterCodec will register the provided ValueCodec for the provided type. +// +// Deprecated: Use Registry.RegisterTypeEncoder and Registry.RegisterTypeDecoder instead. func (rb *RegistryBuilder) RegisterCodec(t reflect.Type, codec ValueCodec) *RegistryBuilder { rb.RegisterTypeEncoder(t, codec) rb.RegisterTypeDecoder(t, codec) @@ -120,31 +97,22 @@ func (rb *RegistryBuilder) RegisterCodec(t reflect.Type, codec ValueCodec) *Regi // The type will be used directly, so an encoder can be registered for a type and a different encoder can be registered // for a pointer to that type. // -// If the given type is an interface, the encoder will be called when marshalling a type that is that interface. It -// will not be called when marshalling a non-interface type that implements the interface. +// If the given type is an interface, the encoder will be called when marshaling a type that is that interface. It +// will not be called when marshaling a non-interface type that implements the interface. +// +// Deprecated: Use Registry.RegisterTypeEncoder instead. func (rb *RegistryBuilder) RegisterTypeEncoder(t reflect.Type, enc ValueEncoder) *RegistryBuilder { - rb.typeEncoders[t] = enc + rb.registry.RegisterTypeEncoder(t, enc) return rb } // RegisterHookEncoder will register an encoder for the provided interface type t. This encoder will be called when -// marshalling a type if the type implements t or a pointer to the type implements t. If the provided type is not +// marshaling a type if the type implements t or a pointer to the type implements t. If the provided type is not // an interface (i.e. t.Kind() != reflect.Interface), this method will panic. +// +// Deprecated: Use Registry.RegisterInterfaceEncoder instead. func (rb *RegistryBuilder) RegisterHookEncoder(t reflect.Type, enc ValueEncoder) *RegistryBuilder { - if t.Kind() != reflect.Interface { - panicStr := fmt.Sprintf("RegisterHookEncoder expects a type with kind reflect.Interface, "+ - "got type %s with kind %s", t, t.Kind()) - panic(panicStr) - } - - for idx, encoder := range rb.interfaceEncoders { - if encoder.i == t { - rb.interfaceEncoders[idx].ve = enc - return rb - } - } - - rb.interfaceEncoders = append(rb.interfaceEncoders, interfaceValueEncoder{i: t, ve: enc}) + rb.registry.RegisterInterfaceEncoder(t, enc) return rb } @@ -153,97 +121,78 @@ func (rb *RegistryBuilder) RegisterHookEncoder(t reflect.Type, enc ValueEncoder) // The type will be used directly, so a decoder can be registered for a type and a different decoder can be registered // for a pointer to that type. // -// If the given type is an interface, the decoder will be called when unmarshalling into a type that is that interface. -// It will not be called when unmarshalling into a non-interface type that implements the interface. +// If the given type is an interface, the decoder will be called when unmarshaling into a type that is that interface. +// It will not be called when unmarshaling into a non-interface type that implements the interface. +// +// Deprecated: Use Registry.RegisterTypeDecoder instead. func (rb *RegistryBuilder) RegisterTypeDecoder(t reflect.Type, dec ValueDecoder) *RegistryBuilder { - rb.typeDecoders[t] = dec + rb.registry.RegisterTypeDecoder(t, dec) return rb } // RegisterHookDecoder will register an decoder for the provided interface type t. This decoder will be called when -// unmarshalling into a type if the type implements t or a pointer to the type implements t. If the provided type is not +// unmarshaling into a type if the type implements t or a pointer to the type implements t. If the provided type is not // an interface (i.e. t.Kind() != reflect.Interface), this method will panic. +// +// Deprecated: Use Registry.RegisterInterfaceDecoder instead. func (rb *RegistryBuilder) RegisterHookDecoder(t reflect.Type, dec ValueDecoder) *RegistryBuilder { - if t.Kind() != reflect.Interface { - panicStr := fmt.Sprintf("RegisterHookDecoder expects a type with kind reflect.Interface, "+ - "got type %s with kind %s", t, t.Kind()) - panic(panicStr) - } - - for idx, decoder := range rb.interfaceDecoders { - if decoder.i == t { - rb.interfaceDecoders[idx].vd = dec - return rb - } - } - - rb.interfaceDecoders = append(rb.interfaceDecoders, interfaceValueDecoder{i: t, vd: dec}) + rb.registry.RegisterInterfaceDecoder(t, dec) return rb } // RegisterEncoder registers the provided type and encoder pair. // -// Deprecated: Use RegisterTypeEncoder or RegisterHookEncoder instead. +// Deprecated: Use Registry.RegisterTypeEncoder or Registry.RegisterInterfaceEncoder instead. func (rb *RegistryBuilder) RegisterEncoder(t reflect.Type, enc ValueEncoder) *RegistryBuilder { if t == tEmpty { - rb.typeEncoders[t] = enc + rb.registry.RegisterTypeEncoder(t, enc) return rb } switch t.Kind() { case reflect.Interface: - for idx, ir := range rb.interfaceEncoders { - if ir.i == t { - rb.interfaceEncoders[idx].ve = enc - return rb - } - } - - rb.interfaceEncoders = append(rb.interfaceEncoders, interfaceValueEncoder{i: t, ve: enc}) + rb.registry.RegisterInterfaceEncoder(t, enc) default: - rb.typeEncoders[t] = enc + rb.registry.RegisterTypeEncoder(t, enc) } return rb } // RegisterDecoder registers the provided type and decoder pair. // -// Deprecated: Use RegisterTypeDecoder or RegisterHookDecoder instead. +// Deprecated: Use Registry.RegisterTypeDecoder or Registry.RegisterInterfaceDecoder instead. func (rb *RegistryBuilder) RegisterDecoder(t reflect.Type, dec ValueDecoder) *RegistryBuilder { if t == nil { - rb.typeDecoders[nil] = dec + rb.registry.RegisterTypeDecoder(t, dec) return rb } if t == tEmpty { - rb.typeDecoders[t] = dec + rb.registry.RegisterTypeDecoder(t, dec) return rb } switch t.Kind() { case reflect.Interface: - for idx, ir := range rb.interfaceDecoders { - if ir.i == t { - rb.interfaceDecoders[idx].vd = dec - return rb - } - } - - rb.interfaceDecoders = append(rb.interfaceDecoders, interfaceValueDecoder{i: t, vd: dec}) + rb.registry.RegisterInterfaceDecoder(t, dec) default: - rb.typeDecoders[t] = dec + rb.registry.RegisterTypeDecoder(t, dec) } return rb } -// RegisterDefaultEncoder will registr the provided ValueEncoder to the provided +// RegisterDefaultEncoder will register the provided ValueEncoder to the provided // kind. +// +// Deprecated: Use Registry.RegisterKindEncoder instead. func (rb *RegistryBuilder) RegisterDefaultEncoder(kind reflect.Kind, enc ValueEncoder) *RegistryBuilder { - rb.kindEncoders[kind] = enc + rb.registry.RegisterKindEncoder(kind, enc) return rb } // RegisterDefaultDecoder will register the provided ValueDecoder to the // provided kind. +// +// Deprecated: Use Registry.RegisterKindDecoder instead. func (rb *RegistryBuilder) RegisterDefaultDecoder(kind reflect.Kind, dec ValueDecoder) *RegistryBuilder { - rb.kindDecoders[kind] = dec + rb.registry.RegisterKindDecoder(kind, dec) return rb } @@ -256,120 +205,277 @@ func (rb *RegistryBuilder) RegisterDefaultDecoder(kind reflect.Kind, dec ValueDe // to decode to bson.Raw, use the following code: // // rb.RegisterTypeMapEntry(bsontype.EmbeddedDocument, reflect.TypeOf(bson.Raw{})) +// +// Deprecated: Use Registry.RegisterTypeMapEntry instead. func (rb *RegistryBuilder) RegisterTypeMapEntry(bt bsontype.Type, rt reflect.Type) *RegistryBuilder { - rb.typeMap[bt] = rt + rb.registry.RegisterTypeMapEntry(bt, rt) return rb } // Build creates a Registry from the current state of this RegistryBuilder. +// +// Deprecated: Use NewRegistry instead. func (rb *RegistryBuilder) Build() *Registry { registry := new(Registry) - registry.typeEncoders = make(map[reflect.Type]ValueEncoder) - for t, enc := range rb.typeEncoders { + registry.typeEncoders = make(map[reflect.Type]ValueEncoder, len(rb.registry.typeEncoders)) + for t, enc := range rb.registry.typeEncoders { registry.typeEncoders[t] = enc } - registry.typeDecoders = make(map[reflect.Type]ValueDecoder) - for t, dec := range rb.typeDecoders { + registry.typeDecoders = make(map[reflect.Type]ValueDecoder, len(rb.registry.typeDecoders)) + for t, dec := range rb.registry.typeDecoders { registry.typeDecoders[t] = dec } - registry.interfaceEncoders = make([]interfaceValueEncoder, len(rb.interfaceEncoders)) - copy(registry.interfaceEncoders, rb.interfaceEncoders) + registry.interfaceEncoders = make([]interfaceValueEncoder, len(rb.registry.interfaceEncoders)) + copy(registry.interfaceEncoders, rb.registry.interfaceEncoders) - registry.interfaceDecoders = make([]interfaceValueDecoder, len(rb.interfaceDecoders)) - copy(registry.interfaceDecoders, rb.interfaceDecoders) + registry.interfaceDecoders = make([]interfaceValueDecoder, len(rb.registry.interfaceDecoders)) + copy(registry.interfaceDecoders, rb.registry.interfaceDecoders) registry.kindEncoders = make(map[reflect.Kind]ValueEncoder) - for kind, enc := range rb.kindEncoders { + for kind, enc := range rb.registry.kindEncoders { registry.kindEncoders[kind] = enc } registry.kindDecoders = make(map[reflect.Kind]ValueDecoder) - for kind, dec := range rb.kindDecoders { + for kind, dec := range rb.registry.kindDecoders { registry.kindDecoders[kind] = dec } registry.typeMap = make(map[bsontype.Type]reflect.Type) - for bt, rt := range rb.typeMap { + for bt, rt := range rb.registry.typeMap { registry.typeMap[bt] = rt } return registry } -// LookupEncoder inspects the registry for an encoder for the given type. The lookup precedence works as follows: +// A Registry is used to store and retrieve codecs for types and interfaces. This type is the main +// typed passed around and Encoders and Decoders are constructed from it. +type Registry struct { + typeEncoders map[reflect.Type]ValueEncoder + typeDecoders map[reflect.Type]ValueDecoder + + interfaceEncoders []interfaceValueEncoder + interfaceDecoders []interfaceValueDecoder + + kindEncoders map[reflect.Kind]ValueEncoder + kindDecoders map[reflect.Kind]ValueDecoder + + typeMap map[bsontype.Type]reflect.Type + + mu sync.RWMutex +} + +// NewRegistry creates a new empty Registry. +func NewRegistry() *Registry { + return &Registry{ + typeEncoders: make(map[reflect.Type]ValueEncoder), + typeDecoders: make(map[reflect.Type]ValueDecoder), + + interfaceEncoders: make([]interfaceValueEncoder, 0), + interfaceDecoders: make([]interfaceValueDecoder, 0), + + kindEncoders: make(map[reflect.Kind]ValueEncoder), + kindDecoders: make(map[reflect.Kind]ValueDecoder), + + typeMap: make(map[bsontype.Type]reflect.Type), + } +} + +// RegisterTypeEncoder registers the provided ValueEncoder for the provided type. +// +// The type will be used as provided, so an encoder can be registered for a type and a different +// encoder can be registered for a pointer to that type. +// +// If the given type is an interface, the encoder will be called when marshaling a type that is +// that interface. It will not be called when marshaling a non-interface type that implements the +// interface. To get the latter behavior, call RegisterHookEncoder instead. +// +// RegisterTypeEncoder should not be called concurrently with any other Registry method. +func (r *Registry) RegisterTypeEncoder(valueType reflect.Type, enc ValueEncoder) { + r.typeEncoders[valueType] = enc +} + +// RegisterTypeDecoder registers the provided ValueDecoder for the provided type. +// +// The type will be used as provided, so a decoder can be registered for a type and a different +// decoder can be registered for a pointer to that type. +// +// If the given type is an interface, the decoder will be called when unmarshaling into a type that +// is that interface. It will not be called when unmarshaling into a non-interface type that +// implements the interface. To get the latter behavior, call RegisterHookDecoder instead. +// +// RegisterTypeDecoder should not be called concurrently with any other Registry method. +func (r *Registry) RegisterTypeDecoder(valueType reflect.Type, dec ValueDecoder) { + r.typeDecoders[valueType] = dec +} + +// RegisterKindEncoder registers the provided ValueEncoder for the provided kind. +// +// Use RegisterKindEncoder to register an encoder for any type with the same underlying kind. For +// example, consider the type MyInt defined as +// +// type MyInt int32 +// +// To define an encoder for MyInt and int32, use RegisterKindEncoder like +// +// reg.RegisterKindEncoder(reflect.Int32, myEncoder) +// +// RegisterKindEncoder should not be called concurrently with any other Registry method. +func (r *Registry) RegisterKindEncoder(kind reflect.Kind, enc ValueEncoder) { + r.kindEncoders[kind] = enc +} + +// RegisterKindDecoder registers the provided ValueDecoder for the provided kind. +// +// Use RegisterKindDecoder to register a decoder for any type with the same underlying kind. For +// example, consider the type MyInt defined as // -// 1. An encoder registered for the exact type. If the given type represents an interface, an encoder registered using -// RegisterTypeEncoder for the interface will be selected. +// type MyInt int32 // -// 2. An encoder registered using RegisterHookEncoder for an interface implemented by the type or by a pointer to the -// type. +// To define an decoder for MyInt and int32, use RegisterKindDecoder like // -// 3. An encoder registered for the reflect.Kind of the value. +// reg.RegisterKindDecoder(reflect.Int32, myDecoder) // -// If no encoder is found, an error of type ErrNoEncoder is returned. -func (r *Registry) LookupEncoder(t reflect.Type) (ValueEncoder, error) { - encodererr := ErrNoEncoder{Type: t} +// RegisterKindDecoder should not be called concurrently with any other Registry method. +func (r *Registry) RegisterKindDecoder(kind reflect.Kind, dec ValueDecoder) { + r.kindDecoders[kind] = dec +} + +// RegisterInterfaceEncoder registers an encoder for the provided interface type iface. This encoder will +// be called when marshaling a type if the type implements iface or a pointer to the type +// implements iface. If the provided type is not an interface +// (i.e. iface.Kind() != reflect.Interface), this method will panic. +// +// RegisterInterfaceEncoder should not be called concurrently with any other Registry method. +func (r *Registry) RegisterInterfaceEncoder(iface reflect.Type, enc ValueEncoder) { + if iface.Kind() != reflect.Interface { + panicStr := fmt.Errorf("RegisterInterfaceEncoder expects a type with kind reflect.Interface, "+ + "got type %s with kind %s", iface, iface.Kind()) + panic(panicStr) + } + + for idx, encoder := range r.interfaceEncoders { + if encoder.i == iface { + r.interfaceEncoders[idx].ve = enc + return + } + } + + r.interfaceEncoders = append(r.interfaceEncoders, interfaceValueEncoder{i: iface, ve: enc}) +} + +// RegisterInterfaceDecoder registers an decoder for the provided interface type iface. This decoder will +// be called when unmarshaling into a type if the type implements iface or a pointer to the type +// implements iface. If the provided type is not an interface (i.e. iface.Kind() != reflect.Interface), +// this method will panic. +// +// RegisterInterfaceDecoder should not be called concurrently with any other Registry method. +func (r *Registry) RegisterInterfaceDecoder(iface reflect.Type, dec ValueDecoder) { + if iface.Kind() != reflect.Interface { + panicStr := fmt.Errorf("RegisterInterfaceDecoder expects a type with kind reflect.Interface, "+ + "got type %s with kind %s", iface, iface.Kind()) + panic(panicStr) + } + + for idx, decoder := range r.interfaceDecoders { + if decoder.i == iface { + r.interfaceDecoders[idx].vd = dec + return + } + } + + r.interfaceDecoders = append(r.interfaceDecoders, interfaceValueDecoder{i: iface, vd: dec}) +} + +// RegisterTypeMapEntry will register the provided type to the BSON type. The primary usage for this +// mapping is decoding situations where an empty interface is used and a default type needs to be +// created and decoded into. +// +// By default, BSON documents will decode into interface{} values as bson.D. To change the default type for BSON +// documents, a type map entry for bsontype.EmbeddedDocument should be registered. For example, to force BSON documents +// to decode to bson.Raw, use the following code: +// +// reg.RegisterTypeMapEntry(bsontype.EmbeddedDocument, reflect.TypeOf(bson.Raw{})) +func (r *Registry) RegisterTypeMapEntry(bt bsontype.Type, rt reflect.Type) { + r.typeMap[bt] = rt +} + +// LookupEncoder returns the first matching encoder in the Registry. It uses the following lookup +// order: +// +// 1. An encoder registered for the exact type. If the given type is an interface, an encoder +// registered using RegisterTypeEncoder for that interface will be selected. +// +// 2. An encoder registered using RegisterInterfaceEncoder for an interface implemented by the type +// or by a pointer to the type. +// +// 3. An encoder registered using RegisterKindEncoder for the kind of value. +// +// If no encoder is found, an error of type ErrNoEncoder is returned. LookupEncoder is safe for +// concurrent use by multiple goroutines after all codecs and encoders are registered. +func (r *Registry) LookupEncoder(valueType reflect.Type) (ValueEncoder, error) { r.mu.RLock() - enc, found := r.lookupTypeEncoder(t) + enc, found := r.lookupTypeEncoder(valueType) r.mu.RUnlock() if found { if enc == nil { - return nil, ErrNoEncoder{Type: t} + return nil, ErrNoEncoder{Type: valueType} } return enc, nil } - enc, found = r.lookupInterfaceEncoder(t, true) + enc, found = r.lookupInterfaceEncoder(valueType, true) if found { r.mu.Lock() - r.typeEncoders[t] = enc + r.typeEncoders[valueType] = enc r.mu.Unlock() return enc, nil } - if t == nil { + if valueType == nil { r.mu.Lock() - r.typeEncoders[t] = nil + r.typeEncoders[valueType] = nil r.mu.Unlock() - return nil, encodererr + return nil, ErrNoEncoder{Type: valueType} } - enc, found = r.kindEncoders[t.Kind()] + enc, found = r.kindEncoders[valueType.Kind()] if !found { r.mu.Lock() - r.typeEncoders[t] = nil + r.typeEncoders[valueType] = nil r.mu.Unlock() - return nil, encodererr + return nil, ErrNoEncoder{Type: valueType} } r.mu.Lock() - r.typeEncoders[t] = enc + r.typeEncoders[valueType] = enc r.mu.Unlock() return enc, nil } -func (r *Registry) lookupTypeEncoder(t reflect.Type) (ValueEncoder, bool) { - enc, found := r.typeEncoders[t] +func (r *Registry) lookupTypeEncoder(valueType reflect.Type) (ValueEncoder, bool) { + enc, found := r.typeEncoders[valueType] return enc, found } -func (r *Registry) lookupInterfaceEncoder(t reflect.Type, allowAddr bool) (ValueEncoder, bool) { - if t == nil { +func (r *Registry) lookupInterfaceEncoder(valueType reflect.Type, allowAddr bool) (ValueEncoder, bool) { + if valueType == nil { return nil, false } for _, ienc := range r.interfaceEncoders { - if t.Implements(ienc.i) { + if valueType.Implements(ienc.i) { return ienc.ve, true } - if allowAddr && t.Kind() != reflect.Ptr && reflect.PtrTo(t).Implements(ienc.i) { - // if *t implements an interface, this will catch if t implements an interface further ahead - // in interfaceEncoders - defaultEnc, found := r.lookupInterfaceEncoder(t, false) + if allowAddr && valueType.Kind() != reflect.Ptr && reflect.PtrTo(valueType).Implements(ienc.i) { + // if *t implements an interface, this will catch if t implements an interface further + // ahead in interfaceEncoders + defaultEnc, found := r.lookupInterfaceEncoder(valueType, false) if !found { - defaultEnc = r.kindEncoders[t.Kind()] + defaultEnc = r.kindEncoders[valueType.Kind()] } return newCondAddrEncoder(ienc.ve, defaultEnc), true } @@ -377,70 +483,72 @@ func (r *Registry) lookupInterfaceEncoder(t reflect.Type, allowAddr bool) (Value return nil, false } -// LookupDecoder inspects the registry for an decoder for the given type. The lookup precedence works as follows: +// LookupDecoder returns the first matching decoder in the Registry. It uses the following lookup +// order: // -// 1. A decoder registered for the exact type. If the given type represents an interface, a decoder registered using -// RegisterTypeDecoder for the interface will be selected. +// 1. A decoder registered for the exact type. If the given type is an interface, a decoder +// registered using RegisterTypeDecoder for that interface will be selected. // -// 2. A decoder registered using RegisterHookDecoder for an interface implemented by the type or by a pointer to the -// type. +// 2. A decoder registered using RegisterInterfaceDecoder for an interface implemented by the type or by +// a pointer to the type. // -// 3. A decoder registered for the reflect.Kind of the value. +// 3. A decoder registered using RegisterKindDecoder for the kind of value. // -// If no decoder is found, an error of type ErrNoDecoder is returned. -func (r *Registry) LookupDecoder(t reflect.Type) (ValueDecoder, error) { - if t == nil { +// If no decoder is found, an error of type ErrNoDecoder is returned. LookupDecoder is safe for +// concurrent use by multiple goroutines after all codecs and decoders are registered. +func (r *Registry) LookupDecoder(valueType reflect.Type) (ValueDecoder, error) { + if valueType == nil { return nil, ErrNilType } - decodererr := ErrNoDecoder{Type: t} + decodererr := ErrNoDecoder{Type: valueType} r.mu.RLock() - dec, found := r.lookupTypeDecoder(t) + dec, found := r.lookupTypeDecoder(valueType) r.mu.RUnlock() if found { if dec == nil { - return nil, ErrNoDecoder{Type: t} + return nil, ErrNoDecoder{Type: valueType} } return dec, nil } - dec, found = r.lookupInterfaceDecoder(t, true) + dec, found = r.lookupInterfaceDecoder(valueType, true) if found { r.mu.Lock() - r.typeDecoders[t] = dec + r.typeDecoders[valueType] = dec r.mu.Unlock() return dec, nil } - dec, found = r.kindDecoders[t.Kind()] + dec, found = r.kindDecoders[valueType.Kind()] if !found { r.mu.Lock() - r.typeDecoders[t] = nil + r.typeDecoders[valueType] = nil r.mu.Unlock() return nil, decodererr } r.mu.Lock() - r.typeDecoders[t] = dec + r.typeDecoders[valueType] = dec r.mu.Unlock() return dec, nil } -func (r *Registry) lookupTypeDecoder(t reflect.Type) (ValueDecoder, bool) { - dec, found := r.typeDecoders[t] +func (r *Registry) lookupTypeDecoder(valueType reflect.Type) (ValueDecoder, bool) { + dec, found := r.typeDecoders[valueType] return dec, found } -func (r *Registry) lookupInterfaceDecoder(t reflect.Type, allowAddr bool) (ValueDecoder, bool) { +func (r *Registry) lookupInterfaceDecoder(valueType reflect.Type, allowAddr bool) (ValueDecoder, bool) { for _, idec := range r.interfaceDecoders { - if t.Implements(idec.i) { + if valueType.Implements(idec.i) { return idec.vd, true } - if allowAddr && t.Kind() != reflect.Ptr && reflect.PtrTo(t).Implements(idec.i) { - // if *t implements an interface, this will catch if t implements an interface further ahead - // in interfaceDecoders - defaultDec, found := r.lookupInterfaceDecoder(t, false) + if allowAddr && valueType.Kind() != reflect.Ptr && reflect.PtrTo(valueType).Implements(idec.i) { + // if *t implements an interface, this will catch if t implements an interface further + // ahead in interfaceDecoders + defaultDec, found := r.lookupInterfaceDecoder(valueType, false) if !found { - defaultDec = r.kindDecoders[t.Kind()] + defaultDec = r.kindDecoders[valueType.Kind()] } return newCondAddrDecoder(idec.vd, defaultDec), true } @@ -450,6 +558,8 @@ func (r *Registry) lookupInterfaceDecoder(t reflect.Type, allowAddr bool) (Value // LookupTypeMapEntry inspects the registry's type map for a Go type for the corresponding BSON // type. If no type is found, ErrNoTypeMapEntry is returned. +// +// LookupTypeMapEntry should not be called concurrently with any other Registry method. func (r *Registry) LookupTypeMapEntry(bt bsontype.Type) (reflect.Type, error) { t, ok := r.typeMap[bt] if !ok || t == nil { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/slice_codec.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/slice_codec.go index 3c1b6b860a..20c3e7549c 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/slice_codec.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/slice_codec.go @@ -19,13 +19,21 @@ import ( var defaultSliceCodec = NewSliceCodec() // SliceCodec is the Codec used for slice values. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// SliceCodec registered. type SliceCodec struct { + // EncodeNilAsEmpty causes EncodeValue to marshal nil Go slices as empty BSON arrays instead of + // BSON null. + // + // Deprecated: Use bson.Encoder.NilSliceAsEmpty instead. EncodeNilAsEmpty bool } -var _ ValueCodec = &MapCodec{} - // NewSliceCodec returns a MapCodec with options opts. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// SliceCodec registered. func NewSliceCodec(opts ...*bsonoptions.SliceCodecOptions) *SliceCodec { sliceOpt := bsonoptions.MergeSliceCodecOptions(opts...) @@ -42,16 +50,14 @@ func (sc SliceCodec) EncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val re return ValueEncoderError{Name: "SliceEncodeValue", Kinds: []reflect.Kind{reflect.Slice}, Received: val} } - if val.IsNil() && !sc.EncodeNilAsEmpty { + if val.IsNil() && !sc.EncodeNilAsEmpty && !ec.nilSliceAsEmpty { return vw.WriteNull() } // If we have a []byte we want to treat it as a binary instead of as an array. if val.Type().Elem() == tByte { - var byteSlice []byte - for idx := 0; idx < val.Len(); idx++ { - byteSlice = append(byteSlice, val.Index(idx).Interface().(byte)) - } + byteSlice := make([]byte, val.Len()) + reflect.Copy(reflect.ValueOf(byteSlice), val) return vw.WriteBinary(byteSlice) } @@ -145,11 +151,8 @@ func (sc *SliceCodec) DecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val r if val.IsNil() { val.Set(reflect.MakeSlice(val.Type(), 0, len(data))) } - val.SetLen(0) - for _, elem := range data { - val.Set(reflect.Append(val, reflect.ValueOf(elem))) - } + val.Set(reflect.AppendSlice(val, reflect.ValueOf(data))) return nil case bsontype.String: if sliceType := val.Type().Elem(); sliceType != tByte { @@ -164,11 +167,8 @@ func (sc *SliceCodec) DecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val r if val.IsNil() { val.Set(reflect.MakeSlice(val.Type(), 0, len(byteStr))) } - val.SetLen(0) - for _, elem := range byteStr { - val.Set(reflect.Append(val, reflect.ValueOf(elem))) - } + val.Set(reflect.AppendSlice(val, reflect.ValueOf(byteStr))) return nil default: return fmt.Errorf("cannot decode %v into a slice", vrType) diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/string_codec.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/string_codec.go index 5332b7c3b5..ff931b7253 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/string_codec.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/string_codec.go @@ -15,26 +15,38 @@ import ( "go.mongodb.org/mongo-driver/bson/bsontype" ) -// StringCodec is the Codec used for struct values. +// StringCodec is the Codec used for string values. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// StringCodec registered. type StringCodec struct { + // DecodeObjectIDAsHex specifies if object IDs should be decoded as their hex representation. + // If false, a string made from the raw object ID bytes will be used. Defaults to true. + // + // Deprecated: Decoding object IDs as raw bytes will not be supported in Go Driver 2.0. DecodeObjectIDAsHex bool } var ( defaultStringCodec = NewStringCodec() - _ ValueCodec = defaultStringCodec + // Assert that defaultStringCodec satisfies the typeDecoder interface, which allows it to be + // used by collection type decoders (e.g. map, slice, etc) to set individual values in a + // collection. _ typeDecoder = defaultStringCodec ) // NewStringCodec returns a StringCodec with options opts. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// StringCodec registered. func NewStringCodec(opts ...*bsonoptions.StringCodecOptions) *StringCodec { stringOpt := bsonoptions.MergeStringCodecOptions(opts...) return &StringCodec{*stringOpt.DecodeObjectIDAsHex} } // EncodeValue is the ValueEncoder for string types. -func (sc *StringCodec) EncodeValue(ectx EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +func (sc *StringCodec) EncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if val.Kind() != reflect.String { return ValueEncoderError{ Name: "StringEncodeValue", @@ -46,7 +58,7 @@ func (sc *StringCodec) EncodeValue(ectx EncodeContext, vw bsonrw.ValueWriter, va return vw.WriteString(val.String()) } -func (sc *StringCodec) decodeType(dc DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { +func (sc *StringCodec) decodeType(_ DecodeContext, vr bsonrw.ValueReader, t reflect.Type) (reflect.Value, error) { if t.Kind() != reflect.String { return emptyValue, ValueDecoderError{ Name: "StringDecodeValue", @@ -71,6 +83,7 @@ func (sc *StringCodec) decodeType(dc DecodeContext, vr bsonrw.ValueReader, t ref if sc.DecodeObjectIDAsHex { str = oid.Hex() } else { + // TODO(GODRIVER-2796): Return an error here instead of decoding to a garbled string. byteArray := [12]byte(oid) str = string(byteArray[:]) } diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/struct_codec.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/struct_codec.go index be3f2081e9..1dfdd98865 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/struct_codec.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/struct_codec.go @@ -59,14 +59,44 @@ type Zeroer interface { } // StructCodec is the Codec used for struct values. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// StructCodec registered. type StructCodec struct { - cache map[reflect.Type]*structDescription - l sync.RWMutex - parser StructTagParser - DecodeZeroStruct bool - DecodeDeepZeroInline bool - EncodeOmitDefaultStruct bool - AllowUnexportedFields bool + cache map[reflect.Type]*structDescription + l sync.RWMutex + parser StructTagParser + + // DecodeZeroStruct causes DecodeValue to delete any existing values from Go structs in the + // destination value passed to Decode before unmarshaling BSON documents into them. + // + // Deprecated: Use bson.Decoder.ZeroStructs instead. + DecodeZeroStruct bool + + // DecodeDeepZeroInline causes DecodeValue to delete any existing values from Go structs in the + // destination value passed to Decode before unmarshaling BSON documents into them. + // + // Deprecated: DecodeDeepZeroInline will not be supported in Go Driver 2.0. + DecodeDeepZeroInline bool + + // EncodeOmitDefaultStruct causes the Encoder to consider the zero value for a struct (e.g. + // MyStruct{}) as empty and omit it from the marshaled BSON when the "omitempty" struct tag + // option is set. + // + // Deprecated: Use bson.Encoder.OmitZeroStruct instead. + EncodeOmitDefaultStruct bool + + // AllowUnexportedFields allows encoding and decoding values from un-exported struct fields. + // + // Deprecated: AllowUnexportedFields does not work on recent versions of Go and will not be + // supported in Go Driver 2.0. + AllowUnexportedFields bool + + // OverwriteDuplicatedInlinedFields, if false, causes EncodeValue to return an error if there is + // a duplicate field in the marshaled BSON when the "inline" struct tag option is set. The + // default value is true. + // + // Deprecated: Use bson.Encoder.ErrorOnInlineDuplicates instead. OverwriteDuplicatedInlinedFields bool } @@ -74,6 +104,9 @@ var _ ValueEncoder = &StructCodec{} var _ ValueDecoder = &StructCodec{} // NewStructCodec returns a StructCodec that uses p for struct tag parsing. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// StructCodec registered. func NewStructCodec(p StructTagParser, opts ...*bsonoptions.StructCodecOptions) (*StructCodec, error) { if p == nil { return nil, errors.New("a StructTagParser must be provided to NewStructCodec") @@ -106,12 +139,12 @@ func NewStructCodec(p StructTagParser, opts ...*bsonoptions.StructCodecOptions) } // EncodeValue handles encoding generic struct types. -func (sc *StructCodec) EncodeValue(r EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +func (sc *StructCodec) EncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Kind() != reflect.Struct { return ValueEncoderError{Name: "StructCodec.EncodeValue", Kinds: []reflect.Kind{reflect.Struct}, Received: val} } - sd, err := sc.describeStruct(r.Registry, val.Type()) + sd, err := sc.describeStruct(ec.Registry, val.Type(), ec.useJSONStructTags, ec.errorOnInlineDuplicates) if err != nil { return err } @@ -131,7 +164,7 @@ func (sc *StructCodec) EncodeValue(r EncodeContext, vw bsonrw.ValueWriter, val r } } - desc.encoder, rv, err = defaultValueEncoders.lookupElementEncoder(r, desc.encoder, rv) + desc.encoder, rv, err = defaultValueEncoders.lookupElementEncoder(ec, desc.encoder, rv) if err != nil && err != errInvalidValue { return err @@ -158,17 +191,18 @@ func (sc *StructCodec) EncodeValue(r EncodeContext, vw bsonrw.ValueWriter, val r encoder := desc.encoder - var isZero bool + var zero bool rvInterface := rv.Interface() if cz, ok := encoder.(CodecZeroer); ok { - isZero = cz.IsTypeZero(rvInterface) + zero = cz.IsTypeZero(rvInterface) } else if rv.Kind() == reflect.Interface { - // sc.isZero will not treat an interface rv as an interface, so we need to check for the zero interface separately. - isZero = rv.IsNil() + // isZero will not treat an interface rv as an interface, so we need to check for the + // zero interface separately. + zero = rv.IsNil() } else { - isZero = sc.isZero(rvInterface) + zero = isZero(rvInterface, sc.EncodeOmitDefaultStruct || ec.omitZeroStruct) } - if desc.omitEmpty && isZero { + if desc.omitEmpty && zero { continue } @@ -177,7 +211,17 @@ func (sc *StructCodec) EncodeValue(r EncodeContext, vw bsonrw.ValueWriter, val r return err } - ectx := EncodeContext{Registry: r.Registry, MinSize: desc.minSize} + ectx := EncodeContext{ + Registry: ec.Registry, + MinSize: desc.minSize || ec.MinSize, + errorOnInlineDuplicates: ec.errorOnInlineDuplicates, + stringifyMapKeysWithFmt: ec.stringifyMapKeysWithFmt, + nilMapAsEmpty: ec.nilMapAsEmpty, + nilSliceAsEmpty: ec.nilSliceAsEmpty, + nilByteSliceAsEmpty: ec.nilByteSliceAsEmpty, + omitZeroStruct: ec.omitZeroStruct, + useJSONStructTags: ec.useJSONStructTags, + } err = encoder.EncodeValue(ectx, vw2, rv) if err != nil { return err @@ -191,7 +235,7 @@ func (sc *StructCodec) EncodeValue(r EncodeContext, vw bsonrw.ValueWriter, val r return exists } - return defaultMapCodec.mapEncodeValue(r, dw, rv, collisionFn) + return defaultMapCodec.mapEncodeValue(ec, dw, rv, collisionFn) } return dw.WriteDocumentEnd() @@ -213,7 +257,7 @@ func newDecodeError(key string, original error) error { // DecodeValue implements the Codec interface. // By default, map types in val will not be cleared. If a map has existing key/value pairs, it will be extended with the new ones from vr. // For slices, the decoder will set the length of the slice to zero and append all elements. The underlying array will not be cleared. -func (sc *StructCodec) DecodeValue(r DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { +func (sc *StructCodec) DecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Kind() != reflect.Struct { return ValueDecoderError{Name: "StructCodec.DecodeValue", Kinds: []reflect.Kind{reflect.Struct}, Received: val} } @@ -238,12 +282,12 @@ func (sc *StructCodec) DecodeValue(r DecodeContext, vr bsonrw.ValueReader, val r return fmt.Errorf("cannot decode %v into a %s", vrType, val.Type()) } - sd, err := sc.describeStruct(r.Registry, val.Type()) + sd, err := sc.describeStruct(dc.Registry, val.Type(), dc.useJSONStructTags, false) if err != nil { return err } - if sc.DecodeZeroStruct { + if sc.DecodeZeroStruct || dc.zeroStructs { val.Set(reflect.Zero(val.Type())) } if sc.DecodeDeepZeroInline && sd.inline { @@ -254,7 +298,7 @@ func (sc *StructCodec) DecodeValue(r DecodeContext, vr bsonrw.ValueReader, val r var inlineMap reflect.Value if sd.inlineMap >= 0 { inlineMap = val.Field(sd.inlineMap) - decoder, err = r.LookupDecoder(inlineMap.Type().Elem()) + decoder, err = dc.LookupDecoder(inlineMap.Type().Elem()) if err != nil { return err } @@ -298,8 +342,8 @@ func (sc *StructCodec) DecodeValue(r DecodeContext, vr bsonrw.ValueReader, val r } elem := reflect.New(inlineMap.Type().Elem()).Elem() - r.Ancestor = inlineMap.Type() - err = decoder.DecodeValue(r, vr, elem) + dc.Ancestor = inlineMap.Type() + err = decoder.DecodeValue(dc, vr, elem) if err != nil { return err } @@ -326,7 +370,17 @@ func (sc *StructCodec) DecodeValue(r DecodeContext, vr bsonrw.ValueReader, val r } field = field.Addr() - dctx := DecodeContext{Registry: r.Registry, Truncate: fd.truncate || r.Truncate} + dctx := DecodeContext{ + Registry: dc.Registry, + Truncate: fd.truncate || dc.Truncate, + defaultDocumentType: dc.defaultDocumentType, + binaryAsSlice: dc.binaryAsSlice, + useJSONStructTags: dc.useJSONStructTags, + useLocalTimeZone: dc.useLocalTimeZone, + zeroMaps: dc.zeroMaps, + zeroStructs: dc.zeroStructs, + } + if fd.decoder == nil { return newDecodeError(fd.name, ErrNoDecoder{Type: field.Elem().Type()}) } @@ -340,7 +394,7 @@ func (sc *StructCodec) DecodeValue(r DecodeContext, vr bsonrw.ValueReader, val r return nil } -func (sc *StructCodec) isZero(i interface{}) bool { +func isZero(i interface{}, omitZeroStruct bool) bool { v := reflect.ValueOf(i) // check the value validity @@ -366,22 +420,27 @@ func (sc *StructCodec) isZero(i interface{}) bool { case reflect.Interface, reflect.Ptr: return v.IsNil() case reflect.Struct: - if sc.EncodeOmitDefaultStruct { - vt := v.Type() - if vt == tTime { - return v.Interface().(time.Time).IsZero() + if !omitZeroStruct { + return false + } + + // TODO(GODRIVER-2820): Update the logic to be able to handle private struct fields. + // TODO Use condition "reflect.Zero(v.Type()).Equal(v)" instead. + + vt := v.Type() + if vt == tTime { + return v.Interface().(time.Time).IsZero() + } + for i := 0; i < v.NumField(); i++ { + if vt.Field(i).PkgPath != "" && !vt.Field(i).Anonymous { + continue // Private field } - for i := 0; i < v.NumField(); i++ { - if vt.Field(i).PkgPath != "" && !vt.Field(i).Anonymous { - continue // Private field - } - fld := v.Field(i) - if !sc.isZero(fld.Interface()) { - return false - } + fld := v.Field(i) + if !isZero(fld.Interface(), omitZeroStruct) { + return false } - return true } + return true } return false @@ -435,7 +494,12 @@ func (bi byIndex) Less(i, j int) bool { return len(bi[i].inline) < len(bi[j].inline) } -func (sc *StructCodec) describeStruct(r *Registry, t reflect.Type) (*structDescription, error) { +func (sc *StructCodec) describeStruct( + r *Registry, + t reflect.Type, + useJSONStructTags bool, + errorOnDuplicates bool, +) (*structDescription, error) { // We need to analyze the struct, including getting the tags, collecting // information about inlining, and create a map of the field name to the field. sc.l.RLock() @@ -477,7 +541,14 @@ func (sc *StructCodec) describeStruct(r *Registry, t reflect.Type) (*structDescr decoder: decoder, } - stags, err := sc.parser.ParseStructTags(sf) + var stags StructTags + // If the caller requested that we use JSON struct tags, use the JSONFallbackStructTagParser + // instead of the parser defined on the codec. + if useJSONStructTags { + stags, err = JSONFallbackStructTagParser.ParseStructTags(sf) + } else { + stags, err = sc.parser.ParseStructTags(sf) + } if err != nil { return nil, err } @@ -507,7 +578,7 @@ func (sc *StructCodec) describeStruct(r *Registry, t reflect.Type) (*structDescr } fallthrough case reflect.Struct: - inlinesf, err := sc.describeStruct(r, sfType) + inlinesf, err := sc.describeStruct(r, sfType, useJSONStructTags, errorOnDuplicates) if err != nil { return nil, err } @@ -559,7 +630,7 @@ func (sc *StructCodec) describeStruct(r *Registry, t reflect.Type) (*structDescr continue } dominant, ok := dominantField(fields[i : i+advance]) - if !ok || !sc.OverwriteDuplicatedInlinedFields { + if !ok || !sc.OverwriteDuplicatedInlinedFields || errorOnDuplicates { return nil, fmt.Errorf("struct %s has duplicated key %s", t.String(), name) } sd.fl = append(sd.fl, dominant) diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/struct_tag_parser.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/struct_tag_parser.go index 62708c5c74..18d85bfb03 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/struct_tag_parser.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/struct_tag_parser.go @@ -12,12 +12,16 @@ import ( ) // StructTagParser returns the struct tags for a given struct field. +// +// Deprecated: Defining custom BSON struct tag parsers will not be supported in Go Driver 2.0. type StructTagParser interface { ParseStructTags(reflect.StructField) (StructTags, error) } // StructTagParserFunc is an adapter that allows a generic function to be used // as a StructTagParser. +// +// Deprecated: Defining custom BSON struct tag parsers will not be supported in Go Driver 2.0. type StructTagParserFunc func(reflect.StructField) (StructTags, error) // ParseStructTags implements the StructTagParser interface. @@ -50,7 +54,7 @@ func (stpf StructTagParserFunc) ParseStructTags(sf reflect.StructField) (StructT // Skip This struct field should be skipped. This is usually denoted by parsing a "-" // for the name. // -// TODO(skriptble): Add tags for undefined as nil and for null as nil. +// Deprecated: Defining custom BSON struct tag parsers will not be supported in Go Driver 2.0. type StructTags struct { Name string OmitEmpty bool @@ -85,6 +89,8 @@ type StructTags struct { // A struct tag either consisting entirely of '-' or with a bson key with a // value consisting entirely of '-' will return a StructTags with Skip true and // the remaining fields will be their default values. +// +// Deprecated: DefaultStructTagParser will be removed in Go Driver 2.0. var DefaultStructTagParser StructTagParserFunc = func(sf reflect.StructField) (StructTags, error) { key := strings.ToLower(sf.Name) tag, ok := sf.Tag.Lookup("bson") @@ -125,6 +131,9 @@ func parseTags(key string, tag string) (StructTags, error) { // JSONFallbackStructTagParser has the same behavior as DefaultStructTagParser // but will also fallback to parsing the json tag instead on a field where the // bson tag isn't available. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.UseJSONStructTags] and +// [go.mongodb.org/mongo-driver/bson.Decoder.UseJSONStructTags] instead. var JSONFallbackStructTagParser StructTagParserFunc = func(sf reflect.StructField) (StructTags, error) { key := strings.ToLower(sf.Name) tag, ok := sf.Tag.Lookup("bson") diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/time_codec.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/time_codec.go index ec7e30f724..7b005a9958 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/time_codec.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/time_codec.go @@ -22,18 +22,28 @@ const ( ) // TimeCodec is the Codec used for time.Time values. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// TimeCodec registered. type TimeCodec struct { + // UseLocalTimeZone specifies if we should decode into the local time zone. Defaults to false. + // + // Deprecated: Use bson.Decoder.UseLocalTimeZone instead. UseLocalTimeZone bool } var ( defaultTimeCodec = NewTimeCodec() - _ ValueCodec = defaultTimeCodec + // Assert that defaultTimeCodec satisfies the typeDecoder interface, which allows it to be used + // by collection type decoders (e.g. map, slice, etc) to set individual values in a collection. _ typeDecoder = defaultTimeCodec ) // NewTimeCodec returns a TimeCodec with options opts. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// TimeCodec registered. func NewTimeCodec(opts ...*bsonoptions.TimeCodecOptions) *TimeCodec { timeOpt := bsonoptions.MergeTimeCodecOptions(opts...) @@ -95,7 +105,7 @@ func (tc *TimeCodec) decodeType(dc DecodeContext, vr bsonrw.ValueReader, t refle return emptyValue, fmt.Errorf("cannot decode %v into a time.Time", vrType) } - if !tc.UseLocalTimeZone { + if !tc.UseLocalTimeZone && !dc.useLocalTimeZone { timeVal = timeVal.UTC() } return reflect.ValueOf(timeVal), nil @@ -117,7 +127,7 @@ func (tc *TimeCodec) DecodeValue(dc DecodeContext, vr bsonrw.ValueReader, val re } // EncodeValue is the ValueEncoderFunc for time.TIme. -func (tc *TimeCodec) EncodeValue(ec EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +func (tc *TimeCodec) EncodeValue(_ EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tTime { return ValueEncoderError{Name: "TimeEncodeValue", Types: []reflect.Type{tTime}, Received: val} } diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/uint_codec.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/uint_codec.go index 0b21ce999c..7eb1069050 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/uint_codec.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/uint_codec.go @@ -17,18 +17,29 @@ import ( ) // UIntCodec is the Codec used for uint values. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// UIntCodec registered. type UIntCodec struct { + // EncodeToMinSize causes EncodeValue to marshal Go uint values (excluding uint64) as the + // minimum BSON int size (either 32-bit or 64-bit) that can represent the integer value. + // + // Deprecated: Use bson.Encoder.IntMinSize instead. EncodeToMinSize bool } var ( defaultUIntCodec = NewUIntCodec() - _ ValueCodec = defaultUIntCodec + // Assert that defaultUIntCodec satisfies the typeDecoder interface, which allows it to be used + // by collection type decoders (e.g. map, slice, etc) to set individual values in a collection. _ typeDecoder = defaultUIntCodec ) // NewUIntCodec returns a UIntCodec with options opts. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.NewRegistry] to get a registry with the +// UIntCodec registered. func NewUIntCodec(opts ...*bsonoptions.UIntCodecOptions) *UIntCodec { uintOpt := bsonoptions.MergeUIntCodecOptions(opts...) diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/byte_slice_codec_options.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/byte_slice_codec_options.go index b1256a4dca..996bd17127 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/byte_slice_codec_options.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/byte_slice_codec_options.go @@ -7,22 +7,33 @@ package bsonoptions // ByteSliceCodecOptions represents all possible options for byte slice encoding and decoding. +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. type ByteSliceCodecOptions struct { EncodeNilAsEmpty *bool // Specifies if a nil byte slice should encode as an empty binary instead of null. Defaults to false. } // ByteSliceCodec creates a new *ByteSliceCodecOptions +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. func ByteSliceCodec() *ByteSliceCodecOptions { return &ByteSliceCodecOptions{} } // SetEncodeNilAsEmpty specifies if a nil byte slice should encode as an empty binary instead of null. Defaults to false. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.NilByteSliceAsEmpty] instead. func (bs *ByteSliceCodecOptions) SetEncodeNilAsEmpty(b bool) *ByteSliceCodecOptions { bs.EncodeNilAsEmpty = &b return bs } // MergeByteSliceCodecOptions combines the given *ByteSliceCodecOptions into a single *ByteSliceCodecOptions in a last one wins fashion. +// +// Deprecated: Merging options structs will not be supported in Go Driver 2.0. Users should create a +// single options struct instead. func MergeByteSliceCodecOptions(opts ...*ByteSliceCodecOptions) *ByteSliceCodecOptions { bs := ByteSliceCodec() for _, opt := range opts { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/empty_interface_codec_options.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/empty_interface_codec_options.go index 6caaa000e6..f522c7e03f 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/empty_interface_codec_options.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/empty_interface_codec_options.go @@ -7,22 +7,33 @@ package bsonoptions // EmptyInterfaceCodecOptions represents all possible options for interface{} encoding and decoding. +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. type EmptyInterfaceCodecOptions struct { DecodeBinaryAsSlice *bool // Specifies if Old and Generic type binarys should default to []slice instead of primitive.Binary. Defaults to false. } // EmptyInterfaceCodec creates a new *EmptyInterfaceCodecOptions +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. func EmptyInterfaceCodec() *EmptyInterfaceCodecOptions { return &EmptyInterfaceCodecOptions{} } // SetDecodeBinaryAsSlice specifies if Old and Generic type binarys should default to []slice instead of primitive.Binary. Defaults to false. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Decoder.BinaryAsSlice] instead. func (e *EmptyInterfaceCodecOptions) SetDecodeBinaryAsSlice(b bool) *EmptyInterfaceCodecOptions { e.DecodeBinaryAsSlice = &b return e } // MergeEmptyInterfaceCodecOptions combines the given *EmptyInterfaceCodecOptions into a single *EmptyInterfaceCodecOptions in a last one wins fashion. +// +// Deprecated: Merging options structs will not be supported in Go Driver 2.0. Users should create a +// single options struct instead. func MergeEmptyInterfaceCodecOptions(opts ...*EmptyInterfaceCodecOptions) *EmptyInterfaceCodecOptions { e := EmptyInterfaceCodec() for _, opt := range opts { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/map_codec_options.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/map_codec_options.go index 7a6a880b88..a7a7c1d980 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/map_codec_options.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/map_codec_options.go @@ -7,6 +7,9 @@ package bsonoptions // MapCodecOptions represents all possible options for map encoding and decoding. +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. type MapCodecOptions struct { DecodeZerosMap *bool // Specifies if the map should be zeroed before decoding into it. Defaults to false. EncodeNilAsEmpty *bool // Specifies if a nil map should encode as an empty document instead of null. Defaults to false. @@ -19,17 +22,24 @@ type MapCodecOptions struct { } // MapCodec creates a new *MapCodecOptions +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. func MapCodec() *MapCodecOptions { return &MapCodecOptions{} } // SetDecodeZerosMap specifies if the map should be zeroed before decoding into it. Defaults to false. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Decoder.ZeroMaps] instead. func (t *MapCodecOptions) SetDecodeZerosMap(b bool) *MapCodecOptions { t.DecodeZerosMap = &b return t } // SetEncodeNilAsEmpty specifies if a nil map should encode as an empty document instead of null. Defaults to false. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.NilMapAsEmpty] instead. func (t *MapCodecOptions) SetEncodeNilAsEmpty(b bool) *MapCodecOptions { t.EncodeNilAsEmpty = &b return t @@ -40,12 +50,17 @@ func (t *MapCodecOptions) SetEncodeNilAsEmpty(b bool) *MapCodecOptions { // type must either be a string, an integer type, or implement bsoncodec.KeyUnmarshaler. If true, keys are encoded with // fmt.Sprint() and the encoding key type must be a string, an integer type, or a float. If true, the use of Stringer // will override TextMarshaler/TextUnmarshaler. Defaults to false. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.StringifyMapKeysWithFmt] instead. func (t *MapCodecOptions) SetEncodeKeysWithStringer(b bool) *MapCodecOptions { t.EncodeKeysWithStringer = &b return t } // MergeMapCodecOptions combines the given *MapCodecOptions into a single *MapCodecOptions in a last one wins fashion. +// +// Deprecated: Merging options structs will not be supported in Go Driver 2.0. Users should create a +// single options struct instead. func MergeMapCodecOptions(opts ...*MapCodecOptions) *MapCodecOptions { s := MapCodec() for _, opt := range opts { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/slice_codec_options.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/slice_codec_options.go index ef965e4b41..3c1e4f35ba 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/slice_codec_options.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/slice_codec_options.go @@ -7,22 +7,33 @@ package bsonoptions // SliceCodecOptions represents all possible options for slice encoding and decoding. +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. type SliceCodecOptions struct { EncodeNilAsEmpty *bool // Specifies if a nil slice should encode as an empty array instead of null. Defaults to false. } // SliceCodec creates a new *SliceCodecOptions +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. func SliceCodec() *SliceCodecOptions { return &SliceCodecOptions{} } // SetEncodeNilAsEmpty specifies if a nil slice should encode as an empty array instead of null. Defaults to false. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.NilSliceAsEmpty] instead. func (s *SliceCodecOptions) SetEncodeNilAsEmpty(b bool) *SliceCodecOptions { s.EncodeNilAsEmpty = &b return s } // MergeSliceCodecOptions combines the given *SliceCodecOptions into a single *SliceCodecOptions in a last one wins fashion. +// +// Deprecated: Merging options structs will not be supported in Go Driver 2.0. Users should create a +// single options struct instead. func MergeSliceCodecOptions(opts ...*SliceCodecOptions) *SliceCodecOptions { s := SliceCodec() for _, opt := range opts { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/string_codec_options.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/string_codec_options.go index 65964f4207..f8b76f996e 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/string_codec_options.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/string_codec_options.go @@ -9,23 +9,34 @@ package bsonoptions var defaultDecodeOIDAsHex = true // StringCodecOptions represents all possible options for string encoding and decoding. +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. type StringCodecOptions struct { DecodeObjectIDAsHex *bool // Specifies if we should decode ObjectID as the hex value. Defaults to true. } // StringCodec creates a new *StringCodecOptions +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. func StringCodec() *StringCodecOptions { return &StringCodecOptions{} } // SetDecodeObjectIDAsHex specifies if object IDs should be decoded as their hex representation. If false, a string made // from the raw object ID bytes will be used. Defaults to true. +// +// Deprecated: Decoding object IDs as raw bytes will not be supported in Go Driver 2.0. func (t *StringCodecOptions) SetDecodeObjectIDAsHex(b bool) *StringCodecOptions { t.DecodeObjectIDAsHex = &b return t } // MergeStringCodecOptions combines the given *StringCodecOptions into a single *StringCodecOptions in a last one wins fashion. +// +// Deprecated: Merging options structs will not be supported in Go Driver 2.0. Users should create a +// single options struct instead. func MergeStringCodecOptions(opts ...*StringCodecOptions) *StringCodecOptions { s := &StringCodecOptions{&defaultDecodeOIDAsHex} for _, opt := range opts { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/struct_codec_options.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/struct_codec_options.go index 78d1dd8668..1cbfa32e8b 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/struct_codec_options.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/struct_codec_options.go @@ -9,6 +9,9 @@ package bsonoptions var defaultOverwriteDuplicatedInlinedFields = true // StructCodecOptions represents all possible options for struct encoding and decoding. +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. type StructCodecOptions struct { DecodeZeroStruct *bool // Specifies if structs should be zeroed before decoding into them. Defaults to false. DecodeDeepZeroInline *bool // Specifies if structs should be recursively zeroed when a inline value is decoded. Defaults to false. @@ -18,17 +21,24 @@ type StructCodecOptions struct { } // StructCodec creates a new *StructCodecOptions +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. func StructCodec() *StructCodecOptions { return &StructCodecOptions{} } // SetDecodeZeroStruct specifies if structs should be zeroed before decoding into them. Defaults to false. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Decoder.ZeroStructs] instead. func (t *StructCodecOptions) SetDecodeZeroStruct(b bool) *StructCodecOptions { t.DecodeZeroStruct = &b return t } // SetDecodeDeepZeroInline specifies if structs should be zeroed before decoding into them. Defaults to false. +// +// Deprecated: DecodeDeepZeroInline will not be supported in Go Driver 2.0. func (t *StructCodecOptions) SetDecodeDeepZeroInline(b bool) *StructCodecOptions { t.DecodeDeepZeroInline = &b return t @@ -36,6 +46,8 @@ func (t *StructCodecOptions) SetDecodeDeepZeroInline(b bool) *StructCodecOptions // SetEncodeOmitDefaultStruct specifies if default structs should be considered empty by omitempty. A default struct has all // its values set to their default value. Defaults to false. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.OmitZeroStruct] instead. func (t *StructCodecOptions) SetEncodeOmitDefaultStruct(b bool) *StructCodecOptions { t.EncodeOmitDefaultStruct = &b return t @@ -45,18 +57,26 @@ func (t *StructCodecOptions) SetEncodeOmitDefaultStruct(b bool) *StructCodecOpti // same bson key. When true and decoding, values will be written to the outermost struct with a matching key, and when // encoding, keys will have the value of the top-most matching field. When false, decoding and encoding will error if // there are duplicate keys after the struct is inlined. Defaults to true. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.ErrorOnInlineDuplicates] instead. func (t *StructCodecOptions) SetOverwriteDuplicatedInlinedFields(b bool) *StructCodecOptions { t.OverwriteDuplicatedInlinedFields = &b return t } // SetAllowUnexportedFields specifies if unexported fields should be marshaled/unmarshaled. Defaults to false. +// +// Deprecated: AllowUnexportedFields does not work on recent versions of Go and will not be +// supported in Go Driver 2.0. func (t *StructCodecOptions) SetAllowUnexportedFields(b bool) *StructCodecOptions { t.AllowUnexportedFields = &b return t } // MergeStructCodecOptions combines the given *StructCodecOptions into a single *StructCodecOptions in a last one wins fashion. +// +// Deprecated: Merging options structs will not be supported in Go Driver 2.0. Users should create a +// single options struct instead. func MergeStructCodecOptions(opts ...*StructCodecOptions) *StructCodecOptions { s := &StructCodecOptions{ OverwriteDuplicatedInlinedFields: &defaultOverwriteDuplicatedInlinedFields, diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/time_codec_options.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/time_codec_options.go index 13496d1217..3f38433d22 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/time_codec_options.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/time_codec_options.go @@ -7,22 +7,33 @@ package bsonoptions // TimeCodecOptions represents all possible options for time.Time encoding and decoding. +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. type TimeCodecOptions struct { UseLocalTimeZone *bool // Specifies if we should decode into the local time zone. Defaults to false. } // TimeCodec creates a new *TimeCodecOptions +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. func TimeCodec() *TimeCodecOptions { return &TimeCodecOptions{} } // SetUseLocalTimeZone specifies if we should decode into the local time zone. Defaults to false. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Decoder.UseLocalTimeZone] instead. func (t *TimeCodecOptions) SetUseLocalTimeZone(b bool) *TimeCodecOptions { t.UseLocalTimeZone = &b return t } // MergeTimeCodecOptions combines the given *TimeCodecOptions into a single *TimeCodecOptions in a last one wins fashion. +// +// Deprecated: Merging options structs will not be supported in Go Driver 2.0. Users should create a +// single options struct instead. func MergeTimeCodecOptions(opts ...*TimeCodecOptions) *TimeCodecOptions { t := TimeCodec() for _, opt := range opts { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/uint_codec_options.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/uint_codec_options.go index e08b7f192e..5091e4d963 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/uint_codec_options.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/uint_codec_options.go @@ -7,22 +7,33 @@ package bsonoptions // UIntCodecOptions represents all possible options for uint encoding and decoding. +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. type UIntCodecOptions struct { EncodeToMinSize *bool // Specifies if all uints except uint64 should be decoded to minimum size bsontype. Defaults to false. } // UIntCodec creates a new *UIntCodecOptions +// +// Deprecated: Use the bson.Encoder and bson.Decoder configuration methods to set the desired BSON marshal +// and unmarshal behavior instead. func UIntCodec() *UIntCodecOptions { return &UIntCodecOptions{} } // SetEncodeToMinSize specifies if all uints except uint64 should be decoded to minimum size bsontype. Defaults to false. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.Encoder.IntMinSize] instead. func (u *UIntCodecOptions) SetEncodeToMinSize(b bool) *UIntCodecOptions { u.EncodeToMinSize = &b return u } // MergeUIntCodecOptions combines the given *UIntCodecOptions into a single *UIntCodecOptions in a last one wins fashion. +// +// Deprecated: Merging options structs will not be supported in Go Driver 2.0. Users should create a +// single options struct instead. func MergeUIntCodecOptions(opts ...*UIntCodecOptions) *UIntCodecOptions { u := UIntCodec() for _, opt := range opts { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/copier.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/copier.go index 5cdf6460bc..33d59bd258 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/copier.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/copier.go @@ -17,20 +17,32 @@ import ( // Copier is a type that allows copying between ValueReaders, ValueWriters, and // []byte values. +// +// Deprecated: Copying BSON documents using the ValueWriter and ValueReader interfaces will not be +// supported in Go Driver 2.0. type Copier struct{} // NewCopier creates a new copier with the given registry. If a nil registry is provided // a default registry is used. +// +// Deprecated: Copying BSON documents using the ValueWriter and ValueReader interfaces will not be +// supported in Go Driver 2.0. func NewCopier() Copier { return Copier{} } // CopyDocument handles copying a document from src to dst. +// +// Deprecated: Copying BSON documents using the ValueWriter and ValueReader interfaces will not be +// supported in Go Driver 2.0. func CopyDocument(dst ValueWriter, src ValueReader) error { return Copier{}.CopyDocument(dst, src) } // CopyDocument handles copying one document from the src to the dst. +// +// Deprecated: Copying BSON documents using the ValueWriter and ValueReader interfaces will not be +// supported in Go Driver 2.0. func (c Copier) CopyDocument(dst ValueWriter, src ValueReader) error { dr, err := src.ReadDocument() if err != nil { @@ -47,6 +59,9 @@ func (c Copier) CopyDocument(dst ValueWriter, src ValueReader) error { // CopyArrayFromBytes copies the values from a BSON array represented as a // []byte to a ValueWriter. +// +// Deprecated: Copying BSON arrays using the ValueWriter and ValueReader interfaces will not be +// supported in Go Driver 2.0. func (c Copier) CopyArrayFromBytes(dst ValueWriter, src []byte) error { aw, err := dst.WriteArray() if err != nil { @@ -63,6 +78,9 @@ func (c Copier) CopyArrayFromBytes(dst ValueWriter, src []byte) error { // CopyDocumentFromBytes copies the values from a BSON document represented as a // []byte to a ValueWriter. +// +// Deprecated: Copying BSON documents using the ValueWriter and ValueReader interfaces will not be +// supported in Go Driver 2.0. func (c Copier) CopyDocumentFromBytes(dst ValueWriter, src []byte) error { dw, err := dst.WriteDocument() if err != nil { @@ -81,6 +99,9 @@ type writeElementFn func(key string) (ValueWriter, error) // CopyBytesToArrayWriter copies the values from a BSON Array represented as a []byte to an // ArrayWriter. +// +// Deprecated: Copying BSON arrays using the ArrayWriter interface will not be supported in Go +// Driver 2.0. func (c Copier) CopyBytesToArrayWriter(dst ArrayWriter, src []byte) error { wef := func(_ string) (ValueWriter, error) { return dst.WriteArrayElement() @@ -91,6 +112,9 @@ func (c Copier) CopyBytesToArrayWriter(dst ArrayWriter, src []byte) error { // CopyBytesToDocumentWriter copies the values from a BSON document represented as a []byte to a // DocumentWriter. +// +// Deprecated: Copying BSON documents using the ValueWriter and ValueReader interfaces will not be +// supported in Go Driver 2.0. func (c Copier) CopyBytesToDocumentWriter(dst DocumentWriter, src []byte) error { wef := func(key string) (ValueWriter, error) { return dst.WriteDocumentElement(key) @@ -150,12 +174,18 @@ func (c Copier) copyBytesToValueWriter(src []byte, wef writeElementFn) error { // CopyDocumentToBytes copies an entire document from the ValueReader and // returns it as bytes. +// +// Deprecated: Copying BSON documents using the ValueWriter and ValueReader interfaces will not be +// supported in Go Driver 2.0. func (c Copier) CopyDocumentToBytes(src ValueReader) ([]byte, error) { return c.AppendDocumentBytes(nil, src) } // AppendDocumentBytes functions the same as CopyDocumentToBytes, but will // append the result to dst. +// +// Deprecated: Copying BSON documents using the ValueWriter and ValueReader interfaces will not be +// supported in Go Driver 2.0. func (c Copier) AppendDocumentBytes(dst []byte, src ValueReader) ([]byte, error) { if br, ok := src.(BytesReader); ok { _, dst, err := br.ReadValueBytes(dst) @@ -173,6 +203,9 @@ func (c Copier) AppendDocumentBytes(dst []byte, src ValueReader) ([]byte, error) } // AppendArrayBytes copies an array from the ValueReader to dst. +// +// Deprecated: Copying BSON arrays using the ValueWriter and ValueReader interfaces will not be +// supported in Go Driver 2.0. func (c Copier) AppendArrayBytes(dst []byte, src ValueReader) ([]byte, error) { if br, ok := src.(BytesReader); ok { _, dst, err := br.ReadValueBytes(dst) @@ -190,6 +223,8 @@ func (c Copier) AppendArrayBytes(dst []byte, src ValueReader) ([]byte, error) { } // CopyValueFromBytes will write the value represtend by t and src to dst. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.UnmarshalValue] instead. func (c Copier) CopyValueFromBytes(dst ValueWriter, t bsontype.Type, src []byte) error { if wvb, ok := dst.(BytesWriter); ok { return wvb.WriteValueBytes(t, src) @@ -206,12 +241,17 @@ func (c Copier) CopyValueFromBytes(dst ValueWriter, t bsontype.Type, src []byte) // CopyValueToBytes copies a value from src and returns it as a bsontype.Type and a // []byte. +// +// Deprecated: Use [go.mongodb.org/mongo-driver/bson.MarshalValue] instead. func (c Copier) CopyValueToBytes(src ValueReader) (bsontype.Type, []byte, error) { return c.AppendValueBytes(nil, src) } // AppendValueBytes functions the same as CopyValueToBytes, but will append the // result to dst. +// +// Deprecated: Appending individual BSON elements to an existing slice will not be supported in Go +// Driver 2.0. func (c Copier) AppendValueBytes(dst []byte, src ValueReader) (bsontype.Type, []byte, error) { if br, ok := src.(BytesReader); ok { return br.ReadValueBytes(dst) @@ -234,6 +274,9 @@ func (c Copier) AppendValueBytes(dst []byte, src ValueReader) (bsontype.Type, [] } // CopyValue will copy a single value from src to dst. +// +// Deprecated: Copying BSON values using the ValueWriter and ValueReader interfaces will not be +// supported in Go Driver 2.0. func (c Copier) CopyValue(dst ValueWriter, src ValueReader) error { var err error switch src.Type() { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/extjson_reader.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/extjson_reader.go index 35832d73aa..2aca37a91f 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/extjson_reader.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/extjson_reader.go @@ -16,11 +16,15 @@ import ( ) // ExtJSONValueReaderPool is a pool for ValueReaders that read ExtJSON. +// +// Deprecated: ExtJSONValueReaderPool will not be supported in Go Driver 2.0. type ExtJSONValueReaderPool struct { pool sync.Pool } // NewExtJSONValueReaderPool instantiates a new ExtJSONValueReaderPool. +// +// Deprecated: ExtJSONValueReaderPool will not be supported in Go Driver 2.0. func NewExtJSONValueReaderPool() *ExtJSONValueReaderPool { return &ExtJSONValueReaderPool{ pool: sync.Pool{ @@ -32,6 +36,8 @@ func NewExtJSONValueReaderPool() *ExtJSONValueReaderPool { } // Get retrieves a ValueReader from the pool and uses src as the underlying ExtJSON. +// +// Deprecated: ExtJSONValueReaderPool will not be supported in Go Driver 2.0. func (bvrp *ExtJSONValueReaderPool) Get(r io.Reader, canonical bool) (ValueReader, error) { vr := bvrp.pool.Get().(*extJSONValueReader) return vr.reset(r, canonical) @@ -39,6 +45,8 @@ func (bvrp *ExtJSONValueReaderPool) Get(r io.Reader, canonical bool) (ValueReade // Put inserts a ValueReader into the pool. If the ValueReader is not a ExtJSON ValueReader nothing // is inserted into the pool and ok will be false. +// +// Deprecated: ExtJSONValueReaderPool will not be supported in Go Driver 2.0. func (bvrp *ExtJSONValueReaderPool) Put(vr ValueReader) (ok bool) { bvr, ok := vr.(*extJSONValueReader) if !ok { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/extjson_writer.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/extjson_writer.go index 99ed524b77..bb9303167c 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/extjson_writer.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/extjson_writer.go @@ -23,11 +23,15 @@ import ( ) // ExtJSONValueWriterPool is a pool for ExtJSON ValueWriters. +// +// Deprecated: ExtJSONValueWriterPool will not be supported in Go Driver 2.0. type ExtJSONValueWriterPool struct { pool sync.Pool } // NewExtJSONValueWriterPool creates a new pool for ValueWriter instances that write to ExtJSON. +// +// Deprecated: ExtJSONValueWriterPool will not be supported in Go Driver 2.0. func NewExtJSONValueWriterPool() *ExtJSONValueWriterPool { return &ExtJSONValueWriterPool{ pool: sync.Pool{ @@ -39,6 +43,8 @@ func NewExtJSONValueWriterPool() *ExtJSONValueWriterPool { } // Get retrieves a ExtJSON ValueWriter from the pool and resets it to use w as the destination. +// +// Deprecated: ExtJSONValueWriterPool will not be supported in Go Driver 2.0. func (bvwp *ExtJSONValueWriterPool) Get(w io.Writer, canonical, escapeHTML bool) ValueWriter { vw := bvwp.pool.Get().(*extJSONValueWriter) if writer, ok := w.(*SliceWriter); ok { @@ -53,6 +59,8 @@ func (bvwp *ExtJSONValueWriterPool) Get(w io.Writer, canonical, escapeHTML bool) // Put inserts a ValueWriter into the pool. If the ValueWriter is not a ExtJSON ValueWriter, nothing // happens and ok will be false. +// +// Deprecated: ExtJSONValueWriterPool will not be supported in Go Driver 2.0. func (bvwp *ExtJSONValueWriterPool) Put(vw ValueWriter) (ok bool) { bvw, ok := vw.(*extJSONValueWriter) if !ok { @@ -80,6 +88,7 @@ type extJSONValueWriter struct { frame int64 canonical bool escapeHTML bool + newlines bool } // NewExtJSONValueWriter creates a ValueWriter that writes Extended JSON to w. @@ -88,10 +97,13 @@ func NewExtJSONValueWriter(w io.Writer, canonical, escapeHTML bool) (ValueWriter return nil, errNilWriter } - return newExtJSONWriter(w, canonical, escapeHTML), nil + // Enable newlines for all Extended JSON value writers created by NewExtJSONValueWriter. We + // expect these value writers to be used with an Encoder, which should add newlines after + // encoded Extended JSON documents. + return newExtJSONWriter(w, canonical, escapeHTML, true), nil } -func newExtJSONWriter(w io.Writer, canonical, escapeHTML bool) *extJSONValueWriter { +func newExtJSONWriter(w io.Writer, canonical, escapeHTML, newlines bool) *extJSONValueWriter { stack := make([]ejvwState, 1, 5) stack[0] = ejvwState{mode: mTopLevel} @@ -101,6 +113,7 @@ func newExtJSONWriter(w io.Writer, canonical, escapeHTML bool) *extJSONValueWrit stack: stack, canonical: canonical, escapeHTML: escapeHTML, + newlines: newlines, } } @@ -564,6 +577,12 @@ func (ejvw *extJSONValueWriter) WriteDocumentEnd() error { case mDocument: ejvw.buf = append(ejvw.buf, ',') case mTopLevel: + // If the value writer has newlines enabled, end top-level documents with a newline so that + // multiple documents encoded to the same writer are separated by newlines. That matches the + // Go json.Encoder behavior and also works with bsonrw.NewExtJSONValueReader. + if ejvw.newlines { + ejvw.buf = append(ejvw.buf, '\n') + } if ejvw.w != nil { if _, err := ejvw.w.Write(ejvw.buf); err != nil { return err diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/reader.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/reader.go index 0b8fa28d57..324b10b616 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/reader.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/reader.go @@ -58,6 +58,8 @@ type ValueReader interface { // types that implement ValueReader may also implement this interface. // // The bytes of the value will be appended to dst. +// +// Deprecated: BytesReader will not be supported in Go Driver 2.0. type BytesReader interface { ReadValueBytes(dst []byte) (bsontype.Type, []byte, error) } diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/value_reader.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/value_reader.go index ef5d837c2f..9bf24fae0b 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/value_reader.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/value_reader.go @@ -28,11 +28,15 @@ var vrPool = sync.Pool{ } // BSONValueReaderPool is a pool for ValueReaders that read BSON. +// +// Deprecated: BSONValueReaderPool will not be supported in Go Driver 2.0. type BSONValueReaderPool struct { pool sync.Pool } // NewBSONValueReaderPool instantiates a new BSONValueReaderPool. +// +// Deprecated: BSONValueReaderPool will not be supported in Go Driver 2.0. func NewBSONValueReaderPool() *BSONValueReaderPool { return &BSONValueReaderPool{ pool: sync.Pool{ @@ -44,6 +48,8 @@ func NewBSONValueReaderPool() *BSONValueReaderPool { } // Get retrieves a ValueReader from the pool and uses src as the underlying BSON. +// +// Deprecated: BSONValueReaderPool will not be supported in Go Driver 2.0. func (bvrp *BSONValueReaderPool) Get(src []byte) ValueReader { vr := bvrp.pool.Get().(*valueReader) vr.reset(src) @@ -52,6 +58,8 @@ func (bvrp *BSONValueReaderPool) Get(src []byte) ValueReader { // Put inserts a ValueReader into the pool. If the ValueReader is not a BSON ValueReader nothing // is inserted into the pool and ok will be false. +// +// Deprecated: BSONValueReaderPool will not be supported in Go Driver 2.0. func (bvrp *BSONValueReaderPool) Put(vr ValueReader) (ok bool) { bvr, ok := vr.(*valueReader) if !ok { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/value_writer.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/value_writer.go index f95a08afd5..a6dd8d34f5 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/value_writer.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/value_writer.go @@ -29,11 +29,15 @@ var vwPool = sync.Pool{ } // BSONValueWriterPool is a pool for BSON ValueWriters. +// +// Deprecated: BSONValueWriterPool will not be supported in Go Driver 2.0. type BSONValueWriterPool struct { pool sync.Pool } // NewBSONValueWriterPool creates a new pool for ValueWriter instances that write to BSON. +// +// Deprecated: BSONValueWriterPool will not be supported in Go Driver 2.0. func NewBSONValueWriterPool() *BSONValueWriterPool { return &BSONValueWriterPool{ pool: sync.Pool{ @@ -45,6 +49,8 @@ func NewBSONValueWriterPool() *BSONValueWriterPool { } // Get retrieves a BSON ValueWriter from the pool and resets it to use w as the destination. +// +// Deprecated: BSONValueWriterPool will not be supported in Go Driver 2.0. func (bvwp *BSONValueWriterPool) Get(w io.Writer) ValueWriter { vw := bvwp.pool.Get().(*valueWriter) @@ -56,6 +62,8 @@ func (bvwp *BSONValueWriterPool) Get(w io.Writer) ValueWriter { } // GetAtModeElement retrieves a ValueWriterFlusher from the pool and resets it to use w as the destination. +// +// Deprecated: BSONValueWriterPool will not be supported in Go Driver 2.0. func (bvwp *BSONValueWriterPool) GetAtModeElement(w io.Writer) ValueWriterFlusher { vw := bvwp.Get(w).(*valueWriter) vw.push(mElement) @@ -64,6 +72,8 @@ func (bvwp *BSONValueWriterPool) GetAtModeElement(w io.Writer) ValueWriterFlushe // Put inserts a ValueWriter into the pool. If the ValueWriter is not a BSON ValueWriter, nothing // happens and ok will be false. +// +// Deprecated: BSONValueWriterPool will not be supported in Go Driver 2.0. func (bvwp *BSONValueWriterPool) Put(vw ValueWriter) (ok bool) { bvw, ok := vw.(*valueWriter) if !ok { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/writer.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/writer.go index dff65f87f7..628f452932 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/writer.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonrw/writer.go @@ -56,6 +56,8 @@ type ValueWriter interface { } // ValueWriterFlusher is a superset of ValueWriter that exposes functionality to flush to the underlying buffer. +// +// Deprecated: ValueWriterFlusher will not be supported in Go Driver 2.0. type ValueWriterFlusher interface { ValueWriter Flush() error @@ -64,13 +66,20 @@ type ValueWriterFlusher interface { // BytesWriter is the interface used to write BSON bytes to a ValueWriter. // This interface is meant to be a superset of ValueWriter, so that types that // implement ValueWriter may also implement this interface. +// +// Deprecated: BytesWriter will not be supported in Go Driver 2.0. type BytesWriter interface { WriteValueBytes(t bsontype.Type, b []byte) error } // SliceWriter allows a pointer to a slice of bytes to be used as an io.Writer. +// +// Deprecated: SliceWriter will not be supported in Go Driver 2.0. type SliceWriter []byte +// Write writes the bytes to the underlying slice. +// +// Deprecated: SliceWriter will not be supported in Go Driver 2.0. func (sw *SliceWriter) Write(p []byte) (int, error) { written := len(p) *sw = append(*sw, p...) diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsontype/bsontype.go b/vendor/go.mongodb.org/mongo-driver/bson/bsontype/bsontype.go index 7c91ae5186..f38c263a4c 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsontype/bsontype.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsontype/bsontype.go @@ -8,7 +8,9 @@ // a stringifier for the Type to enable easier debugging when working with BSON. package bsontype // import "go.mongodb.org/mongo-driver/bson/bsontype" -// These constants uniquely refer to each BSON type. +// BSON element types as described in https://bsonspec.org/spec.html. +// +// Deprecated: Use bson.Type* constants instead. const ( Double Type = 0x01 String Type = 0x02 @@ -31,7 +33,12 @@ const ( Decimal128 Type = 0x13 MinKey Type = 0xFF MaxKey Type = 0x7F +) +// BSON binary element subtypes as described in https://bsonspec.org/spec.html. +// +// Deprecated: Use the bson.TypeBinary* constants instead. +const ( BinaryGeneric byte = 0x00 BinaryFunction byte = 0x01 BinaryBinaryOld byte = 0x02 diff --git a/vendor/go.mongodb.org/mongo-driver/bson/decoder.go b/vendor/go.mongodb.org/mongo-driver/bson/decoder.go index 6e189fa589..eac74cd399 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/decoder.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/decoder.go @@ -38,6 +38,12 @@ type Decoder struct { // (*Decoder).SetContext. defaultDocumentM bool defaultDocumentD bool + + binaryAsSlice bool + useJSONStructTags bool + useLocalTimeZone bool + zeroMaps bool + zeroStructs bool } // NewDecoder returns a new decoder that uses the DefaultRegistry to read from vr. @@ -53,6 +59,9 @@ func NewDecoder(vr bsonrw.ValueReader) (*Decoder, error) { } // NewDecoderWithContext returns a new decoder that uses DecodeContext dc to read from vr. +// +// Deprecated: Use [NewDecoder] and use the Decoder configuration methods set the desired unmarshal +// behavior instead. func NewDecoderWithContext(dc bsoncodec.DecodeContext, vr bsonrw.ValueReader) (*Decoder, error) { if dc.Registry == nil { dc.Registry = DefaultRegistry @@ -70,8 +79,7 @@ func NewDecoderWithContext(dc bsoncodec.DecodeContext, vr bsonrw.ValueReader) (* // Decode reads the next BSON document from the stream and decodes it into the // value pointed to by val. // -// The documentation for Unmarshal contains details about of BSON into a Go -// value. +// See [Unmarshal] for details about BSON unmarshaling behavior. func (d *Decoder) Decode(val interface{}) error { if unmarshaler, ok := val.(Unmarshaler); ok { // TODO(skriptble): Reuse a []byte here and use the AppendDocumentBytes method. @@ -100,42 +108,101 @@ func (d *Decoder) Decode(val interface{}) error { if err != nil { return err } + if d.defaultDocumentM { d.dc.DefaultDocumentM() } if d.defaultDocumentD { d.dc.DefaultDocumentD() } + if d.binaryAsSlice { + d.dc.BinaryAsSlice() + } + if d.useJSONStructTags { + d.dc.UseJSONStructTags() + } + if d.useLocalTimeZone { + d.dc.UseLocalTimeZone() + } + if d.zeroMaps { + d.dc.ZeroMaps() + } + if d.zeroStructs { + d.dc.ZeroStructs() + } + return decoder.DecodeValue(d.dc, d.vr, rval) } // Reset will reset the state of the decoder, using the same *DecodeContext used in // the original construction but using vr for reading. func (d *Decoder) Reset(vr bsonrw.ValueReader) error { + // TODO:(GODRIVER-2719): Remove error return value. d.vr = vr return nil } // SetRegistry replaces the current registry of the decoder with r. func (d *Decoder) SetRegistry(r *bsoncodec.Registry) error { + // TODO:(GODRIVER-2719): Remove error return value. d.dc.Registry = r return nil } // SetContext replaces the current registry of the decoder with dc. +// +// Deprecated: Use the Decoder configuration methods to set the desired unmarshal behavior instead. func (d *Decoder) SetContext(dc bsoncodec.DecodeContext) error { + // TODO:(GODRIVER-2719): Remove error return value. d.dc = dc return nil } -// DefaultDocumentM will decode empty documents using the primitive.M type. This behavior is restricted to data typed as -// "interface{}" or "map[string]interface{}". +// DefaultDocumentM causes the Decoder to always unmarshal documents into the primitive.M type. This +// behavior is restricted to data typed as "interface{}" or "map[string]interface{}". func (d *Decoder) DefaultDocumentM() { d.defaultDocumentM = true } -// DefaultDocumentD will decode empty documents using the primitive.D type. This behavior is restricted to data typed as -// "interface{}" or "map[string]interface{}". +// DefaultDocumentD causes the Decoder to always unmarshal documents into the primitive.D type. This +// behavior is restricted to data typed as "interface{}" or "map[string]interface{}". func (d *Decoder) DefaultDocumentD() { d.defaultDocumentD = true } + +// AllowTruncatingDoubles causes the Decoder to truncate the fractional part of BSON "double" values +// when attempting to unmarshal them into a Go integer (int, int8, int16, int32, or int64) struct +// field. The truncation logic does not apply to BSON "decimal128" values. +func (d *Decoder) AllowTruncatingDoubles() { + d.dc.Truncate = true +} + +// BinaryAsSlice causes the Decoder to unmarshal BSON binary field values that are the "Generic" or +// "Old" BSON binary subtype as a Go byte slice instead of a primitive.Binary. +func (d *Decoder) BinaryAsSlice() { + d.binaryAsSlice = true +} + +// UseJSONStructTags causes the Decoder to fall back to using the "json" struct tag if a "bson" +// struct tag is not specified. +func (d *Decoder) UseJSONStructTags() { + d.useJSONStructTags = true +} + +// UseLocalTimeZone causes the Decoder to unmarshal time.Time values in the local timezone instead +// of the UTC timezone. +func (d *Decoder) UseLocalTimeZone() { + d.useLocalTimeZone = true +} + +// ZeroMaps causes the Decoder to delete any existing values from Go maps in the destination value +// passed to Decode before unmarshaling BSON documents into them. +func (d *Decoder) ZeroMaps() { + d.zeroMaps = true +} + +// ZeroStructs causes the Decoder to delete any existing values from Go structs in the destination +// value passed to Decode before unmarshaling BSON documents into them. +func (d *Decoder) ZeroStructs() { + d.zeroStructs = true +} diff --git a/vendor/go.mongodb.org/mongo-driver/bson/doc.go b/vendor/go.mongodb.org/mongo-driver/bson/doc.go index 0134006d8e..048b5eb998 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/doc.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/doc.go @@ -7,7 +7,8 @@ // Package bson is a library for reading, writing, and manipulating BSON. BSON is a binary serialization format used to // store documents and make remote procedure calls in MongoDB. The BSON specification is located at https://bsonspec.org. // The BSON library handles marshalling and unmarshalling of values through a configurable codec system. For a description -// of the codec system and examples of registering custom codecs, see the bsoncodec package. +// of the codec system and examples of registering custom codecs, see the bsoncodec package. For additional information and +// usage examples, check out the [Work with BSON] page in the Go Driver docs site. // // # Raw BSON // @@ -138,4 +139,6 @@ // # Marshalling and Unmarshalling // // Manually marshalling and unmarshalling can be done with the Marshal and Unmarshal family of functions. +// +// [Work with BSON]: https://www.mongodb.com/docs/drivers/go/current/fundamentals/bson/ package bson diff --git a/vendor/go.mongodb.org/mongo-driver/bson/encoder.go b/vendor/go.mongodb.org/mongo-driver/bson/encoder.go index fe5125d086..0be2a97fbc 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/encoder.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/encoder.go @@ -29,10 +29,20 @@ var encPool = sync.Pool{ type Encoder struct { ec bsoncodec.EncodeContext vw bsonrw.ValueWriter + + errorOnInlineDuplicates bool + intMinSize bool + stringifyMapKeysWithFmt bool + nilMapAsEmpty bool + nilSliceAsEmpty bool + nilByteSliceAsEmpty bool + omitZeroStruct bool + useJSONStructTags bool } // NewEncoder returns a new encoder that uses the DefaultRegistry to write to vw. func NewEncoder(vw bsonrw.ValueWriter) (*Encoder, error) { + // TODO:(GODRIVER-2719): Remove error return value. if vw == nil { return nil, errors.New("cannot create a new Encoder with a nil ValueWriter") } @@ -44,6 +54,9 @@ func NewEncoder(vw bsonrw.ValueWriter) (*Encoder, error) { } // NewEncoderWithContext returns a new encoder that uses EncodeContext ec to write to vw. +// +// Deprecated: Use [NewEncoder] and use the Encoder configuration methods to set the desired marshal +// behavior instead. func NewEncoderWithContext(ec bsoncodec.EncodeContext, vw bsonrw.ValueWriter) (*Encoder, error) { if ec.Registry == nil { ec = bsoncodec.EncodeContext{Registry: DefaultRegistry} @@ -60,8 +73,7 @@ func NewEncoderWithContext(ec bsoncodec.EncodeContext, vw bsonrw.ValueWriter) (* // Encode writes the BSON encoding of val to the stream. // -// The documentation for Marshal contains details about the conversion of Go -// values to BSON. +// See [Marshal] for details about BSON marshaling behavior. func (e *Encoder) Encode(val interface{}) error { if marshaler, ok := val.(Marshaler); ok { // TODO(skriptble): Should we have a MarshalAppender interface so that we can have []byte reuse? @@ -76,24 +88,112 @@ func (e *Encoder) Encode(val interface{}) error { if err != nil { return err } + + // Copy the configurations applied to the Encoder over to the EncodeContext, which actually + // communicates those configurations to the default ValueEncoders. + if e.errorOnInlineDuplicates { + e.ec.ErrorOnInlineDuplicates() + } + if e.intMinSize { + e.ec.MinSize = true + } + if e.stringifyMapKeysWithFmt { + e.ec.StringifyMapKeysWithFmt() + } + if e.nilMapAsEmpty { + e.ec.NilMapAsEmpty() + } + if e.nilSliceAsEmpty { + e.ec.NilSliceAsEmpty() + } + if e.nilByteSliceAsEmpty { + e.ec.NilByteSliceAsEmpty() + } + if e.omitZeroStruct { + e.ec.OmitZeroStruct() + } + if e.useJSONStructTags { + e.ec.UseJSONStructTags() + } + return encoder.EncodeValue(e.ec, e.vw, reflect.ValueOf(val)) } -// Reset will reset the state of the encoder, using the same *EncodeContext used in +// Reset will reset the state of the Encoder, using the same *EncodeContext used in // the original construction but using vw. func (e *Encoder) Reset(vw bsonrw.ValueWriter) error { + // TODO:(GODRIVER-2719): Remove error return value. e.vw = vw return nil } -// SetRegistry replaces the current registry of the encoder with r. +// SetRegistry replaces the current registry of the Encoder with r. func (e *Encoder) SetRegistry(r *bsoncodec.Registry) error { + // TODO:(GODRIVER-2719): Remove error return value. e.ec.Registry = r return nil } -// SetContext replaces the current EncodeContext of the encoder with er. +// SetContext replaces the current EncodeContext of the encoder with ec. +// +// Deprecated: Use the Encoder configuration methods set the desired marshal behavior instead. func (e *Encoder) SetContext(ec bsoncodec.EncodeContext) error { + // TODO:(GODRIVER-2719): Remove error return value. e.ec = ec return nil } + +// ErrorOnInlineDuplicates causes the Encoder to return an error if there is a duplicate field in +// the marshaled BSON when the "inline" struct tag option is set. +func (e *Encoder) ErrorOnInlineDuplicates() { + e.errorOnInlineDuplicates = true +} + +// IntMinSize causes the Encoder to marshal Go integer values (int, int8, int16, int32, int64, uint, +// uint8, uint16, uint32, or uint64) as the minimum BSON int size (either 32 or 64 bits) that can +// represent the integer value. +func (e *Encoder) IntMinSize() { + e.intMinSize = true +} + +// StringifyMapKeysWithFmt causes the Encoder to convert Go map keys to BSON document field name +// strings using fmt.Sprint instead of the default string conversion logic. +func (e *Encoder) StringifyMapKeysWithFmt() { + e.stringifyMapKeysWithFmt = true +} + +// NilMapAsEmpty causes the Encoder to marshal nil Go maps as empty BSON documents instead of BSON +// null. +func (e *Encoder) NilMapAsEmpty() { + e.nilMapAsEmpty = true +} + +// NilSliceAsEmpty causes the Encoder to marshal nil Go slices as empty BSON arrays instead of BSON +// null. +func (e *Encoder) NilSliceAsEmpty() { + e.nilSliceAsEmpty = true +} + +// NilByteSliceAsEmpty causes the Encoder to marshal nil Go byte slices as empty BSON binary values +// instead of BSON null. +func (e *Encoder) NilByteSliceAsEmpty() { + e.nilByteSliceAsEmpty = true +} + +// TODO(GODRIVER-2820): Update the description to remove the note about only examining exported +// TODO struct fields once the logic is updated to also inspect private struct fields. + +// OmitZeroStruct causes the Encoder to consider the zero value for a struct (e.g. MyStruct{}) +// as empty and omit it from the marshaled BSON when the "omitempty" struct tag option is set. +// +// Note that the Encoder only examines exported struct fields when determining if a struct is the +// zero value. It considers pointers to a zero struct value (e.g. &MyStruct{}) not empty. +func (e *Encoder) OmitZeroStruct() { + e.omitZeroStruct = true +} + +// UseJSONStructTags causes the Encoder to fall back to using the "json" struct tag if a "bson" +// struct tag is not specified. +func (e *Encoder) UseJSONStructTags() { + e.useJSONStructTags = true +} diff --git a/vendor/go.mongodb.org/mongo-driver/bson/marshal.go b/vendor/go.mongodb.org/mongo-driver/bson/marshal.go index db8d8ee92b..f2c48d049e 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/marshal.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/marshal.go @@ -20,17 +20,23 @@ const defaultDstCap = 256 var bvwPool = bsonrw.NewBSONValueWriterPool() var extjPool = bsonrw.NewExtJSONValueWriterPool() -// Marshaler is an interface implemented by types that can marshal themselves -// into a BSON document represented as bytes. The bytes returned must be a valid -// BSON document if the error is nil. +// Marshaler is the interface implemented by types that can marshal themselves +// into a valid BSON document. +// +// Implementations of Marshaler must return a full BSON document. To create +// custom BSON marshaling behavior for individual values in a BSON document, +// implement the ValueMarshaler interface instead. type Marshaler interface { MarshalBSON() ([]byte, error) } -// ValueMarshaler is an interface implemented by types that can marshal -// themselves into a BSON value as bytes. The type must be the valid type for -// the bytes returned. The bytes and byte type together must be valid if the -// error is nil. +// ValueMarshaler is the interface implemented by types that can marshal +// themselves into a valid BSON value. The format of the returned bytes must +// match the returned type. +// +// Implementations of ValueMarshaler must return an individual BSON value. To +// create custom BSON marshaling behavior for an entire BSON document, implement +// the Marshaler interface instead. type ValueMarshaler interface { MarshalBSONValue() (bsontype.Type, []byte, error) } @@ -48,12 +54,42 @@ func Marshal(val interface{}) ([]byte, error) { // MarshalAppend will encode val as a BSON document and append the bytes to dst. If dst is not large enough to hold the // bytes, it will be grown. If val is not a type that can be transformed into a document, MarshalValueAppend should be // used instead. +// +// Deprecated: Use [NewEncoder] and pass the dst byte slice (wrapped by a bytes.Buffer) into +// [bsonrw.NewBSONValueWriter]: +// +// buf := bytes.NewBuffer(dst) +// vw, err := bsonrw.NewBSONValueWriter(buf) +// if err != nil { +// panic(err) +// } +// enc, err := bson.NewEncoder(vw) +// if err != nil { +// panic(err) +// } +// +// See [Encoder] for more examples. func MarshalAppend(dst []byte, val interface{}) ([]byte, error) { return MarshalAppendWithRegistry(DefaultRegistry, dst, val) } // MarshalWithRegistry returns the BSON encoding of val as a BSON document. If val is not a type that can be transformed // into a document, MarshalValueWithRegistry should be used instead. +// +// Deprecated: Use [NewEncoder] and specify the Registry by calling [Encoder.SetRegistry] instead: +// +// buf := new(bytes.Buffer) +// vw, err := bsonrw.NewBSONValueWriter(buf) +// if err != nil { +// panic(err) +// } +// enc, err := bson.NewEncoder(vw) +// if err != nil { +// panic(err) +// } +// enc.SetRegistry(reg) +// +// See [Encoder] for more examples. func MarshalWithRegistry(r *bsoncodec.Registry, val interface{}) ([]byte, error) { dst := make([]byte, 0) return MarshalAppendWithRegistry(r, dst, val) @@ -61,6 +97,22 @@ func MarshalWithRegistry(r *bsoncodec.Registry, val interface{}) ([]byte, error) // MarshalWithContext returns the BSON encoding of val as a BSON document using EncodeContext ec. If val is not a type // that can be transformed into a document, MarshalValueWithContext should be used instead. +// +// Deprecated: Use [NewEncoder] and use the Encoder configuration methods to set the desired marshal +// behavior instead: +// +// buf := bytes.NewBuffer(dst) +// vw, err := bsonrw.NewBSONValueWriter(buf) +// if err != nil { +// panic(err) +// } +// enc, err := bson.NewEncoder(vw) +// if err != nil { +// panic(err) +// } +// enc.IntMinSize() +// +// See [Encoder] for more examples. func MarshalWithContext(ec bsoncodec.EncodeContext, val interface{}) ([]byte, error) { dst := make([]byte, 0) return MarshalAppendWithContext(ec, dst, val) @@ -69,6 +121,22 @@ func MarshalWithContext(ec bsoncodec.EncodeContext, val interface{}) ([]byte, er // MarshalAppendWithRegistry will encode val as a BSON document using Registry r and append the bytes to dst. If dst is // not large enough to hold the bytes, it will be grown. If val is not a type that can be transformed into a document, // MarshalValueAppendWithRegistry should be used instead. +// +// Deprecated: Use [NewEncoder], and pass the dst byte slice (wrapped by a bytes.Buffer) into +// [bsonrw.NewBSONValueWriter], and specify the Registry by calling [Encoder.SetRegistry] instead: +// +// buf := bytes.NewBuffer(dst) +// vw, err := bsonrw.NewBSONValueWriter(buf) +// if err != nil { +// panic(err) +// } +// enc, err := bson.NewEncoder(vw) +// if err != nil { +// panic(err) +// } +// enc.SetRegistry(reg) +// +// See [Encoder] for more examples. func MarshalAppendWithRegistry(r *bsoncodec.Registry, dst []byte, val interface{}) ([]byte, error) { return MarshalAppendWithContext(bsoncodec.EncodeContext{Registry: r}, dst, val) } @@ -76,6 +144,23 @@ func MarshalAppendWithRegistry(r *bsoncodec.Registry, dst []byte, val interface{ // MarshalAppendWithContext will encode val as a BSON document using Registry r and EncodeContext ec and append the // bytes to dst. If dst is not large enough to hold the bytes, it will be grown. If val is not a type that can be // transformed into a document, MarshalValueAppendWithContext should be used instead. +// +// Deprecated: Use [NewEncoder], pass the dst byte slice (wrapped by a bytes.Buffer) into +// [bsonrw.NewBSONValueWriter], and use the Encoder configuration methods to set the desired marshal +// behavior instead: +// +// buf := bytes.NewBuffer(dst) +// vw, err := bsonrw.NewBSONValueWriter(buf) +// if err != nil { +// panic(err) +// } +// enc, err := bson.NewEncoder(vw) +// if err != nil { +// panic(err) +// } +// enc.IntMinSize() +// +// See [Encoder] for more examples. func MarshalAppendWithContext(ec bsoncodec.EncodeContext, dst []byte, val interface{}) ([]byte, error) { sw := new(bsonrw.SliceWriter) *sw = dst @@ -112,17 +197,26 @@ func MarshalValue(val interface{}) (bsontype.Type, []byte, error) { // MarshalValueAppend will append the BSON encoding of val to dst. If dst is not large enough to hold the BSON encoding // of val, dst will be grown. +// +// Deprecated: Appending individual BSON elements to an existing slice will not be supported in Go +// Driver 2.0. func MarshalValueAppend(dst []byte, val interface{}) (bsontype.Type, []byte, error) { return MarshalValueAppendWithRegistry(DefaultRegistry, dst, val) } // MarshalValueWithRegistry returns the BSON encoding of val using Registry r. +// +// Deprecated: Using a custom registry to marshal individual BSON values will not be supported in Go +// Driver 2.0. func MarshalValueWithRegistry(r *bsoncodec.Registry, val interface{}) (bsontype.Type, []byte, error) { dst := make([]byte, 0) return MarshalValueAppendWithRegistry(r, dst, val) } // MarshalValueWithContext returns the BSON encoding of val using EncodeContext ec. +// +// Deprecated: Using a custom EncodeContext to marshal individual BSON elements will not be +// supported in Go Driver 2.0. func MarshalValueWithContext(ec bsoncodec.EncodeContext, val interface{}) (bsontype.Type, []byte, error) { dst := make([]byte, 0) return MarshalValueAppendWithContext(ec, dst, val) @@ -130,12 +224,18 @@ func MarshalValueWithContext(ec bsoncodec.EncodeContext, val interface{}) (bsont // MarshalValueAppendWithRegistry will append the BSON encoding of val to dst using Registry r. If dst is not large // enough to hold the BSON encoding of val, dst will be grown. +// +// Deprecated: Appending individual BSON elements to an existing slice will not be supported in Go +// Driver 2.0. func MarshalValueAppendWithRegistry(r *bsoncodec.Registry, dst []byte, val interface{}) (bsontype.Type, []byte, error) { return MarshalValueAppendWithContext(bsoncodec.EncodeContext{Registry: r}, dst, val) } // MarshalValueAppendWithContext will append the BSON encoding of val to dst using EncodeContext ec. If dst is not large // enough to hold the BSON encoding of val, dst will be grown. +// +// Deprecated: Appending individual BSON elements to an existing slice will not be supported in Go +// Driver 2.0. func MarshalValueAppendWithContext(ec bsoncodec.EncodeContext, dst []byte, val interface{}) (bsontype.Type, []byte, error) { // get a ValueWriter configured to write to dst sw := new(bsonrw.SliceWriter) @@ -173,17 +273,63 @@ func MarshalExtJSON(val interface{}, canonical, escapeHTML bool) ([]byte, error) // MarshalExtJSONAppend will append the extended JSON encoding of val to dst. // If dst is not large enough to hold the extended JSON encoding of val, dst // will be grown. +// +// Deprecated: Use [NewEncoder] and pass the dst byte slice (wrapped by a bytes.Buffer) into +// [bsonrw.NewExtJSONValueWriter] instead: +// +// buf := bytes.NewBuffer(dst) +// vw, err := bsonrw.NewExtJSONValueWriter(buf, true, false) +// if err != nil { +// panic(err) +// } +// enc, err := bson.NewEncoder(vw) +// if err != nil { +// panic(err) +// } +// +// See [Encoder] for more examples. func MarshalExtJSONAppend(dst []byte, val interface{}, canonical, escapeHTML bool) ([]byte, error) { return MarshalExtJSONAppendWithRegistry(DefaultRegistry, dst, val, canonical, escapeHTML) } // MarshalExtJSONWithRegistry returns the extended JSON encoding of val using Registry r. +// +// Deprecated: Use [NewEncoder] and specify the Registry by calling [Encoder.SetRegistry] instead: +// +// buf := new(bytes.Buffer) +// vw, err := bsonrw.NewBSONValueWriter(buf) +// if err != nil { +// panic(err) +// } +// enc, err := bson.NewEncoder(vw) +// if err != nil { +// panic(err) +// } +// enc.SetRegistry(reg) +// +// See [Encoder] for more examples. func MarshalExtJSONWithRegistry(r *bsoncodec.Registry, val interface{}, canonical, escapeHTML bool) ([]byte, error) { dst := make([]byte, 0, defaultDstCap) return MarshalExtJSONAppendWithContext(bsoncodec.EncodeContext{Registry: r}, dst, val, canonical, escapeHTML) } // MarshalExtJSONWithContext returns the extended JSON encoding of val using Registry r. +// +// Deprecated: Use [NewEncoder] and use the Encoder configuration methods to set the desired marshal +// behavior instead: +// +// buf := new(bytes.Buffer) +// vw, err := bsonrw.NewBSONValueWriter(buf) +// if err != nil { +// panic(err) +// } +// enc, err := bson.NewEncoder(vw) +// if err != nil { +// panic(err) +// } +// enc.IntMinSize() +// +// See [Encoder] for more examples. func MarshalExtJSONWithContext(ec bsoncodec.EncodeContext, val interface{}, canonical, escapeHTML bool) ([]byte, error) { dst := make([]byte, 0, defaultDstCap) return MarshalExtJSONAppendWithContext(ec, dst, val, canonical, escapeHTML) @@ -192,6 +338,22 @@ func MarshalExtJSONWithContext(ec bsoncodec.EncodeContext, val interface{}, cano // MarshalExtJSONAppendWithRegistry will append the extended JSON encoding of // val to dst using Registry r. If dst is not large enough to hold the BSON // encoding of val, dst will be grown. +// +// Deprecated: Use [NewEncoder], pass the dst byte slice (wrapped by a bytes.Buffer) into +// [bsonrw.NewExtJSONValueWriter], and specify the Registry by calling [Encoder.SetRegistry] +// instead: +// +// buf := bytes.NewBuffer(dst) +// vw, err := bsonrw.NewExtJSONValueWriter(buf, true, false) +// if err != nil { +// panic(err) +// } +// enc, err := bson.NewEncoder(vw) +// if err != nil { +// panic(err) +// } +// +// See [Encoder] for more examples. func MarshalExtJSONAppendWithRegistry(r *bsoncodec.Registry, dst []byte, val interface{}, canonical, escapeHTML bool) ([]byte, error) { return MarshalExtJSONAppendWithContext(bsoncodec.EncodeContext{Registry: r}, dst, val, canonical, escapeHTML) } @@ -199,6 +361,23 @@ func MarshalExtJSONAppendWithRegistry(r *bsoncodec.Registry, dst []byte, val int // MarshalExtJSONAppendWithContext will append the extended JSON encoding of // val to dst using Registry r. If dst is not large enough to hold the BSON // encoding of val, dst will be grown. +// +// Deprecated: Use [NewEncoder], pass the dst byte slice (wrapped by a bytes.Buffer) into +// [bsonrw.NewExtJSONValueWriter], and use the Encoder configuration methods to set the desired marshal +// behavior instead: +// +// buf := bytes.NewBuffer(dst) +// vw, err := bsonrw.NewExtJSONValueWriter(buf, true, false) +// if err != nil { +// panic(err) +// } +// enc, err := bson.NewEncoder(vw) +// if err != nil { +// panic(err) +// } +// enc.IntMinSize() +// +// See [Encoder] for more examples. func MarshalExtJSONAppendWithContext(ec bsoncodec.EncodeContext, dst []byte, val interface{}, canonical, escapeHTML bool) ([]byte, error) { sw := new(bsonrw.SliceWriter) *sw = dst diff --git a/vendor/go.mongodb.org/mongo-driver/bson/primitive/decimal.go b/vendor/go.mongodb.org/mongo-driver/bson/primitive/decimal.go index ba7c9112e9..24ab58fc49 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/primitive/decimal.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/primitive/decimal.go @@ -328,6 +328,7 @@ func ParseDecimal128(s string) (Decimal128, error) { return dErr(s) } + // Parse the significand (i.e. the non-exponent part) as a big.Int. bi, ok := new(big.Int).SetString(intPart+decPart, 10) if !ok { return dErr(s) @@ -360,6 +361,19 @@ func ParseDecimal128FromBigInt(bi *big.Int, exp int) (Decimal128, bool) { q := new(big.Int) r := new(big.Int) + // If the significand is zero, the logical value will always be zero, independent of the + // exponent. However, the loops for handling out-of-range exponent values below may be extremely + // slow for zero values because the significand never changes. Limit the exponent value to the + // supported range here to prevent entering the loops below. + if bi.Cmp(zero) == 0 { + if exp > MaxDecimal128Exp { + exp = MaxDecimal128Exp + } + if exp < MinDecimal128Exp { + exp = MinDecimal128Exp + } + } + for bigIntCmpAbs(bi, maxS) == 1 { bi, _ = q.QuoRem(bi, ten, r) if r.Cmp(zero) != 0 { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/primitive/objectid.go b/vendor/go.mongodb.org/mongo-driver/bson/primitive/objectid.go index ded3673165..9bbaffac26 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/primitive/objectid.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/primitive/objectid.go @@ -82,18 +82,18 @@ func ObjectIDFromHex(s string) (ObjectID, error) { return NilObjectID, ErrInvalidHex } - b, err := hex.DecodeString(s) + var oid [12]byte + _, err := hex.Decode(oid[:], []byte(s)) if err != nil { return NilObjectID, err } - var oid [12]byte - copy(oid[:], b) - return oid, nil } // IsValidObjectID returns true if the provided hex string represents a valid ObjectID and false if not. +// +// Deprecated: Use ObjectIDFromHex and check the error instead. func IsValidObjectID(s string) bool { _, err := ObjectIDFromHex(s) return err == nil diff --git a/vendor/go.mongodb.org/mongo-driver/bson/primitive/primitive.go b/vendor/go.mongodb.org/mongo-driver/bson/primitive/primitive.go index c72ccc1c4d..65f4fbb949 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/primitive/primitive.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/primitive/primitive.go @@ -45,7 +45,7 @@ var _ json.Unmarshaler = (*DateTime)(nil) // MarshalJSON marshal to time type. func (d DateTime) MarshalJSON() ([]byte, error) { - return json.Marshal(d.Time()) + return json.Marshal(d.Time().UTC()) } // UnmarshalJSON creates a primitive.DateTime from a JSON string. @@ -141,6 +141,16 @@ type Timestamp struct { I uint32 } +// After reports whether the time instant tp is after tp2. +func (tp Timestamp) After(tp2 Timestamp) bool { + return tp.T > tp2.T || (tp.T == tp2.T && tp.I > tp2.I) +} + +// Before reports whether the time instant tp is before tp2. +func (tp Timestamp) Before(tp2 Timestamp) bool { + return tp.T < tp2.T || (tp.T == tp2.T && tp.I < tp2.I) +} + // Equal compares tp to tp2 and returns true if they are equal. func (tp Timestamp) Equal(tp2 Timestamp) bool { return tp.T == tp2.T && tp.I == tp2.I @@ -151,24 +161,25 @@ func (tp Timestamp) IsZero() bool { return tp.T == 0 && tp.I == 0 } -// CompareTimestamp returns an integer comparing two Timestamps, where T is compared first, followed by I. -// Returns 0 if tp = tp2, 1 if tp > tp2, -1 if tp < tp2. -func CompareTimestamp(tp, tp2 Timestamp) int { - if tp.Equal(tp2) { +// Compare compares the time instant tp with tp2. If tp is before tp2, it returns -1; if tp is after +// tp2, it returns +1; if they're the same, it returns 0. +func (tp Timestamp) Compare(tp2 Timestamp) int { + switch { + case tp.Equal(tp2): return 0 - } - - if tp.T > tp2.T { - return 1 - } - if tp.T < tp2.T { + case tp.Before(tp2): return -1 + default: + return +1 } - // Compare I values because T values are equal - if tp.I > tp2.I { - return 1 - } - return -1 +} + +// CompareTimestamp compares the time instant tp with tp2. If tp is before tp2, it returns -1; if tp is after +// tp2, it returns +1; if they're the same, it returns 0. +// +// Deprecated: Use Timestamp.Compare instead. +func CompareTimestamp(tp, tp2 Timestamp) int { + return tp.Compare(tp2) } // MinKey represents the BSON minkey value. @@ -186,6 +197,9 @@ type MaxKey struct{} type D []E // Map creates a map from the elements of the D. +// +// Deprecated: Converting directly from a D to an M will not be supported in Go Driver 2.0. Instead, +// users should marshal the D to BSON using bson.Marshal and unmarshal it to M using bson.Unmarshal. func (d D) Map() M { m := make(M, len(d)) for _, e := range d { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/primitive_codecs.go b/vendor/go.mongodb.org/mongo-driver/bson/primitive_codecs.go index 1cbe3884d1..6b9602589c 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/primitive_codecs.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/primitive_codecs.go @@ -21,10 +21,16 @@ var primitiveCodecs PrimitiveCodecs // PrimitiveCodecs is a namespace for all of the default bsoncodec.Codecs for the primitive types // defined in this package. +// +// Deprecated: Use bson.NewRegistry to get a registry with all primitive encoders and decoders +// registered. type PrimitiveCodecs struct{} // RegisterPrimitiveCodecs will register the encode and decode methods attached to PrimitiveCodecs // with the provided RegistryBuilder. if rb is nil, a new empty RegistryBuilder will be created. +// +// Deprecated: Use bson.NewRegistry to get a registry with all primitive encoders and decoders +// registered. func (pc PrimitiveCodecs) RegisterPrimitiveCodecs(rb *bsoncodec.RegistryBuilder) { if rb == nil { panic(errors.New("argument to RegisterPrimitiveCodecs must not be nil")) @@ -38,7 +44,10 @@ func (pc PrimitiveCodecs) RegisterPrimitiveCodecs(rb *bsoncodec.RegistryBuilder) } // RawValueEncodeValue is the ValueEncoderFunc for RawValue. -func (PrimitiveCodecs) RawValueEncodeValue(ec bsoncodec.EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use bson.NewRegistry to get a registry with all primitive encoders and decoders +// registered. +func (PrimitiveCodecs) RawValueEncodeValue(_ bsoncodec.EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tRawValue { return bsoncodec.ValueEncoderError{Name: "RawValueEncodeValue", Types: []reflect.Type{tRawValue}, Received: val} } @@ -49,7 +58,10 @@ func (PrimitiveCodecs) RawValueEncodeValue(ec bsoncodec.EncodeContext, vw bsonrw } // RawValueDecodeValue is the ValueDecoderFunc for RawValue. -func (PrimitiveCodecs) RawValueDecodeValue(dc bsoncodec.DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { +// +// Deprecated: Use bson.NewRegistry to get a registry with all primitive encoders and decoders +// registered. +func (PrimitiveCodecs) RawValueDecodeValue(_ bsoncodec.DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tRawValue { return bsoncodec.ValueDecoderError{Name: "RawValueDecodeValue", Types: []reflect.Type{tRawValue}, Received: val} } @@ -64,7 +76,10 @@ func (PrimitiveCodecs) RawValueDecodeValue(dc bsoncodec.DecodeContext, vr bsonrw } // RawEncodeValue is the ValueEncoderFunc for Reader. -func (PrimitiveCodecs) RawEncodeValue(ec bsoncodec.EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { +// +// Deprecated: Use bson.NewRegistry to get a registry with all primitive encoders and decoders +// registered. +func (PrimitiveCodecs) RawEncodeValue(_ bsoncodec.EncodeContext, vw bsonrw.ValueWriter, val reflect.Value) error { if !val.IsValid() || val.Type() != tRaw { return bsoncodec.ValueEncoderError{Name: "RawEncodeValue", Types: []reflect.Type{tRaw}, Received: val} } @@ -75,7 +90,10 @@ func (PrimitiveCodecs) RawEncodeValue(ec bsoncodec.EncodeContext, vw bsonrw.Valu } // RawDecodeValue is the ValueDecoderFunc for Reader. -func (PrimitiveCodecs) RawDecodeValue(dc bsoncodec.DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { +// +// Deprecated: Use bson.NewRegistry to get a registry with all primitive encoders and decoders +// registered. +func (PrimitiveCodecs) RawDecodeValue(_ bsoncodec.DecodeContext, vr bsonrw.ValueReader, val reflect.Value) error { if !val.CanSet() || val.Type() != tRaw { return bsoncodec.ValueDecoderError{Name: "RawDecodeValue", Types: []reflect.Type{tRaw}, Received: val} } diff --git a/vendor/go.mongodb.org/mongo-driver/bson/raw.go b/vendor/go.mongodb.org/mongo-driver/bson/raw.go index efd705daaa..fe990a1771 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/raw.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/raw.go @@ -16,18 +16,27 @@ import ( // ErrNilReader indicates that an operation was attempted on a nil bson.Reader. var ErrNilReader = errors.New("nil reader") -// Raw is a wrapper around a byte slice. It will interpret the slice as a -// BSON document. This type is a wrapper around a bsoncore.Document. Errors returned from the -// methods on this type and associated types come from the bsoncore package. +// Raw is a raw encoded BSON document. It can be used to delay BSON document decoding or precompute +// a BSON encoded document. +// +// A Raw must be a full BSON document. Use the RawValue type for individual BSON values. type Raw []byte -// NewFromIOReader reads in a document from the given io.Reader and constructs a Raw from -// it. -func NewFromIOReader(r io.Reader) (Raw, error) { +// ReadDocument reads a BSON document from the io.Reader and returns it as a bson.Raw. If the +// reader contains multiple BSON documents, only the first document is read. +func ReadDocument(r io.Reader) (Raw, error) { doc, err := bsoncore.NewDocumentFromReader(r) return Raw(doc), err } +// NewFromIOReader reads a BSON document from the io.Reader and returns it as a bson.Raw. If the +// reader contains multiple BSON documents, only the first document is read. +// +// Deprecated: Use ReadDocument instead. +func NewFromIOReader(r io.Reader) (Raw, error) { + return ReadDocument(r) +} + // Validate validates the document. This method only validates the first document in // the slice, to validate other documents, the slice must be resliced. func (r Raw) Validate() (err error) { return bsoncore.Document(r).Validate() } @@ -81,5 +90,5 @@ func (r Raw) IndexErr(index uint) (RawElement, error) { return RawElement(elem), err } -// String implements the fmt.Stringer interface. +// String returns the BSON document encoded as Extended JSON. func (r Raw) String() string { return bsoncore.Document(r).String() } diff --git a/vendor/go.mongodb.org/mongo-driver/bson/raw_element.go b/vendor/go.mongodb.org/mongo-driver/bson/raw_element.go index 006f503a30..8ce13c2cc7 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/raw_element.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/raw_element.go @@ -10,10 +10,7 @@ import ( "go.mongodb.org/mongo-driver/x/bsonx/bsoncore" ) -// RawElement represents a BSON element in byte form. This type provides a simple way to -// transform a slice of bytes into a BSON element and extract information from it. -// -// RawElement is a thin wrapper around a bsoncore.Element. +// RawElement is a raw encoded BSON document or array element. type RawElement []byte // Key returns the key for this element. If the element is not valid, this method returns an empty @@ -36,7 +33,7 @@ func (re RawElement) ValueErr() (RawValue, error) { // Validate ensures re is a valid BSON element. func (re RawElement) Validate() error { return bsoncore.Element(re).Validate() } -// String implements the fmt.Stringer interface. The output will be in extended JSON format. +// String returns the BSON element encoded as Extended JSON. func (re RawElement) String() string { doc := bsoncore.BuildDocument(nil, re) j, err := MarshalExtJSON(Raw(doc), true, false) diff --git a/vendor/go.mongodb.org/mongo-driver/bson/raw_value.go b/vendor/go.mongodb.org/mongo-driver/bson/raw_value.go index 75297f30fe..6627294c4d 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/raw_value.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/raw_value.go @@ -26,11 +26,10 @@ var ErrNilContext = errors.New("DecodeContext cannot be nil") // ErrNilRegistry is returned when the provided registry is nil. var ErrNilRegistry = errors.New("Registry cannot be nil") -// RawValue represents a BSON value in byte form. It can be used to hold unprocessed BSON or to -// defer processing of BSON. Type is the BSON type of the value and Value are the raw bytes that -// represent the element. +// RawValue is a raw encoded BSON value. It can be used to delay BSON value decoding or precompute +// BSON encoded value. Type is the BSON type of the value and Value is the raw encoded BSON value. // -// This type wraps bsoncore.Value for most of it's functionality. +// A RawValue must be an individual BSON value. Use the Raw type for full BSON documents. type RawValue struct { Type bsontype.Type Value []byte @@ -268,10 +267,16 @@ func (rv RawValue) Int32OK() (int32, bool) { return convertToCoreValue(rv).Int32 // AsInt32 returns a BSON number as an int32. If the BSON type is not a numeric one, this method // will panic. +// +// Deprecated: Use AsInt64 instead. If an int32 is required, convert the returned value to an int32 +// and perform any required overflow/underflow checking. func (rv RawValue) AsInt32() int32 { return convertToCoreValue(rv).AsInt32() } // AsInt32OK is the same as AsInt32, except that it returns a boolean instead of // panicking. +// +// Deprecated: Use AsInt64OK instead. If an int32 is required, convert the returned value to an +// int32 and perform any required overflow/underflow checking. func (rv RawValue) AsInt32OK() (int32, bool) { return convertToCoreValue(rv).AsInt32OK() } // Timestamp returns the BSON timestamp value the Value represents. It panics if the value is a diff --git a/vendor/go.mongodb.org/mongo-driver/bson/registry.go b/vendor/go.mongodb.org/mongo-driver/bson/registry.go index 16d7573e75..b5b0f35687 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/registry.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/registry.go @@ -6,15 +6,19 @@ package bson -import "go.mongodb.org/mongo-driver/bson/bsoncodec" +import ( + "go.mongodb.org/mongo-driver/bson/bsoncodec" +) // DefaultRegistry is the default bsoncodec.Registry. It contains the default codecs and the // primitive codecs. -var DefaultRegistry = NewRegistryBuilder().Build() +var DefaultRegistry = NewRegistry() // NewRegistryBuilder creates a new RegistryBuilder configured with the default encoders and // decoders from the bsoncodec.DefaultValueEncoders and bsoncodec.DefaultValueDecoders types and the // PrimitiveCodecs type in this package. +// +// Deprecated: Use NewRegistry instead. func NewRegistryBuilder() *bsoncodec.RegistryBuilder { rb := bsoncodec.NewRegistryBuilder() bsoncodec.DefaultValueEncoders{}.RegisterDefaultEncoders(rb) @@ -22,3 +26,10 @@ func NewRegistryBuilder() *bsoncodec.RegistryBuilder { primitiveCodecs.RegisterPrimitiveCodecs(rb) return rb } + +// NewRegistry creates a new Registry configured with the default encoders and decoders from the +// bsoncodec.DefaultValueEncoders and bsoncodec.DefaultValueDecoders types and the PrimitiveCodecs +// type in this package. +func NewRegistry() *bsoncodec.Registry { + return NewRegistryBuilder().Build() +} diff --git a/vendor/go.mongodb.org/mongo-driver/bson/types.go b/vendor/go.mongodb.org/mongo-driver/bson/types.go index 13a1c35cf6..e201ac37eb 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/types.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/types.go @@ -10,7 +10,7 @@ import ( "go.mongodb.org/mongo-driver/bson/bsontype" ) -// These constants uniquely refer to each BSON type. +// BSON element types as described in https://bsonspec.org/spec.html. const ( TypeDouble = bsontype.Double TypeString = bsontype.String @@ -34,3 +34,16 @@ const ( TypeMinKey = bsontype.MinKey TypeMaxKey = bsontype.MaxKey ) + +// BSON binary element subtypes as described in https://bsonspec.org/spec.html. +const ( + TypeBinaryGeneric = bsontype.BinaryGeneric + TypeBinaryFunction = bsontype.BinaryFunction + TypeBinaryBinaryOld = bsontype.BinaryBinaryOld + TypeBinaryUUIDOld = bsontype.BinaryUUIDOld + TypeBinaryUUID = bsontype.BinaryUUID + TypeBinaryMD5 = bsontype.BinaryMD5 + TypeBinaryEncrypted = bsontype.BinaryEncrypted + TypeBinaryColumn = bsontype.BinaryColumn + TypeBinaryUserDefined = bsontype.BinaryUserDefined +) diff --git a/vendor/go.mongodb.org/mongo-driver/bson/unmarshal.go b/vendor/go.mongodb.org/mongo-driver/bson/unmarshal.go index f936ba1836..66da17ee01 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/unmarshal.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/unmarshal.go @@ -14,18 +14,26 @@ import ( "go.mongodb.org/mongo-driver/bson/bsontype" ) -// Unmarshaler is an interface implemented by types that can unmarshal a BSON -// document representation of themselves. The BSON bytes can be assumed to be -// valid. UnmarshalBSON must copy the BSON bytes if it wishes to retain the data -// after returning. +// Unmarshaler is the interface implemented by types that can unmarshal a BSON +// document representation of themselves. The input can be assumed to be a valid +// encoding of a BSON document. UnmarshalBSON must copy the JSON data if it +// wishes to retain the data after returning. +// +// Unmarshaler is only used to unmarshal full BSON documents. To create custom +// BSON unmarshaling behavior for individual values in a BSON document, +// implement the ValueUnmarshaler interface instead. type Unmarshaler interface { UnmarshalBSON([]byte) error } -// ValueUnmarshaler is an interface implemented by types that can unmarshal a -// BSON value representation of themselves. The BSON bytes and type can be -// assumed to be valid. UnmarshalBSONValue must copy the BSON value bytes if it -// wishes to retain the data after returning. +// ValueUnmarshaler is the interface implemented by types that can unmarshal a +// BSON value representation of themselves. The input can be assumed to be a +// valid encoding of a BSON value. UnmarshalBSONValue must copy the BSON value +// bytes if it wishes to retain the data after returning. +// +// ValueUnmarshaler is only used to unmarshal individual values in a BSON +// document. To create custom BSON unmarshaling behavior for an entire BSON +// document, implement the Unmarshaler interface instead. type ValueUnmarshaler interface { UnmarshalBSONValue(bsontype.Type, []byte) error } @@ -40,6 +48,16 @@ func Unmarshal(data []byte, val interface{}) error { // UnmarshalWithRegistry parses the BSON-encoded data using Registry r and // stores the result in the value pointed to by val. If val is nil or not // a pointer, UnmarshalWithRegistry returns InvalidUnmarshalError. +// +// Deprecated: Use [NewDecoder] and specify the Registry by calling [Decoder.SetRegistry] instead: +// +// dec, err := bson.NewDecoder(bsonrw.NewBSONDocumentReader(data)) +// if err != nil { +// panic(err) +// } +// dec.SetRegistry(reg) +// +// See [Decoder] for more examples. func UnmarshalWithRegistry(r *bsoncodec.Registry, data []byte, val interface{}) error { vr := bsonrw.NewBSONDocumentReader(data) return unmarshalFromReader(bsoncodec.DecodeContext{Registry: r}, vr, val) @@ -48,11 +66,40 @@ func UnmarshalWithRegistry(r *bsoncodec.Registry, data []byte, val interface{}) // UnmarshalWithContext parses the BSON-encoded data using DecodeContext dc and // stores the result in the value pointed to by val. If val is nil or not // a pointer, UnmarshalWithRegistry returns InvalidUnmarshalError. +// +// Deprecated: Use [NewDecoder] and use the Decoder configuration methods to set the desired unmarshal +// behavior instead: +// +// dec, err := bson.NewDecoder(bsonrw.NewBSONDocumentReader(data)) +// if err != nil { +// panic(err) +// } +// dec.DefaultDocumentM() +// +// See [Decoder] for more examples. func UnmarshalWithContext(dc bsoncodec.DecodeContext, data []byte, val interface{}) error { vr := bsonrw.NewBSONDocumentReader(data) return unmarshalFromReader(dc, vr, val) } +// UnmarshalValue parses the BSON value of type t with bson.DefaultRegistry and +// stores the result in the value pointed to by val. If val is nil or not a pointer, +// UnmarshalValue returns an error. +func UnmarshalValue(t bsontype.Type, data []byte, val interface{}) error { + return UnmarshalValueWithRegistry(DefaultRegistry, t, data, val) +} + +// UnmarshalValueWithRegistry parses the BSON value of type t with registry r and +// stores the result in the value pointed to by val. If val is nil or not a pointer, +// UnmarshalValue returns an error. +// +// Deprecated: Using a custom registry to unmarshal individual BSON values will not be supported in +// Go Driver 2.0. +func UnmarshalValueWithRegistry(r *bsoncodec.Registry, t bsontype.Type, data []byte, val interface{}) error { + vr := bsonrw.NewBSONValueReader(t, data) + return unmarshalFromReader(bsoncodec.DecodeContext{Registry: r}, vr, val) +} + // UnmarshalExtJSON parses the extended JSON-encoded data and stores the result // in the value pointed to by val. If val is nil or not a pointer, Unmarshal // returns InvalidUnmarshalError. @@ -63,6 +110,20 @@ func UnmarshalExtJSON(data []byte, canonical bool, val interface{}) error { // UnmarshalExtJSONWithRegistry parses the extended JSON-encoded data using // Registry r and stores the result in the value pointed to by val. If val is // nil or not a pointer, UnmarshalWithRegistry returns InvalidUnmarshalError. +// +// Deprecated: Use [NewDecoder] and specify the Registry by calling [Decoder.SetRegistry] instead: +// +// vr, err := bsonrw.NewExtJSONValueReader(bytes.NewReader(data), true) +// if err != nil { +// panic(err) +// } +// dec, err := bson.NewDecoder(vr) +// if err != nil { +// panic(err) +// } +// dec.SetRegistry(reg) +// +// See [Decoder] for more examples. func UnmarshalExtJSONWithRegistry(r *bsoncodec.Registry, data []byte, canonical bool, val interface{}) error { ejvr, err := bsonrw.NewExtJSONValueReader(bytes.NewReader(data), canonical) if err != nil { @@ -75,6 +136,21 @@ func UnmarshalExtJSONWithRegistry(r *bsoncodec.Registry, data []byte, canonical // UnmarshalExtJSONWithContext parses the extended JSON-encoded data using // DecodeContext dc and stores the result in the value pointed to by val. If val is // nil or not a pointer, UnmarshalWithRegistry returns InvalidUnmarshalError. +// +// Deprecated: Use [NewDecoder] and use the Decoder configuration methods to set the desired unmarshal +// behavior instead: +// +// vr, err := bsonrw.NewExtJSONValueReader(bytes.NewReader(data), true) +// if err != nil { +// panic(err) +// } +// dec, err := bson.NewDecoder(vr) +// if err != nil { +// panic(err) +// } +// dec.DefaultDocumentM() +// +// See [Decoder] for more examples. func UnmarshalExtJSONWithContext(dc bsoncodec.DecodeContext, data []byte, canonical bool, val interface{}) error { ejvr, err := bsonrw.NewExtJSONValueReader(bytes.NewReader(data), canonical) if err != nil { diff --git a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/array.go b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/array.go index 8ea60ba3c6..6bc0afa700 100644 --- a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/array.go +++ b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/array.go @@ -7,10 +7,10 @@ package bsoncore import ( - "bytes" "fmt" "io" "strconv" + "strings" ) // NewArrayLengthError creates and returns an error for when the length of an array exceeds the @@ -53,7 +53,7 @@ func (a Array) DebugString() string { if len(a) < 5 { return "<malformed>" } - var buf bytes.Buffer + var buf strings.Builder buf.WriteString("Array") length, rem, _ := ReadLength(a) // We know we have enough bytes to read the length buf.WriteByte('(') @@ -69,7 +69,7 @@ func (a Array) DebugString() string { buf.WriteString(fmt.Sprintf("<malformed (%d)>", length)) break } - fmt.Fprintf(&buf, "%s", elem.Value().DebugString()) + buf.WriteString(elem.Value().DebugString()) if length != 1 { buf.WriteByte(',') } @@ -85,7 +85,7 @@ func (a Array) String() string { if len(a) < 5 { return "" } - var buf bytes.Buffer + var buf strings.Builder buf.WriteByte('[') length, rem, _ := ReadLength(a) // We know we have enough bytes to read the length @@ -100,7 +100,7 @@ func (a Array) String() string { if !ok { return "" } - fmt.Fprintf(&buf, "%s", elem.Value().String()) + buf.WriteString(elem.Value().String()) if length > 1 { buf.WriteByte(',') } diff --git a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/bsoncore.go b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/bsoncore.go index 17aad6d71e..94d479428f 100644 --- a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/bsoncore.go +++ b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/bsoncore.go @@ -4,25 +4,6 @@ // not use this file except in compliance with the License. You may obtain // a copy of the License at http://www.apache.org/licenses/LICENSE-2.0 -// Package bsoncore contains functions that can be used to encode and decode BSON -// elements and values to or from a slice of bytes. These functions are aimed at -// allowing low level manipulation of BSON and can be used to build a higher -// level BSON library. -// -// The Read* functions within this package return the values of the element and -// a boolean indicating if the values are valid. A boolean was used instead of -// an error because any error that would be returned would be the same: not -// enough bytes. This library attempts to do no validation, it will only return -// false if there are not enough bytes for an item to be read. For example, the -// ReadDocument function checks the length, if that length is larger than the -// number of bytes available, it will return false, if there are enough bytes, it -// will return those bytes and true. It is the consumers responsibility to -// validate those bytes. -// -// The Append* functions within this package will append the type value to the -// given dst slice. If the slice has enough capacity, it will not grow the -// slice. The Append*Element functions within this package operate in the same -// way, but additionally append the BSON type and the key before the value. package bsoncore // import "go.mongodb.org/mongo-driver/x/bsonx/bsoncore" import ( diff --git a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/doc.go b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/doc.go new file mode 100644 index 0000000000..6837b53fc5 --- /dev/null +++ b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/doc.go @@ -0,0 +1,29 @@ +// Copyright (C) MongoDB, Inc. 2022-present. +// +// Licensed under the Apache License, Version 2.0 (the "License"); you may +// not use this file except in compliance with the License. You may obtain +// a copy of the License at http://www.apache.org/licenses/LICENSE-2.0 + +// Package bsoncore contains functions that can be used to encode and decode BSON +// elements and values to or from a slice of bytes. These functions are aimed at +// allowing low level manipulation of BSON and can be used to build a higher +// level BSON library. +// +// The Read* functions within this package return the values of the element and +// a boolean indicating if the values are valid. A boolean was used instead of +// an error because any error that would be returned would be the same: not +// enough bytes. This library attempts to do no validation, it will only return +// false if there are not enough bytes for an item to be read. For example, the +// ReadDocument function checks the length, if that length is larger than the +// number of bytes available, it will return false, if there are enough bytes, it +// will return those bytes and true. It is the consumers responsibility to +// validate those bytes. +// +// The Append* functions within this package will append the type value to the +// given dst slice. If the slice has enough capacity, it will not grow the +// slice. The Append*Element functions within this package operate in the same +// way, but additionally append the BSON type and the key before the value. +// +// Warning: Package bsoncore is unstable and there is no backward compatibility +// guarantee. It is experimental and subject to change. +package bsoncore diff --git a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/document.go b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/document.go index d6e4bb069f..3f360f1ae1 100644 --- a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/document.go +++ b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/document.go @@ -7,11 +7,11 @@ package bsoncore import ( - "bytes" "errors" "fmt" "io" "strconv" + "strings" "go.mongodb.org/mongo-driver/bson/bsontype" ) @@ -237,7 +237,7 @@ func (d Document) DebugString() string { if len(d) < 5 { return "<malformed>" } - var buf bytes.Buffer + var buf strings.Builder buf.WriteString("Document") length, rem, _ := ReadLength(d) // We know we have enough bytes to read the length buf.WriteByte('(') @@ -253,7 +253,7 @@ func (d Document) DebugString() string { buf.WriteString(fmt.Sprintf("<malformed (%d)>", length)) break } - fmt.Fprintf(&buf, "%s ", elem.DebugString()) + buf.WriteString(elem.DebugString()) } buf.WriteByte('}') @@ -266,7 +266,7 @@ func (d Document) String() string { if len(d) < 5 { return "" } - var buf bytes.Buffer + var buf strings.Builder buf.WriteByte('{') length, rem, _ := ReadLength(d) // We know we have enough bytes to read the length @@ -285,7 +285,7 @@ func (d Document) String() string { if !ok { return "" } - fmt.Fprintf(&buf, "%s", elem.String()) + buf.WriteString(elem.String()) first = false } buf.WriteByte('}') diff --git a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/element.go b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/element.go index 3acb4222b2..1fe0897c91 100644 --- a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/element.go +++ b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/element.go @@ -129,7 +129,7 @@ func (e Element) String() string { if !valid { return "" } - return fmt.Sprintf(`"%s": %v`, key, val) + return "\"" + string(key) + "\": " + val.String() } // DebugString outputs a human readable version of RawElement. It will attempt to stringify the diff --git a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/value.go b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/value.go index 54aa617cfd..69c1f9edbb 100644 --- a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/value.go +++ b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/value.go @@ -59,8 +59,6 @@ func (v Value) IsNumber() bool { // AsInt32 returns a BSON number as an int32. If the BSON type is not a numeric one, this method // will panic. -// -// TODO(skriptble): Add support for Decimal128. func (v Value) AsInt32() int32 { if !v.IsNumber() { panic(ElementTypeError{"bsoncore.Value.AsInt32", v.Type}) @@ -93,8 +91,6 @@ func (v Value) AsInt32() int32 { // AsInt32OK functions the same as AsInt32 but returns a boolean instead of panicking. False // indicates an error. -// -// TODO(skriptble): Add support for Decimal128. func (v Value) AsInt32OK() (int32, bool) { if !v.IsNumber() { return 0, false @@ -127,8 +123,6 @@ func (v Value) AsInt32OK() (int32, bool) { // AsInt64 returns a BSON number as an int64. If the BSON type is not a numeric one, this method // will panic. -// -// TODO(skriptble): Add support for Decimal128. func (v Value) AsInt64() int64 { if !v.IsNumber() { panic(ElementTypeError{"bsoncore.Value.AsInt64", v.Type}) @@ -162,8 +156,6 @@ func (v Value) AsInt64() int64 { // AsInt64OK functions the same as AsInt64 but returns a boolean instead of panicking. False // indicates an error. -// -// TODO(skriptble): Add support for Decimal128. func (v Value) AsInt64OK() (int64, bool) { if !v.IsNumber() { return 0, false @@ -198,21 +190,14 @@ func (v Value) AsInt64OK() (int64, bool) { // AsFloat64 returns a BSON number as an float64. If the BSON type is not a numeric one, this method // will panic. // -// TODO(skriptble): Add support for Decimal128. -func (v Value) AsFloat64() float64 { return 0 } +// TODO(GODRIVER-2751): Implement AsFloat64. +// func (v Value) AsFloat64() float64 // AsFloat64OK functions the same as AsFloat64 but returns a boolean instead of panicking. False // indicates an error. // -// TODO(skriptble): Add support for Decimal128. -func (v Value) AsFloat64OK() (float64, bool) { return 0, false } - -// Add will add this value to another. This is currently only implemented for strings and numbers. -// If either value is a string, the other type is coerced into a string and added to the other. -// -// This method will alter v and will attempt to reuse the []byte of v. If the []byte is too small, -// it will be expanded. -func (v *Value) Add(v2 Value) error { return nil } +// TODO(GODRIVER-2751): Implement AsFloat64OK. +// func (v Value) AsFloat64OK() (float64, bool) // Equal compaes v to v2 and returns true if they are equal. func (v Value) Equal(v2 Value) bool { @@ -323,7 +308,7 @@ func (v Value) String() string { if !ok { return "" } - return fmt.Sprintf(`{"$timestamp":{"t":"%s","i":"%s"}}`, strconv.FormatUint(uint64(t), 10), strconv.FormatUint(uint64(i), 10)) + return fmt.Sprintf(`{"$timestamp":{"t":%v,"i":%v}}`, t, i) case bsontype.Int64: i64, ok := v.Int64OK() if !ok { diff --git a/vendor/go.opentelemetry.io/otel/.codespellignore b/vendor/go.opentelemetry.io/otel/.codespellignore new file mode 100644 index 0000000000..ae6a3bcf12 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/.codespellignore @@ -0,0 +1,5 @@ +ot +fo +te +collison +consequentially diff --git a/vendor/go.opentelemetry.io/otel/.codespellrc b/vendor/go.opentelemetry.io/otel/.codespellrc new file mode 100644 index 0000000000..4afbb1fb3b --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/.codespellrc @@ -0,0 +1,10 @@ +# https://github.com/codespell-project/codespell +[codespell] +builtin = clear,rare,informal +check-filenames = +check-hidden = +ignore-words = .codespellignore +interactive = 1 +skip = .git,go.mod,go.sum,semconv,venv,.tools +uri-ignore-words-list = * +write = diff --git a/vendor/go.opentelemetry.io/otel/.gitignore b/vendor/go.opentelemetry.io/otel/.gitignore index 0b605b3d67..aa69937622 100644 --- a/vendor/go.opentelemetry.io/otel/.gitignore +++ b/vendor/go.opentelemetry.io/otel/.gitignore @@ -2,11 +2,14 @@ Thumbs.db .tools/ +venv/ .idea/ .vscode/ *.iml *.so coverage.* +go.work +go.work.sum gen/ diff --git a/vendor/go.opentelemetry.io/otel/.golangci.yml b/vendor/go.opentelemetry.io/otel/.golangci.yml index 0f099f5759..dbb6670b39 100644 --- a/vendor/go.opentelemetry.io/otel/.golangci.yml +++ b/vendor/go.opentelemetry.io/otel/.golangci.yml @@ -85,6 +85,8 @@ linters-settings: - "**/internal/matchers/*.go" godot: exclude: + # Exclude links. + - '^ *\[[^]]+\]:' # Exclude sentence fragments for lists. - '^[ ]*[-•]' # Exclude sentences prefixing a list. @@ -111,7 +113,7 @@ linters-settings: - name: constant-logical-expr disabled: false # https://github.com/mgechev/revive/blob/master/RULES_DESCRIPTIONS.md#context-as-argument - # TODO (#3372) reenable linter when it is compatible. https://github.com/golangci/golangci-lint/issues/3280 + # TODO (#3372) re-enable linter when it is compatible. https://github.com/golangci/golangci-lint/issues/3280 - name: context-as-argument disabled: true arguments: diff --git a/vendor/go.opentelemetry.io/otel/.lycheeignore b/vendor/go.opentelemetry.io/otel/.lycheeignore index 545d634525..40d62fa2eb 100644 --- a/vendor/go.opentelemetry.io/otel/.lycheeignore +++ b/vendor/go.opentelemetry.io/otel/.lycheeignore @@ -1,3 +1,6 @@ http://localhost http://jaeger-collector https://github.com/open-telemetry/opentelemetry-go/milestone/ +https://github.com/open-telemetry/opentelemetry-go/projects +file:///home/runner/work/opentelemetry-go/opentelemetry-go/libraries +file:///home/runner/work/opentelemetry-go/opentelemetry-go/manual diff --git a/vendor/go.opentelemetry.io/otel/CHANGELOG.md b/vendor/go.opentelemetry.io/otel/CHANGELOG.md index 9f130b8be1..d9f145f86d 100644 --- a/vendor/go.opentelemetry.io/otel/CHANGELOG.md +++ b/vendor/go.opentelemetry.io/otel/CHANGELOG.md @@ -8,6 +8,411 @@ This project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.htm ## [Unreleased] +## [1.16.0/0.39.0] 2023-05-18 + +This release contains the first stable release of the OpenTelemetry Go [metric API]. +Our project stability guarantees now apply to the `go.opentelemetry.io/otel/metric` package. +See our [versioning policy](VERSIONING.md) for more information about these stability guarantees. + +### Added + +- The `go.opentelemetry.io/otel/semconv/v1.19.0` package. + The package contains semantic conventions from the `v1.19.0` version of the OpenTelemetry specification. (#3848) +- The `go.opentelemetry.io/otel/semconv/v1.20.0` package. + The package contains semantic conventions from the `v1.20.0` version of the OpenTelemetry specification. (#4078) + +### Changed + +- Use `strings.Cut()` instead of `string.SplitN()` for better readability and memory use. (#4049) + +### Removed + +- The deprecated `go.opentelemetry.io/otel/metric/instrument` package is removed. + Use `go.opentelemetry.io/otel/metric` instead. (#4055) + +### Fixed + +- Fix build for BSD based systems in `go.opentelemetry.io/otel/sdk/resource`. (#4077) + +## [1.16.0-rc.1/0.39.0-rc.1] 2023-05-03 + +This is a release candidate for the v1.16.0/v0.39.0 release. +That release is expected to include the `v1` release of the OpenTelemetry Go metric API and will provide stability guarantees of that API. +See our [versioning policy](VERSIONING.md) for more information about these stability guarantees. + +### Added + +- Support global `MeterProvider` in `go.opentelemetry.io/otel`. (#4039) + - Use `Meter` for a `metric.Meter` from the global `metric.MeterProvider`. + - Use `GetMeterProivder` for a global `metric.MeterProvider`. + - Use `SetMeterProivder` to set the global `metric.MeterProvider`. + +### Changed + +- Move the `go.opentelemetry.io/otel/metric` module to the `stable-v1` module set. + This stages the metric API to be released as a stable module. (#4038) + +### Removed + +- The `go.opentelemetry.io/otel/metric/global` package is removed. + Use `go.opentelemetry.io/otel` instead. (#4039) + +## [1.15.1/0.38.1] 2023-05-02 + +### Fixed + +- Remove unused imports from `sdk/resource/host_id_bsd.go` which caused build failures. (#4040, #4041) + +## [1.15.0/0.38.0] 2023-04-27 + +### Added + +- The `go.opentelemetry.io/otel/metric/embedded` package. (#3916) +- The `Version` function to `go.opentelemetry.io/otel/sdk` to return the SDK version. (#3949) +- Add a `WithNamespace` option to `go.opentelemetry.io/otel/exporters/prometheus` to allow users to prefix metrics with a namespace. (#3970) +- The following configuration types were added to `go.opentelemetry.io/otel/metric/instrument` to be used in the configuration of measurement methods. (#3971) + - The `AddConfig` used to hold configuration for addition measurements + - `NewAddConfig` used to create a new `AddConfig` + - `AddOption` used to configure an `AddConfig` + - The `RecordConfig` used to hold configuration for recorded measurements + - `NewRecordConfig` used to create a new `RecordConfig` + - `RecordOption` used to configure a `RecordConfig` + - The `ObserveConfig` used to hold configuration for observed measurements + - `NewObserveConfig` used to create a new `ObserveConfig` + - `ObserveOption` used to configure an `ObserveConfig` +- `WithAttributeSet` and `WithAttributes` are added to `go.opentelemetry.io/otel/metric/instrument`. + They return an option used during a measurement that defines the attribute Set associated with the measurement. (#3971) +- The `Version` function to `go.opentelemetry.io/otel/exporters/otlp/otlpmetric` to return the OTLP metrics client version. (#3956) +- The `Version` function to `go.opentelemetry.io/otel/exporters/otlp/otlptrace` to return the OTLP trace client version. (#3956) + +### Changed + +- The `Extrema` in `go.opentelemetry.io/otel/sdk/metric/metricdata` is redefined with a generic argument of `[N int64 | float64]`. (#3870) +- Update all exported interfaces from `go.opentelemetry.io/otel/metric` to embed their corresponding interface from `go.opentelemetry.io/otel/metric/embedded`. + This adds an implementation requirement to set the interface default behavior for unimplemented methods. (#3916) +- Move No-Op implementation from `go.opentelemetry.io/otel/metric` into its own package `go.opentelemetry.io/otel/metric/noop`. (#3941) + - `metric.NewNoopMeterProvider` is replaced with `noop.NewMeterProvider` +- Add all the methods from `"go.opentelemetry.io/otel/trace".SpanContext` to `bridgeSpanContext` by embedding `otel.SpanContext` in `bridgeSpanContext`. (#3966) +- Wrap `UploadMetrics` error in `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/` to improve error message when encountering generic grpc errors. (#3974) +- The measurement methods for all instruments in `go.opentelemetry.io/otel/metric/instrument` accept an option instead of the variadic `"go.opentelemetry.io/otel/attribute".KeyValue`. (#3971) + - The `Int64Counter.Add` method now accepts `...AddOption` + - The `Float64Counter.Add` method now accepts `...AddOption` + - The `Int64UpDownCounter.Add` method now accepts `...AddOption` + - The `Float64UpDownCounter.Add` method now accepts `...AddOption` + - The `Int64Histogram.Record` method now accepts `...RecordOption` + - The `Float64Histogram.Record` method now accepts `...RecordOption` + - The `Int64Observer.Observe` method now accepts `...ObserveOption` + - The `Float64Observer.Observe` method now accepts `...ObserveOption` +- The `Observer` methods in `go.opentelemetry.io/otel/metric` accept an option instead of the variadic `"go.opentelemetry.io/otel/attribute".KeyValue`. (#3971) + - The `Observer.ObserveInt64` method now accepts `...ObserveOption` + - The `Observer.ObserveFloat64` method now accepts `...ObserveOption` +- Move global metric back to `go.opentelemetry.io/otel/metric/global` from `go.opentelemetry.io/otel`. (#3986) + +### Fixed + +- `TracerProvider` allows calling `Tracer()` while it's shutting down. + It used to deadlock. (#3924) +- Use the SDK version for the Telemetry SDK resource detector in `go.opentelemetry.io/otel/sdk/resource`. (#3949) +- Fix a data race in `SpanProcessor` returned by `NewSimpleSpanProcessor` in `go.opentelemetry.io/otel/sdk/trace`. (#3951) +- Automatically figure out the default aggregation with `aggregation.Default`. (#3967) + +### Deprecated + +- The `go.opentelemetry.io/otel/metric/instrument` package is deprecated. + Use the equivalent types added to `go.opentelemetry.io/otel/metric` instead. (#4018) + +## [1.15.0-rc.2/0.38.0-rc.2] 2023-03-23 + +This is a release candidate for the v1.15.0/v0.38.0 release. +That release will include the `v1` release of the OpenTelemetry Go metric API and will provide stability guarantees of that API. +See our [versioning policy](VERSIONING.md) for more information about these stability guarantees. + +### Added + +- The `WithHostID` option to `go.opentelemetry.io/otel/sdk/resource`. (#3812) +- The `WithoutTimestamps` option to `go.opentelemetry.io/otel/exporters/stdout/stdoutmetric` to sets all timestamps to zero. (#3828) +- The new `Exemplar` type is added to `go.opentelemetry.io/otel/sdk/metric/metricdata`. + Both the `DataPoint` and `HistogramDataPoint` types from that package have a new field of `Exemplars` containing the sampled exemplars for their timeseries. (#3849) +- Configuration for each metric instrument in `go.opentelemetry.io/otel/sdk/metric/instrument`. (#3895) +- The internal logging introduces a warning level verbosity equal to `V(1)`. (#3900) +- Added a log message warning about usage of `SimpleSpanProcessor` in production environments. (#3854) + +### Changed + +- Optimize memory allocation when creation a new `Set` using `NewSet` or `NewSetWithFiltered` in `go.opentelemetry.io/otel/attribute`. (#3832) +- Optimize memory allocation when creation new metric instruments in `go.opentelemetry.io/otel/sdk/metric`. (#3832) +- Avoid creating new objects on all calls to `WithDeferredSetup` and `SkipContextSetup` in OpenTracing bridge. (#3833) +- The `New` and `Detect` functions from `go.opentelemetry.io/otel/sdk/resource` return errors that wrap underlying errors instead of just containing the underlying error strings. (#3844) +- Both the `Histogram` and `HistogramDataPoint` are redefined with a generic argument of `[N int64 | float64]` in `go.opentelemetry.io/otel/sdk/metric/metricdata`. (#3849) +- The metric `Export` interface from `go.opentelemetry.io/otel/sdk/metric` accepts a `*ResourceMetrics` instead of `ResourceMetrics`. (#3853) +- Rename `Asynchronous` to `Observable` in `go.opentelemetry.io/otel/metric/instrument`. (#3892) +- Rename `Int64ObserverOption` to `Int64ObservableOption` in `go.opentelemetry.io/otel/metric/instrument`. (#3895) +- Rename `Float64ObserverOption` to `Float64ObservableOption` in `go.opentelemetry.io/otel/metric/instrument`. (#3895) +- The internal logging changes the verbosity level of info to `V(4)`, the verbosity level of debug to `V(8)`. (#3900) + +### Fixed + +- `TracerProvider` consistently doesn't allow to register a `SpanProcessor` after shutdown. (#3845) + +### Removed + +- The deprecated `go.opentelemetry.io/otel/metric/global` package is removed. (#3829) +- The unneeded `Synchronous` interface in `go.opentelemetry.io/otel/metric/instrument` was removed. (#3892) +- The `Float64ObserverConfig` and `NewFloat64ObserverConfig` in `go.opentelemetry.io/otel/sdk/metric/instrument`. + Use the added `float64` instrument configuration instead. (#3895) +- The `Int64ObserverConfig` and `NewInt64ObserverConfig` in `go.opentelemetry.io/otel/sdk/metric/instrument`. + Use the added `int64` instrument configuration instead. (#3895) +- The `NewNoopMeter` function in `go.opentelemetry.io/otel/metric`, use `NewMeterProvider().Meter("")` instead. (#3893) + +## [1.15.0-rc.1/0.38.0-rc.1] 2023-03-01 + +This is a release candidate for the v1.15.0/v0.38.0 release. +That release will include the `v1` release of the OpenTelemetry Go metric API and will provide stability guarantees of that API. +See our [versioning policy](VERSIONING.md) for more information about these stability guarantees. + +This release drops the compatibility guarantee of [Go 1.18]. + +### Added + +- Support global `MeterProvider` in `go.opentelemetry.io/otel`. (#3818) + - Use `Meter` for a `metric.Meter` from the global `metric.MeterProvider`. + - Use `GetMeterProivder` for a global `metric.MeterProvider`. + - Use `SetMeterProivder` to set the global `metric.MeterProvider`. + +### Changed + +- Dropped compatibility testing for [Go 1.18]. + The project no longer guarantees support for this version of Go. (#3813) + +### Fixed + +- Handle empty environment variable as it they were not set. (#3764) +- Clarify the `httpconv` and `netconv` packages in `go.opentelemetry.io/otel/semconv/*` provide tracing semantic conventions. (#3823) + +### Deprecated + +- The `go.opentelemetry.io/otel/metric/global` package is deprecated. + Use `go.opentelemetry.io/otel` instead. (#3818) + +### Removed + +- The deprecated `go.opentelemetry.io/otel/metric/unit` package is removed. (#3814) + +## [1.14.0/0.37.0/0.0.4] 2023-02-27 + +This release is the last to support [Go 1.18]. +The next release will require at least [Go 1.19]. + +### Added + +- The `event` type semantic conventions are added to `go.opentelemetry.io/otel/semconv/v1.17.0`. (#3697) +- Support [Go 1.20]. (#3693) +- The `go.opentelemetry.io/otel/semconv/v1.18.0` package. + The package contains semantic conventions from the `v1.18.0` version of the OpenTelemetry specification. (#3719) + - The following `const` renames from `go.opentelemetry.io/otel/semconv/v1.17.0` are included: + - `OtelScopeNameKey` -> `OTelScopeNameKey` + - `OtelScopeVersionKey` -> `OTelScopeVersionKey` + - `OtelLibraryNameKey` -> `OTelLibraryNameKey` + - `OtelLibraryVersionKey` -> `OTelLibraryVersionKey` + - `OtelStatusCodeKey` -> `OTelStatusCodeKey` + - `OtelStatusDescriptionKey` -> `OTelStatusDescriptionKey` + - `OtelStatusCodeOk` -> `OTelStatusCodeOk` + - `OtelStatusCodeError` -> `OTelStatusCodeError` + - The following `func` renames from `go.opentelemetry.io/otel/semconv/v1.17.0` are included: + - `OtelScopeName` -> `OTelScopeName` + - `OtelScopeVersion` -> `OTelScopeVersion` + - `OtelLibraryName` -> `OTelLibraryName` + - `OtelLibraryVersion` -> `OTelLibraryVersion` + - `OtelStatusDescription` -> `OTelStatusDescription` +- A `IsSampled` method is added to the `SpanContext` implementation in `go.opentelemetry.io/otel/bridge/opentracing` to expose the span sampled state. + See the [README](./bridge/opentracing/README.md) for more information. (#3570) +- The `WithInstrumentationAttributes` option to `go.opentelemetry.io/otel/metric`. (#3738) +- The `WithInstrumentationAttributes` option to `go.opentelemetry.io/otel/trace`. (#3739) +- The following environment variables are supported by the periodic `Reader` in `go.opentelemetry.io/otel/sdk/metric`. (#3763) + - `OTEL_METRIC_EXPORT_INTERVAL` sets the time between collections and exports. + - `OTEL_METRIC_EXPORT_TIMEOUT` sets the timeout an export is attempted. + +### Changed + +- Fall-back to `TextMapCarrier` when it's not `HttpHeader`s in `go.opentelemetry.io/otel/bridge/opentracing`. (#3679) +- The `Collect` method of the `"go.opentelemetry.io/otel/sdk/metric".Reader` interface is updated to accept the `metricdata.ResourceMetrics` value the collection will be made into. + This change is made to enable memory reuse by SDK users. (#3732) +- The `WithUnit` option in `go.opentelemetry.io/otel/sdk/metric/instrument` is updated to accept a `string` for the unit value. (#3776) + +### Fixed + +- Ensure `go.opentelemetry.io/otel` does not use generics. (#3723, #3725) +- Multi-reader `MeterProvider`s now export metrics for all readers, instead of just the first reader. (#3720, #3724) +- Remove use of deprecated `"math/rand".Seed` in `go.opentelemetry.io/otel/example/prometheus`. (#3733) +- Do not silently drop unknown schema data with `Parse` in `go.opentelemetry.io/otel/schema/v1.1`. (#3743) +- Data race issue in OTLP exporter retry mechanism. (#3755, #3756) +- Wrapping empty errors when exporting in `go.opentelemetry.io/otel/sdk/metric`. (#3698, #3772) +- Incorrect "all" and "resource" definition for schema files in `go.opentelemetry.io/otel/schema/v1.1`. (#3777) + +### Deprecated + +- The `go.opentelemetry.io/otel/metric/unit` package is deprecated. + Use the equivalent unit string instead. (#3776) + - Use `"1"` instead of `unit.Dimensionless` + - Use `"By"` instead of `unit.Bytes` + - Use `"ms"` instead of `unit.Milliseconds` + +## [1.13.0/0.36.0] 2023-02-07 + +### Added + +- Attribute `KeyValue` creations functions to `go.opentelemetry.io/otel/semconv/v1.17.0` for all non-enum semantic conventions. + These functions ensure semantic convention type correctness. (#3675) + +### Fixed + +- Removed the `http.target` attribute from being added by `ServerRequest` in the following packages. (#3687) + - `go.opentelemetry.io/otel/semconv/v1.13.0/httpconv` + - `go.opentelemetry.io/otel/semconv/v1.14.0/httpconv` + - `go.opentelemetry.io/otel/semconv/v1.15.0/httpconv` + - `go.opentelemetry.io/otel/semconv/v1.16.0/httpconv` + - `go.opentelemetry.io/otel/semconv/v1.17.0/httpconv` + +### Removed + +- The deprecated `go.opentelemetry.io/otel/metric/instrument/asyncfloat64` package is removed. (#3631) +- The deprecated `go.opentelemetry.io/otel/metric/instrument/asyncint64` package is removed. (#3631) +- The deprecated `go.opentelemetry.io/otel/metric/instrument/syncfloat64` package is removed. (#3631) +- The deprecated `go.opentelemetry.io/otel/metric/instrument/syncint64` package is removed. (#3631) + +## [1.12.0/0.35.0] 2023-01-28 + +### Added + +- The `WithInt64Callback` option to `go.opentelemetry.io/otel/metric/instrument`. + This options is used to configure `int64` Observer callbacks during their creation. (#3507) +- The `WithFloat64Callback` option to `go.opentelemetry.io/otel/metric/instrument`. + This options is used to configure `float64` Observer callbacks during their creation. (#3507) +- The `Producer` interface and `Reader.RegisterProducer(Producer)` to `go.opentelemetry.io/otel/sdk/metric`. + These additions are used to enable external metric Producers. (#3524) +- The `Callback` function type to `go.opentelemetry.io/otel/metric`. + This new named function type is registered with a `Meter`. (#3564) +- The `go.opentelemetry.io/otel/semconv/v1.13.0` package. + The package contains semantic conventions from the `v1.13.0` version of the OpenTelemetry specification. (#3499) + - The `EndUserAttributesFromHTTPRequest` function in `go.opentelemetry.io/otel/semconv/v1.12.0` is merged into `ClientRequest` and `ServerRequest` in `go.opentelemetry.io/otel/semconv/v1.13.0/httpconv`. + - The `HTTPAttributesFromHTTPStatusCode` function in `go.opentelemetry.io/otel/semconv/v1.12.0` is merged into `ClientResponse` in `go.opentelemetry.io/otel/semconv/v1.13.0/httpconv`. + - The `HTTPClientAttributesFromHTTPRequest` function in `go.opentelemetry.io/otel/semconv/v1.12.0` is replaced by `ClientRequest` in `go.opentelemetry.io/otel/semconv/v1.13.0/httpconv`. + - The `HTTPServerAttributesFromHTTPRequest` function in `go.opentelemetry.io/otel/semconv/v1.12.0` is replaced by `ServerRequest` in `go.opentelemetry.io/otel/semconv/v1.13.0/httpconv`. + - The `HTTPServerMetricAttributesFromHTTPRequest` function in `go.opentelemetry.io/otel/semconv/v1.12.0` is replaced by `ServerRequest` in `go.opentelemetry.io/otel/semconv/v1.13.0/httpconv`. + - The `NetAttributesFromHTTPRequest` function in `go.opentelemetry.io/otel/semconv/v1.12.0` is split into `Transport` in `go.opentelemetry.io/otel/semconv/v1.13.0/netconv` and `ClientRequest` or `ServerRequest` in `go.opentelemetry.io/otel/semconv/v1.13.0/httpconv`. + - The `SpanStatusFromHTTPStatusCode` function in `go.opentelemetry.io/otel/semconv/v1.12.0` is replaced by `ClientStatus` in `go.opentelemetry.io/otel/semconv/v1.13.0/httpconv`. + - The `SpanStatusFromHTTPStatusCodeAndSpanKind` function in `go.opentelemetry.io/otel/semconv/v1.12.0` is split into `ClientStatus` and `ServerStatus` in `go.opentelemetry.io/otel/semconv/v1.13.0/httpconv`. + - The `Client` function is included in `go.opentelemetry.io/otel/semconv/v1.13.0/netconv` to generate attributes for a `net.Conn`. + - The `Server` function is included in `go.opentelemetry.io/otel/semconv/v1.13.0/netconv` to generate attributes for a `net.Listener`. +- The `go.opentelemetry.io/otel/semconv/v1.14.0` package. + The package contains semantic conventions from the `v1.14.0` version of the OpenTelemetry specification. (#3566) +- The `go.opentelemetry.io/otel/semconv/v1.15.0` package. + The package contains semantic conventions from the `v1.15.0` version of the OpenTelemetry specification. (#3578) +- The `go.opentelemetry.io/otel/semconv/v1.16.0` package. + The package contains semantic conventions from the `v1.16.0` version of the OpenTelemetry specification. (#3579) +- Metric instruments to `go.opentelemetry.io/otel/metric/instrument`. + These instruments are use as replacements of the deprecated `go.opentelemetry.io/otel/metric/instrument/{asyncfloat64,asyncint64,syncfloat64,syncint64}` packages.(#3575, #3586) + - `Float64ObservableCounter` replaces the `asyncfloat64.Counter` + - `Float64ObservableUpDownCounter` replaces the `asyncfloat64.UpDownCounter` + - `Float64ObservableGauge` replaces the `asyncfloat64.Gauge` + - `Int64ObservableCounter` replaces the `asyncint64.Counter` + - `Int64ObservableUpDownCounter` replaces the `asyncint64.UpDownCounter` + - `Int64ObservableGauge` replaces the `asyncint64.Gauge` + - `Float64Counter` replaces the `syncfloat64.Counter` + - `Float64UpDownCounter` replaces the `syncfloat64.UpDownCounter` + - `Float64Histogram` replaces the `syncfloat64.Histogram` + - `Int64Counter` replaces the `syncint64.Counter` + - `Int64UpDownCounter` replaces the `syncint64.UpDownCounter` + - `Int64Histogram` replaces the `syncint64.Histogram` +- `NewTracerProvider` to `go.opentelemetry.io/otel/bridge/opentracing`. + This is used to create `WrapperTracer` instances from a `TracerProvider`. (#3116) +- The `Extrema` type to `go.opentelemetry.io/otel/sdk/metric/metricdata`. + This type is used to represent min/max values and still be able to distinguish unset and zero values. (#3487) +- The `go.opentelemetry.io/otel/semconv/v1.17.0` package. + The package contains semantic conventions from the `v1.17.0` version of the OpenTelemetry specification. (#3599) + +### Changed + +- Jaeger and Zipkin exporter use `github.com/go-logr/logr` as the logging interface, and add the `WithLogr` option. (#3497, #3500) +- Instrument configuration in `go.opentelemetry.io/otel/metric/instrument` is split into specific options and configuration based on the instrument type. (#3507) + - Use the added `Int64Option` type to configure instruments from `go.opentelemetry.io/otel/metric/instrument/syncint64`. + - Use the added `Float64Option` type to configure instruments from `go.opentelemetry.io/otel/metric/instrument/syncfloat64`. + - Use the added `Int64ObserverOption` type to configure instruments from `go.opentelemetry.io/otel/metric/instrument/asyncint64`. + - Use the added `Float64ObserverOption` type to configure instruments from `go.opentelemetry.io/otel/metric/instrument/asyncfloat64`. +- Return a `Registration` from the `RegisterCallback` method of a `Meter` in the `go.opentelemetry.io/otel/metric` package. + This `Registration` can be used to unregister callbacks. (#3522) +- Global error handler uses an atomic value instead of a mutex. (#3543) +- Add `NewMetricProducer` to `go.opentelemetry.io/otel/bridge/opencensus`, which can be used to pass OpenCensus metrics to an OpenTelemetry Reader. (#3541) +- Global logger uses an atomic value instead of a mutex. (#3545) +- The `Shutdown` method of the `"go.opentelemetry.io/otel/sdk/trace".TracerProvider` releases all computational resources when called the first time. (#3551) +- The `Sampler` returned from `TraceIDRatioBased` `go.opentelemetry.io/otel/sdk/trace` now uses the rightmost bits for sampling decisions. + This fixes random sampling when using ID generators like `xray.IDGenerator` and increasing parity with other language implementations. (#3557) +- Errors from `go.opentelemetry.io/otel/exporters/otlp/otlptrace` exporters are wrapped in errors identifying their signal name. + Existing users of the exporters attempting to identify specific errors will need to use `errors.Unwrap()` to get the underlying error. (#3516) +- Exporters from `go.opentelemetry.io/otel/exporters/otlp` will print the final retryable error message when attempts to retry time out. (#3514) +- The instrument kind names in `go.opentelemetry.io/otel/sdk/metric` are updated to match the API. (#3562) + - `InstrumentKindSyncCounter` is renamed to `InstrumentKindCounter` + - `InstrumentKindSyncUpDownCounter` is renamed to `InstrumentKindUpDownCounter` + - `InstrumentKindSyncHistogram` is renamed to `InstrumentKindHistogram` + - `InstrumentKindAsyncCounter` is renamed to `InstrumentKindObservableCounter` + - `InstrumentKindAsyncUpDownCounter` is renamed to `InstrumentKindObservableUpDownCounter` + - `InstrumentKindAsyncGauge` is renamed to `InstrumentKindObservableGauge` +- The `RegisterCallback` method of the `Meter` in `go.opentelemetry.io/otel/metric` changed. + - The named `Callback` replaces the inline function parameter. (#3564) + - `Callback` is required to return an error. (#3576) + - `Callback` accepts the added `Observer` parameter added. + This new parameter is used by `Callback` implementations to observe values for asynchronous instruments instead of calling the `Observe` method of the instrument directly. (#3584) + - The slice of `instrument.Asynchronous` is now passed as a variadic argument. (#3587) +- The exporter from `go.opentelemetry.io/otel/exporters/zipkin` is updated to use the `v1.16.0` version of semantic conventions. + This means it no longer uses the removed `net.peer.ip` or `http.host` attributes to determine the remote endpoint. + Instead it uses the `net.sock.peer` attributes. (#3581) +- The `Min` and `Max` fields of the `HistogramDataPoint` in `go.opentelemetry.io/otel/sdk/metric/metricdata` are now defined with the added `Extrema` type instead of a `*float64`. (#3487) + +### Fixed + +- Asynchronous instruments that use sum aggregators and attribute filters correctly add values from equivalent attribute sets that have been filtered. (#3439, #3549) +- The `RegisterCallback` method of the `Meter` from `go.opentelemetry.io/otel/sdk/metric` only registers a callback for instruments created by that meter. + Trying to register a callback with instruments from a different meter will result in an error being returned. (#3584) + +### Deprecated + +- The `NewMetricExporter` in `go.opentelemetry.io/otel/bridge/opencensus` is deprecated. + Use `NewMetricProducer` instead. (#3541) +- The `go.opentelemetry.io/otel/metric/instrument/asyncfloat64` package is deprecated. + Use the instruments from `go.opentelemetry.io/otel/metric/instrument` instead. (#3575) +- The `go.opentelemetry.io/otel/metric/instrument/asyncint64` package is deprecated. + Use the instruments from `go.opentelemetry.io/otel/metric/instrument` instead. (#3575) +- The `go.opentelemetry.io/otel/metric/instrument/syncfloat64` package is deprecated. + Use the instruments from `go.opentelemetry.io/otel/metric/instrument` instead. (#3575) +- The `go.opentelemetry.io/otel/metric/instrument/syncint64` package is deprecated. + Use the instruments from `go.opentelemetry.io/otel/metric/instrument` instead. (#3575) +- The `NewWrappedTracerProvider` in `go.opentelemetry.io/otel/bridge/opentracing` is now deprecated. + Use `NewTracerProvider` instead. (#3116) + +### Removed + +- The deprecated `go.opentelemetry.io/otel/sdk/metric/view` package is removed. (#3520) +- The `InstrumentProvider` from `go.opentelemetry.io/otel/sdk/metric/asyncint64` is removed. + Use the new creation methods of the `Meter` in `go.opentelemetry.io/otel/sdk/metric` instead. (#3530) + - The `Counter` method is replaced by `Meter.Int64ObservableCounter` + - The `UpDownCounter` method is replaced by `Meter.Int64ObservableUpDownCounter` + - The `Gauge` method is replaced by `Meter.Int64ObservableGauge` +- The `InstrumentProvider` from `go.opentelemetry.io/otel/sdk/metric/asyncfloat64` is removed. + Use the new creation methods of the `Meter` in `go.opentelemetry.io/otel/sdk/metric` instead. (#3530) + - The `Counter` method is replaced by `Meter.Float64ObservableCounter` + - The `UpDownCounter` method is replaced by `Meter.Float64ObservableUpDownCounter` + - The `Gauge` method is replaced by `Meter.Float64ObservableGauge` +- The `InstrumentProvider` from `go.opentelemetry.io/otel/sdk/metric/syncint64` is removed. + Use the new creation methods of the `Meter` in `go.opentelemetry.io/otel/sdk/metric` instead. (#3530) + - The `Counter` method is replaced by `Meter.Int64Counter` + - The `UpDownCounter` method is replaced by `Meter.Int64UpDownCounter` + - The `Histogram` method is replaced by `Meter.Int64Histogram` +- The `InstrumentProvider` from `go.opentelemetry.io/otel/sdk/metric/syncfloat64` is removed. + Use the new creation methods of the `Meter` in `go.opentelemetry.io/otel/sdk/metric` instead. (#3530) + - The `Counter` method is replaced by `Meter.Float64Counter` + - The `UpDownCounter` method is replaced by `Meter.Float64UpDownCounter` + - The `Histogram` method is replaced by `Meter.Float64Histogram` + ## [1.11.2/0.34.0] 2022-12-05 ### Added @@ -51,14 +456,14 @@ This project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.htm - Asynchronous counters (`Counter` and `UpDownCounter`) from the metric SDK now produce delta sums when configured with delta temporality. (#3398) - Exported `Status` codes in the `go.opentelemetry.io/otel/exporters/zipkin` exporter are now exported as all upper case values. (#3340) - `Aggregation`s from `go.opentelemetry.io/otel/sdk/metric` with no data are not exported. (#3394, #3436) -- Reenabled Attribute Filters in the Metric SDK. (#3396) +- Re-enabled Attribute Filters in the Metric SDK. (#3396) - Asynchronous callbacks are only called if they are registered with at least one instrument that does not use drop aggragation. (#3408) - Do not report empty partial-success responses in the `go.opentelemetry.io/otel/exporters/otlp` exporters. (#3438, #3432) - Handle partial success responses in `go.opentelemetry.io/otel/exporters/otlp/otlpmetric` exporters. (#3162, #3440) - Prevent duplicate Prometheus description, unit, and type. (#3469) - Prevents panic when using incorrect `attribute.Value.As[Type]Slice()`. (#3489) -## Removed +### Removed - The `go.opentelemetry.io/otel/exporters/otlp/otlpmetric.Client` interface is removed. (#3486) - The `go.opentelemetry.io/otel/exporters/otlp/otlpmetric.New` function is removed. Use the `otlpmetric[http|grpc].New` directly. (#3486) @@ -632,7 +1037,7 @@ This release includes an API and SDK for the tracing signal that will comply wit - Setting the global `ErrorHandler` with `"go.opentelemetry.io/otel".SetErrorHandler` multiple times is now supported. (#2160, #2140) - The `"go.opentelemetry.io/otel/attribute".Any` function now supports `int32` values. (#2169) - Multiple calls to `"go.opentelemetry.io/otel/sdk/metric/controller/basic".WithResource()` are handled correctly, and when no resources are provided `"go.opentelemetry.io/otel/sdk/resource".Default()` is used. (#2120) -- The `WithoutTimestamps` option for the `go.opentelemetry.io/otel/exporters/stdout/stdouttrace` exporter causes the exporter to correctly ommit timestamps. (#2195) +- The `WithoutTimestamps` option for the `go.opentelemetry.io/otel/exporters/stdout/stdouttrace` exporter causes the exporter to correctly omit timestamps. (#2195) - Fixed typos in resources.go. (#2201) ## [1.0.0-RC2] - 2021-07-26 @@ -1078,7 +1483,7 @@ with major version 0. - `NewGRPCDriver` function returns a `ProtocolDriver` that maintains a single gRPC connection to the collector. (#1369) - Added documentation about the project's versioning policy. (#1388) - Added `NewSplitDriver` for OTLP exporter that allows sending traces and metrics to different endpoints. (#1418) -- Added codeql worfklow to GitHub Actions (#1428) +- Added codeql workflow to GitHub Actions (#1428) - Added Gosec workflow to GitHub Actions (#1429) - Add new HTTP driver for OTLP exporter in `exporters/otlp/otlphttp`. Currently it only supports the binary protobuf payloads. (#1420) - Add an OpenCensus exporter bridge. (#1444) @@ -1921,7 +2326,7 @@ There is still a possibility of breaking changes. ### Fixed -- Use stateful batcher on Prometheus exporter fixing regresion introduced in #395. (#428) +- Use stateful batcher on Prometheus exporter fixing regression introduced in #395. (#428) ## [0.2.1] - 2020-01-08 @@ -2087,7 +2492,16 @@ It contains api and sdk for trace and meter. - CircleCI build CI manifest files. - CODEOWNERS file to track owners of this project. -[Unreleased]: https://github.com/open-telemetry/opentelemetry-go/compare/v1.11.2...HEAD +[Unreleased]: https://github.com/open-telemetry/opentelemetry-go/compare/v1.16.0...HEAD +[1.16.0/0.39.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.16.0 +[1.16.0-rc.1/0.39.0-rc.1]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.16.0-rc.1 +[1.15.1/0.38.1]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.15.1 +[1.15.0/0.38.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.15.0 +[1.15.0-rc.2/0.38.0-rc.2]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.15.0-rc.2 +[1.15.0-rc.1/0.38.0-rc.1]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.15.0-rc.1 +[1.14.0/0.37.0/0.0.4]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.14.0 +[1.13.0/0.36.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.13.0 +[1.12.0/0.35.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.12.0 [1.11.2/0.34.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.11.2 [1.11.1/0.33.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.11.1 [1.11.0/0.32.3]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.11.0 @@ -2145,3 +2559,9 @@ It contains api and sdk for trace and meter. [0.1.2]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v0.1.2 [0.1.1]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v0.1.1 [0.1.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v0.1.0 + +[Go 1.20]: https://go.dev/doc/go1.20 +[Go 1.19]: https://go.dev/doc/go1.19 +[Go 1.18]: https://go.dev/doc/go1.18 + +[metric API]:https://pkg.go.dev/go.opentelemetry.io/otel/metric diff --git a/vendor/go.opentelemetry.io/otel/CODEOWNERS b/vendor/go.opentelemetry.io/otel/CODEOWNERS index c4012ed6ca..f6f6a313b5 100644 --- a/vendor/go.opentelemetry.io/otel/CODEOWNERS +++ b/vendor/go.opentelemetry.io/otel/CODEOWNERS @@ -12,6 +12,6 @@ # https://help.github.com/en/articles/about-code-owners # -* @jmacd @MrAlias @Aneurysm9 @evantorrie @XSAM @dashpole @MadVikingGod @pellared @hanyuancheung @dmathieu +* @MrAlias @Aneurysm9 @evantorrie @XSAM @dashpole @MadVikingGod @pellared @hanyuancheung @dmathieu CODEOWNERS @MrAlias @Aneurysm9 @MadVikingGod diff --git a/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md b/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md index 9371a481ab..b2df5de34a 100644 --- a/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md +++ b/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md @@ -6,7 +6,7 @@ OpenTelemetry repo for information on this and other language SIGs. See the [public meeting -notes](https://docs.google.com/document/d/1A63zSWX0x2CyCK_LoNhmQC4rqhLpYXJzXbEPDUQ2n6w/edit#heading=h.9tngw7jdwd6b) +notes](https://docs.google.com/document/d/1E5e7Ld0NuU1iVvf-42tOBpu2VBBLYnh73GJuITGJTTU/edit) for a summary description of past meetings. To request edit access, join the meeting or get in touch on [Slack](https://cloud-native.slack.com/archives/C01NPAXACKT). @@ -28,6 +28,11 @@ precommit` - the `precommit` target is the default). The `precommit` target also fixes the formatting of the code and checks the status of the go module files. +Additionally, there is a `codespell` target that checks for common +typos in the code. It is not run by default, but you can run it +manually with `make codespell`. It will set up a virtual environment +in `venv` and install `codespell` there. + If after running `make precommit` the output of `git status` contains `nothing to commit, working tree clean` then it means that everything is up-to-date and properly formatted. @@ -94,38 +99,66 @@ request ID to the entry you added to `CHANGELOG.md`. ### How to Get PRs Merged -A PR is considered to be **ready to merge** when: - -* It has received two approvals from Collaborators/Maintainers (at - different companies). This is not enforced through technical means - and a PR may be **ready to merge** with a single approval if the change - and its approach have been discussed and consensus reached. -* Feedback has been addressed. -* Any substantive changes to your PR will require that you clear any prior - Approval reviews, this includes changes resulting from other feedback. Unless - the approver explicitly stated that their approval will persist across - changes it should be assumed that the PR needs their review again. Other - project members (e.g. approvers, maintainers) can help with this if there are - any questions or if you forget to clear reviews. -* It has been open for review for at least one working day. This gives - people reasonable time to review. -* Trivial changes (typo, cosmetic, doc, etc.) do not have to wait for - one day and may be merged with a single Maintainer's approval. -* `CHANGELOG.md` has been updated to reflect what has been - added, changed, removed, or fixed. -* `README.md` has been updated if necessary. -* Urgent fix can take exception as long as it has been actively - communicated. - -Any Maintainer can merge the PR once it is **ready to merge**. +A PR is considered **ready to merge** when: + +* It has received two qualified approvals[^1]. + + This is not enforced through automation, but needs to be validated by the + maintainer merging. + * The qualified approvals need to be from [Approver]s/[Maintainer]s + affiliated with different companies. Two qualified approvals from + [Approver]s or [Maintainer]s affiliated with the same company counts as a + single qualified approval. + * PRs introducing changes that have already been discussed and consensus + reached only need one qualified approval. The discussion and resolution + needs to be linked to the PR. + * Trivial changes[^2] only need one qualified approval. + +* All feedback has been addressed. + * All PR comments and suggestions are resolved. + * All GitHub Pull Request reviews with a status of "Request changes" have + been addressed. Another review by the objecting reviewer with a different + status can be submitted to clear the original review, or the review can be + dismissed by a [Maintainer] when the issues from the original review have + been addressed. + * Any comments or reviews that cannot be resolved between the PR author and + reviewers can be submitted to the community [Approver]s and [Maintainer]s + during the weekly SIG meeting. If consensus is reached among the + [Approver]s and [Maintainer]s during the SIG meeting the objections to the + PR may be dismissed or resolved or the PR closed by a [Maintainer]. + * Any substantive changes to the PR require existing Approval reviews be + cleared unless the approver explicitly states that their approval persists + across changes. This includes changes resulting from other feedback. + [Approver]s and [Maintainer]s can help in clearing reviews and they should + be consulted if there are any questions. + +* The PR branch is up to date with the base branch it is merging into. + * To ensure this does not block the PR, it should be configured to allow + maintainers to update it. + +* It has been open for review for at least one working day. This gives people + reasonable time to review. + * Trivial changes[^2] do not have to wait for one day and may be merged with + a single [Maintainer]'s approval. + +* All required GitHub workflows have succeeded. +* Urgent fix can take exception as long as it has been actively communicated + among [Maintainer]s. + +Any [Maintainer] can merge the PR once the above criteria have been met. + +[^1]: A qualified approval is a GitHub Pull Request review with "Approve" + status from an OpenTelemetry Go [Approver] or [Maintainer]. +[^2]: Trivial changes include: typo corrections, cosmetic non-substantive + changes, documentation corrections or updates, dependency updates, etc. ## Design Choices As with other OpenTelemetry clients, opentelemetry-go follows the -[opentelemetry-specification](https://github.com/open-telemetry/opentelemetry-specification). +[OpenTelemetry Specification](https://opentelemetry.io/docs/specs/otel). It's especially valuable to read through the [library -guidelines](https://github.com/open-telemetry/opentelemetry-specification/blob/main/specification/library-guidelines.md). +guidelines](https://opentelemetry.io/docs/specs/otel/library-guidelines). ### Focus on Capabilities, Not Structure Compliance @@ -216,7 +249,7 @@ Meaning a `config` from one package should not be directly used by another. The one exception is the API packages. The configs from the base API, eg. `go.opentelemetry.io/otel/trace.TracerConfig` and `go.opentelemetry.io/otel/metric.InstrumentConfig`, are intended to be consumed -by the SDK therefor it is expected that these are exported. +by the SDK therefore it is expected that these are exported. When a config is exported we want to maintain forward and backward compatibility, to achieve this no fields should be exported but should @@ -234,12 +267,12 @@ func newConfig(options ...Option) config { for _, option := range options { config = option.apply(config) } - // Preform any validation here. + // Perform any validation here. return config } ``` -If validation of the `config` options is also preformed this can return an +If validation of the `config` options is also performed this can return an error as well that is expected to be handled by the instantiation function or propagated to the user. @@ -438,7 +471,7 @@ their parameters appropriately named. #### Interface Stability All exported stable interfaces that include the following warning in their -doumentation are allowed to be extended with additional methods. +documentation are allowed to be extended with additional methods. > Warning: methods may be added to this interface in minor releases. @@ -500,27 +533,30 @@ interface that defines the specific functionality should be preferred. ## Approvers and Maintainers -Approvers: +### Approvers - [Evan Torrie](https://github.com/evantorrie), Verizon Media -- [Josh MacDonald](https://github.com/jmacd), LightStep - [Sam Xie](https://github.com/XSAM), Cisco/AppDynamics - [David Ashpole](https://github.com/dashpole), Google - [Robert Pająk](https://github.com/pellared), Splunk - [Chester Cheung](https://github.com/hanyuancheung), Tencent -- [Damien Mathieu](https://github.com/dmathieu), Auth0/Okta +- [Damien Mathieu](https://github.com/dmathieu), Elastic -Maintainers: +### Maintainers - [Aaron Clawson](https://github.com/MadVikingGod), LightStep - [Anthony Mirabella](https://github.com/Aneurysm9), AWS - [Tyler Yahn](https://github.com/MrAlias), Splunk -Emeritus: +### Emeritus - [Gustavo Silva Paiva](https://github.com/paivagustavo), LightStep +- [Josh MacDonald](https://github.com/jmacd), LightStep ### Become an Approver or a Maintainer See the [community membership document in OpenTelemetry community repo](https://github.com/open-telemetry/community/blob/main/community-membership.md). + +[Approver]: #approvers +[Maintainer]: #maintainers diff --git a/vendor/go.opentelemetry.io/otel/Makefile b/vendor/go.opentelemetry.io/otel/Makefile index 68cdfef7d9..26e4bed226 100644 --- a/vendor/go.opentelemetry.io/otel/Makefile +++ b/vendor/go.opentelemetry.io/otel/Makefile @@ -25,8 +25,8 @@ TIMEOUT = 60 .DEFAULT_GOAL := precommit .PHONY: precommit ci -precommit: dependabot-generate license-check vanity-import-fix misspell go-mod-tidy golangci-lint-fix test-default -ci: dependabot-check license-check lint vanity-import-check build test-default check-clean-work-tree test-coverage +precommit: generate dependabot-generate license-check vanity-import-fix misspell go-mod-tidy golangci-lint-fix test-default +ci: generate dependabot-check license-check lint vanity-import-check build test-default check-clean-work-tree test-coverage # Tools @@ -74,9 +74,42 @@ $(TOOLS)/gojq: PACKAGE=github.com/itchyny/gojq/cmd/gojq .PHONY: tools tools: $(CROSSLINK) $(DBOTCONF) $(GOLANGCI_LINT) $(MISSPELL) $(GOCOVMERGE) $(STRINGER) $(PORTO) $(GOJQ) $(SEMCONVGEN) $(MULTIMOD) $(SEMCONVKIT) -# Build +# Virtualized python tools via docker + +# The directory where the virtual environment is created. +VENVDIR := venv + +# The directory where the python tools are installed. +PYTOOLS := $(VENVDIR)/bin + +# The pip executable in the virtual environment. +PIP := $(PYTOOLS)/pip + +# The directory in the docker image where the current directory is mounted. +WORKDIR := /workdir + +# The python image to use for the virtual environment. +PYTHONIMAGE := python:3.11.3-slim-bullseye + +# Run the python image with the current directory mounted. +DOCKERPY := docker run --rm -v "$(CURDIR):$(WORKDIR)" -w $(WORKDIR) $(PYTHONIMAGE) + +# Create a virtual environment for Python tools. +$(PYTOOLS): +# The `--upgrade` flag is needed to ensure that the virtual environment is +# created with the latest pip version. + @$(DOCKERPY) bash -c "python3 -m venv $(VENVDIR) && $(PIP) install --upgrade pip" -.PHONY: generate build +# Install python packages into the virtual environment. +$(PYTOOLS)/%: | $(PYTOOLS) + @$(DOCKERPY) $(PIP) install -r requirements.txt + +CODESPELL = $(PYTOOLS)/codespell +$(CODESPELL): PACKAGE=codespell + +# Generate + +.PHONY: generate generate: $(OTEL_GO_MOD_DIRS:%=generate/%) generate/%: DIR=$* @@ -85,7 +118,11 @@ generate/%: | $(STRINGER) $(PORTO) && cd $(DIR) \ && PATH="$(TOOLS):$${PATH}" $(GO) generate ./... && $(PORTO) -w . -build: generate $(OTEL_GO_MOD_DIRS:%=build/%) $(OTEL_GO_MOD_DIRS:%=build-tests/%) +# Build + +.PHONY: build + +build: $(OTEL_GO_MOD_DIRS:%=build/%) $(OTEL_GO_MOD_DIRS:%=build-tests/%) build/%: DIR=$* build/%: @echo "$(GO) build $(DIR)/..." \ @@ -156,7 +193,7 @@ go-mod-tidy/%: DIR=$* go-mod-tidy/%: | crosslink @echo "$(GO) mod tidy in $(DIR)" \ && cd $(DIR) \ - && $(GO) mod tidy -compat=1.18 + && $(GO) mod tidy -compat=1.19 .PHONY: lint-modules lint-modules: go-mod-tidy @@ -176,6 +213,10 @@ vanity-import-fix: | $(PORTO) misspell: | $(MISSPELL) @$(MISSPELL) -w $(ALL_DOCS) +.PHONY: codespell +codespell: | $(CODESPELL) + @$(DOCKERPY) $(CODESPELL) + .PHONY: license-check license-check: @licRes=$$(for f in $$(find . -type f \( -iname '*.go' -o -iname '*.sh' \) ! -path '**/third_party/*' ! -path './.git/*' ) ; do \ @@ -208,11 +249,13 @@ check-clean-work-tree: SEMCONVPKG ?= "semconv/" .PHONY: semconv-generate semconv-generate: | $(SEMCONVGEN) $(SEMCONVKIT) - @[ "$(TAG)" ] || ( echo "TAG unset: missing opentelemetry specification tag"; exit 1 ) - @[ "$(OTEL_SPEC_REPO)" ] || ( echo "OTEL_SPEC_REPO unset: missing path to opentelemetry specification repo"; exit 1 ) - @$(SEMCONVGEN) -i "$(OTEL_SPEC_REPO)/semantic_conventions/trace" -t "$(SEMCONVPKG)/template.j2" -s "$(TAG)" - @$(SEMCONVGEN) -i "$(OTEL_SPEC_REPO)/semantic_conventions/resource" -t "$(SEMCONVPKG)/template.j2" -s "$(TAG)" - @$(SEMCONVKIT) -output "$(SEMCONVPKG)/$(TAG)" -tag "$(TAG)" + [ "$(TAG)" ] || ( echo "TAG unset: missing opentelemetry specification tag"; exit 1 ) + [ "$(OTEL_SPEC_REPO)" ] || ( echo "OTEL_SPEC_REPO unset: missing path to opentelemetry specification repo"; exit 1 ) + $(SEMCONVGEN) -i "$(OTEL_SPEC_REPO)/semantic_conventions/." --only=span -p conventionType=trace -f trace.go -t "$(SEMCONVPKG)/template.j2" -s "$(TAG)" + $(SEMCONVGEN) -i "$(OTEL_SPEC_REPO)/semantic_conventions/." --only=attribute_group -p conventionType=trace -f attribute_group.go -t "$(SEMCONVPKG)/template.j2" -s "$(TAG)" + $(SEMCONVGEN) -i "$(OTEL_SPEC_REPO)/semantic_conventions/." --only=event -p conventionType=event -f event.go -t "$(SEMCONVPKG)/template.j2" -s "$(TAG)" + $(SEMCONVGEN) -i "$(OTEL_SPEC_REPO)/semantic_conventions/." --only=resource -p conventionType=resource -f resource.go -t "$(SEMCONVPKG)/template.j2" -s "$(TAG)" + $(SEMCONVKIT) -output "$(SEMCONVPKG)/$(TAG)" -tag "$(TAG)" .PHONY: prerelease prerelease: | $(MULTIMOD) diff --git a/vendor/go.opentelemetry.io/otel/README.md b/vendor/go.opentelemetry.io/otel/README.md index 1b2ee21fbf..e138a8a07f 100644 --- a/vendor/go.opentelemetry.io/otel/README.md +++ b/vendor/go.opentelemetry.io/otel/README.md @@ -14,7 +14,7 @@ It provides a set of APIs to directly measure performance and behavior of your s | Signal | Status | Project | | ------- | ---------- | ------- | | Traces | Stable | N/A | -| Metrics | Alpha | N/A | +| Metrics | Beta | N/A | | Logs | Frozen [1] | N/A | - [1]: The Logs signal development is halted for this project while we develop both Traces and Metrics. @@ -50,16 +50,16 @@ Currently, this project supports the following environments. | OS | Go Version | Architecture | | ------- | ---------- | ------------ | +| Ubuntu | 1.20 | amd64 | | Ubuntu | 1.19 | amd64 | -| Ubuntu | 1.18 | amd64 | +| Ubuntu | 1.20 | 386 | | Ubuntu | 1.19 | 386 | -| Ubuntu | 1.18 | 386 | +| MacOS | 1.20 | amd64 | | MacOS | 1.19 | amd64 | -| MacOS | 1.18 | amd64 | +| Windows | 1.20 | amd64 | | Windows | 1.19 | amd64 | -| Windows | 1.18 | amd64 | +| Windows | 1.20 | 386 | | Windows | 1.19 | 386 | -| Windows | 1.18 | 386 | While this project should work for other systems, no compatibility guarantees are made for those systems currently. diff --git a/vendor/go.opentelemetry.io/otel/RELEASING.md b/vendor/go.opentelemetry.io/otel/RELEASING.md index 71e5762547..5e6daf6c48 100644 --- a/vendor/go.opentelemetry.io/otel/RELEASING.md +++ b/vendor/go.opentelemetry.io/otel/RELEASING.md @@ -2,24 +2,28 @@ ## Semantic Convention Generation -New versions of the [OpenTelemetry specification] mean new versions of the `semconv` package need to be generated. +New versions of the [OpenTelemetry Specification] mean new versions of the `semconv` package need to be generated. The `semconv-generate` make target is used for this. -1. Checkout a local copy of the [OpenTelemetry specification] to the desired release tag. -2. Run the `make semconv-generate ...` target from this repository. +1. Checkout a local copy of the [OpenTelemetry Specification] to the desired release tag. +2. Pull the latest `otel/semconvgen` image: `docker pull otel/semconvgen:latest` +3. Run the `make semconv-generate ...` target from this repository. For example, ```sh -export TAG="v1.7.0" # Change to the release version you are generating. +export TAG="v1.13.0" # Change to the release version you are generating. export OTEL_SPEC_REPO="/absolute/path/to/opentelemetry-specification" -git -C "$OTEL_SPEC_REPO" checkout "tags/$TAG" +docker pull otel/semconvgen:latest make semconv-generate # Uses the exported TAG and OTEL_SPEC_REPO. ``` This should create a new sub-package of [`semconv`](./semconv). Ensure things look correct before submitting a pull request to include the addition. +**Note**, the generation code was changed to generate versions >= 1.13. +To generate versions prior to this, checkout the old release of this repository (i.e. [2fe8861](https://github.com/open-telemetry/opentelemetry-go/commit/2fe8861a24e20088c065b116089862caf9e3cd8b)). + ## Pre-Release First, decide which module sets will be released and update their versions @@ -119,4 +123,4 @@ Once verified be sure to [make a release for the `contrib` repository](https://g Update [the documentation](./website_docs) for [the OpenTelemetry website](https://opentelemetry.io/docs/go/). Importantly, bump any package versions referenced to be the latest one you just released and ensure all code examples still compile and are accurate. -[OpenTelemetry specification]: https://github.com/open-telemetry/opentelemetry-specification +[OpenTelemetry Specification]: https://github.com/open-telemetry/opentelemetry-specification diff --git a/vendor/go.opentelemetry.io/otel/attribute/set.go b/vendor/go.opentelemetry.io/otel/attribute/set.go index 26be598322..b976367e46 100644 --- a/vendor/go.opentelemetry.io/otel/attribute/set.go +++ b/vendor/go.opentelemetry.io/otel/attribute/set.go @@ -18,6 +18,7 @@ import ( "encoding/json" "reflect" "sort" + "sync" ) type ( @@ -62,6 +63,12 @@ var ( iface: [0]KeyValue{}, }, } + + // sortables is a pool of Sortables used to create Sets with a user does + // not provide one. + sortables = sync.Pool{ + New: func() interface{} { return new(Sortable) }, + } ) // EmptySet returns a reference to a Set with no elements. @@ -91,7 +98,7 @@ func (l *Set) Len() int { // Get returns the KeyValue at ordered position idx in this set. func (l *Set) Get(idx int) (KeyValue, bool) { - if l == nil { + if l == nil || !l.equivalent.Valid() { return KeyValue{}, false } value := l.equivalent.reflectValue() @@ -107,7 +114,7 @@ func (l *Set) Get(idx int) (KeyValue, bool) { // Value returns the value of a specified key in this set. func (l *Set) Value(k Key) (Value, bool) { - if l == nil { + if l == nil || !l.equivalent.Valid() { return Value{}, false } rValue := l.equivalent.reflectValue() @@ -191,7 +198,9 @@ func NewSet(kvs ...KeyValue) Set { if len(kvs) == 0 { return empty() } - s, _ := NewSetWithSortableFiltered(kvs, new(Sortable), nil) + srt := sortables.Get().(*Sortable) + s, _ := NewSetWithSortableFiltered(kvs, srt, nil) + sortables.Put(srt) return s } @@ -218,7 +227,10 @@ func NewSetWithFiltered(kvs []KeyValue, filter Filter) (Set, []KeyValue) { if len(kvs) == 0 { return empty(), nil } - return NewSetWithSortableFiltered(kvs, new(Sortable), filter) + srt := sortables.Get().(*Sortable) + s, filtered := NewSetWithSortableFiltered(kvs, srt, filter) + sortables.Put(srt) + return s, filtered } // NewSetWithSortableFiltered returns a new Set. diff --git a/vendor/go.opentelemetry.io/otel/attribute/value.go b/vendor/go.opentelemetry.io/otel/attribute/value.go index 34a4e548dd..cb21dd5c09 100644 --- a/vendor/go.opentelemetry.io/otel/attribute/value.go +++ b/vendor/go.opentelemetry.io/otel/attribute/value.go @@ -68,7 +68,7 @@ func BoolValue(v bool) Value { // BoolSliceValue creates a BOOLSLICE Value. func BoolSliceValue(v []bool) Value { - return Value{vtype: BOOLSLICE, slice: attribute.SliceValue(v)} + return Value{vtype: BOOLSLICE, slice: attribute.BoolSliceValue(v)} } // IntValue creates an INT64 Value. @@ -99,7 +99,7 @@ func Int64Value(v int64) Value { // Int64SliceValue creates an INT64SLICE Value. func Int64SliceValue(v []int64) Value { - return Value{vtype: INT64SLICE, slice: attribute.SliceValue(v)} + return Value{vtype: INT64SLICE, slice: attribute.Int64SliceValue(v)} } // Float64Value creates a FLOAT64 Value. @@ -112,7 +112,7 @@ func Float64Value(v float64) Value { // Float64SliceValue creates a FLOAT64SLICE Value. func Float64SliceValue(v []float64) Value { - return Value{vtype: FLOAT64SLICE, slice: attribute.SliceValue(v)} + return Value{vtype: FLOAT64SLICE, slice: attribute.Float64SliceValue(v)} } // StringValue creates a STRING Value. @@ -125,7 +125,7 @@ func StringValue(v string) Value { // StringSliceValue creates a STRINGSLICE Value. func StringSliceValue(v []string) Value { - return Value{vtype: STRINGSLICE, slice: attribute.SliceValue(v)} + return Value{vtype: STRINGSLICE, slice: attribute.StringSliceValue(v)} } // Type returns a type of the Value. @@ -149,7 +149,7 @@ func (v Value) AsBoolSlice() []bool { } func (v Value) asBoolSlice() []bool { - return attribute.AsSlice[bool](v.slice) + return attribute.AsBoolSlice(v.slice) } // AsInt64 returns the int64 value. Make sure that the Value's type is @@ -168,7 +168,7 @@ func (v Value) AsInt64Slice() []int64 { } func (v Value) asInt64Slice() []int64 { - return attribute.AsSlice[int64](v.slice) + return attribute.AsInt64Slice(v.slice) } // AsFloat64 returns the float64 value. Make sure that the Value's @@ -187,7 +187,7 @@ func (v Value) AsFloat64Slice() []float64 { } func (v Value) asFloat64Slice() []float64 { - return attribute.AsSlice[float64](v.slice) + return attribute.AsFloat64Slice(v.slice) } // AsString returns the string value. Make sure that the Value's type @@ -206,7 +206,7 @@ func (v Value) AsStringSlice() []string { } func (v Value) asStringSlice() []string { - return attribute.AsSlice[string](v.slice) + return attribute.AsStringSlice(v.slice) } type unknownValueType struct{} diff --git a/vendor/go.opentelemetry.io/otel/baggage/baggage.go b/vendor/go.opentelemetry.io/otel/baggage/baggage.go index a36db8f8d8..46e523a80e 100644 --- a/vendor/go.opentelemetry.io/otel/baggage/baggage.go +++ b/vendor/go.opentelemetry.io/otel/baggage/baggage.go @@ -289,45 +289,37 @@ func parseMember(member string) (Member, error) { props properties ) - parts := strings.SplitN(member, propertyDelimiter, 2) - switch len(parts) { - case 2: + keyValue, properties, found := strings.Cut(member, propertyDelimiter) + if found { // Parse the member properties. - for _, pStr := range strings.Split(parts[1], propertyDelimiter) { + for _, pStr := range strings.Split(properties, propertyDelimiter) { p, err := parseProperty(pStr) if err != nil { return newInvalidMember(), err } props = append(props, p) } - fallthrough - case 1: - // Parse the member key/value pair. - - // Take into account a value can contain equal signs (=). - kv := strings.SplitN(parts[0], keyValueDelimiter, 2) - if len(kv) != 2 { - return newInvalidMember(), fmt.Errorf("%w: %q", errInvalidMember, member) - } - // "Leading and trailing whitespaces are allowed but MUST be trimmed - // when converting the header into a data structure." - key = strings.TrimSpace(kv[0]) - var err error - value, err = url.QueryUnescape(strings.TrimSpace(kv[1])) - if err != nil { - return newInvalidMember(), fmt.Errorf("%w: %q", err, value) - } - if !keyRe.MatchString(key) { - return newInvalidMember(), fmt.Errorf("%w: %q", errInvalidKey, key) - } - if !valueRe.MatchString(value) { - return newInvalidMember(), fmt.Errorf("%w: %q", errInvalidValue, value) - } - default: - // This should never happen unless a developer has changed the string - // splitting somehow. Panic instead of failing silently and allowing - // the bug to slip past the CI checks. - panic("failed to parse baggage member") + } + // Parse the member key/value pair. + + // Take into account a value can contain equal signs (=). + k, v, found := strings.Cut(keyValue, keyValueDelimiter) + if !found { + return newInvalidMember(), fmt.Errorf("%w: %q", errInvalidMember, member) + } + // "Leading and trailing whitespaces are allowed but MUST be trimmed + // when converting the header into a data structure." + key = strings.TrimSpace(k) + var err error + value, err = url.QueryUnescape(strings.TrimSpace(v)) + if err != nil { + return newInvalidMember(), fmt.Errorf("%w: %q", err, value) + } + if !keyRe.MatchString(key) { + return newInvalidMember(), fmt.Errorf("%w: %q", errInvalidKey, key) + } + if !valueRe.MatchString(value) { + return newInvalidMember(), fmt.Errorf("%w: %q", errInvalidValue, value) } return Member{key: key, value: value, properties: props, hasData: true}, nil diff --git a/vendor/go.opentelemetry.io/otel/codes/doc.go b/vendor/go.opentelemetry.io/otel/codes/doc.go index df3e0f1b62..4e328fbb4b 100644 --- a/vendor/go.opentelemetry.io/otel/codes/doc.go +++ b/vendor/go.opentelemetry.io/otel/codes/doc.go @@ -16,6 +16,6 @@ Package codes defines the canonical error codes used by OpenTelemetry. It conforms to [the OpenTelemetry -specification](https://github.com/open-telemetry/opentelemetry-specification/blob/main/specification/trace/api.md#statuscanonicalcode). +specification](https://github.com/open-telemetry/opentelemetry-specification/blob/v1.20.0/specification/trace/api.md#set-status). */ package codes // import "go.opentelemetry.io/otel/codes" diff --git a/vendor/go.opentelemetry.io/otel/handler.go b/vendor/go.opentelemetry.io/otel/handler.go index 36cf09f729..4115fe3bbb 100644 --- a/vendor/go.opentelemetry.io/otel/handler.go +++ b/vendor/go.opentelemetry.io/otel/handler.go @@ -15,59 +15,16 @@ package otel // import "go.opentelemetry.io/otel" import ( - "log" - "os" - "sync" + "go.opentelemetry.io/otel/internal/global" ) var ( - // globalErrorHandler provides an ErrorHandler that can be used - // throughout an OpenTelemetry instrumented project. When a user - // specified ErrorHandler is registered (`SetErrorHandler`) all calls to - // `Handle` and will be delegated to the registered ErrorHandler. - globalErrorHandler = defaultErrorHandler() - - // Compile-time check that delegator implements ErrorHandler. - _ ErrorHandler = (*delegator)(nil) - // Compile-time check that errLogger implements ErrorHandler. - _ ErrorHandler = (*errLogger)(nil) + // Compile-time check global.ErrDelegator implements ErrorHandler. + _ ErrorHandler = (*global.ErrDelegator)(nil) + // Compile-time check global.ErrLogger implements ErrorHandler. + _ ErrorHandler = (*global.ErrLogger)(nil) ) -type delegator struct { - lock *sync.RWMutex - eh ErrorHandler -} - -func (d *delegator) Handle(err error) { - d.lock.RLock() - defer d.lock.RUnlock() - d.eh.Handle(err) -} - -// setDelegate sets the ErrorHandler delegate. -func (d *delegator) setDelegate(eh ErrorHandler) { - d.lock.Lock() - defer d.lock.Unlock() - d.eh = eh -} - -func defaultErrorHandler() *delegator { - return &delegator{ - lock: &sync.RWMutex{}, - eh: &errLogger{l: log.New(os.Stderr, "", log.LstdFlags)}, - } -} - -// errLogger logs errors if no delegate is set, otherwise they are delegated. -type errLogger struct { - l *log.Logger -} - -// Handle logs err if no delegate is set, otherwise it is delegated. -func (h *errLogger) Handle(err error) { - h.l.Print(err) -} - // GetErrorHandler returns the global ErrorHandler instance. // // The default ErrorHandler instance returned will log all errors to STDERR @@ -77,9 +34,7 @@ func (h *errLogger) Handle(err error) { // // Subsequent calls to SetErrorHandler after the first will not forward errors // to the new ErrorHandler for prior returned instances. -func GetErrorHandler() ErrorHandler { - return globalErrorHandler -} +func GetErrorHandler() ErrorHandler { return global.GetErrorHandler() } // SetErrorHandler sets the global ErrorHandler to h. // @@ -87,11 +42,7 @@ func GetErrorHandler() ErrorHandler { // GetErrorHandler will send errors to h instead of the default logging // ErrorHandler. Subsequent calls will set the global ErrorHandler, but not // delegate errors to h. -func SetErrorHandler(h ErrorHandler) { - globalErrorHandler.setDelegate(h) -} +func SetErrorHandler(h ErrorHandler) { global.SetErrorHandler(h) } // Handle is a convenience function for ErrorHandler().Handle(err). -func Handle(err error) { - GetErrorHandler().Handle(err) -} +func Handle(err error) { global.Handle(err) } diff --git a/vendor/go.opentelemetry.io/otel/internal/attribute/attribute.go b/vendor/go.opentelemetry.io/otel/internal/attribute/attribute.go index 2203489447..622c3ee3f2 100644 --- a/vendor/go.opentelemetry.io/otel/internal/attribute/attribute.go +++ b/vendor/go.opentelemetry.io/otel/internal/attribute/attribute.go @@ -22,24 +22,90 @@ import ( "reflect" ) -// SliceValue convert a slice into an array with same elements as slice. -func SliceValue[T bool | int64 | float64 | string](v []T) any { - var zero T +// BoolSliceValue converts a bool slice into an array with same elements as slice. +func BoolSliceValue(v []bool) interface{} { + var zero bool cp := reflect.New(reflect.ArrayOf(len(v), reflect.TypeOf(zero))) - copy(cp.Elem().Slice(0, len(v)).Interface().([]T), v) + copy(cp.Elem().Slice(0, len(v)).Interface().([]bool), v) return cp.Elem().Interface() } -// AsSlice convert an array into a slice into with same elements as array. -func AsSlice[T bool | int64 | float64 | string](v any) []T { +// Int64SliceValue converts an int64 slice into an array with same elements as slice. +func Int64SliceValue(v []int64) interface{} { + var zero int64 + cp := reflect.New(reflect.ArrayOf(len(v), reflect.TypeOf(zero))) + copy(cp.Elem().Slice(0, len(v)).Interface().([]int64), v) + return cp.Elem().Interface() +} + +// Float64SliceValue converts a float64 slice into an array with same elements as slice. +func Float64SliceValue(v []float64) interface{} { + var zero float64 + cp := reflect.New(reflect.ArrayOf(len(v), reflect.TypeOf(zero))) + copy(cp.Elem().Slice(0, len(v)).Interface().([]float64), v) + return cp.Elem().Interface() +} + +// StringSliceValue converts a string slice into an array with same elements as slice. +func StringSliceValue(v []string) interface{} { + var zero string + cp := reflect.New(reflect.ArrayOf(len(v), reflect.TypeOf(zero))) + copy(cp.Elem().Slice(0, len(v)).Interface().([]string), v) + return cp.Elem().Interface() +} + +// AsBoolSlice converts a bool array into a slice into with same elements as array. +func AsBoolSlice(v interface{}) []bool { + rv := reflect.ValueOf(v) + if rv.Type().Kind() != reflect.Array { + return nil + } + var zero bool + correctLen := rv.Len() + correctType := reflect.ArrayOf(correctLen, reflect.TypeOf(zero)) + cpy := reflect.New(correctType) + _ = reflect.Copy(cpy.Elem(), rv) + return cpy.Elem().Slice(0, correctLen).Interface().([]bool) +} + +// AsInt64Slice converts an int64 array into a slice into with same elements as array. +func AsInt64Slice(v interface{}) []int64 { + rv := reflect.ValueOf(v) + if rv.Type().Kind() != reflect.Array { + return nil + } + var zero int64 + correctLen := rv.Len() + correctType := reflect.ArrayOf(correctLen, reflect.TypeOf(zero)) + cpy := reflect.New(correctType) + _ = reflect.Copy(cpy.Elem(), rv) + return cpy.Elem().Slice(0, correctLen).Interface().([]int64) +} + +// AsFloat64Slice converts a float64 array into a slice into with same elements as array. +func AsFloat64Slice(v interface{}) []float64 { + rv := reflect.ValueOf(v) + if rv.Type().Kind() != reflect.Array { + return nil + } + var zero float64 + correctLen := rv.Len() + correctType := reflect.ArrayOf(correctLen, reflect.TypeOf(zero)) + cpy := reflect.New(correctType) + _ = reflect.Copy(cpy.Elem(), rv) + return cpy.Elem().Slice(0, correctLen).Interface().([]float64) +} + +// AsStringSlice converts a string array into a slice into with same elements as array. +func AsStringSlice(v interface{}) []string { rv := reflect.ValueOf(v) if rv.Type().Kind() != reflect.Array { return nil } - var zero T + var zero string correctLen := rv.Len() correctType := reflect.ArrayOf(correctLen, reflect.TypeOf(zero)) cpy := reflect.New(correctType) _ = reflect.Copy(cpy.Elem(), rv) - return cpy.Elem().Slice(0, correctLen).Interface().([]T) + return cpy.Elem().Slice(0, correctLen).Interface().([]string) } diff --git a/vendor/go.opentelemetry.io/otel/internal/global/handler.go b/vendor/go.opentelemetry.io/otel/internal/global/handler.go new file mode 100644 index 0000000000..3dcd1caae6 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/internal/global/handler.go @@ -0,0 +1,103 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package global // import "go.opentelemetry.io/otel/internal/global" + +import ( + "log" + "os" + "sync/atomic" + "unsafe" +) + +var ( + // GlobalErrorHandler provides an ErrorHandler that can be used + // throughout an OpenTelemetry instrumented project. When a user + // specified ErrorHandler is registered (`SetErrorHandler`) all calls to + // `Handle` and will be delegated to the registered ErrorHandler. + GlobalErrorHandler = defaultErrorHandler() + + // Compile-time check that delegator implements ErrorHandler. + _ ErrorHandler = (*ErrDelegator)(nil) + // Compile-time check that errLogger implements ErrorHandler. + _ ErrorHandler = (*ErrLogger)(nil) +) + +// ErrorHandler handles irremediable events. +type ErrorHandler interface { + // Handle handles any error deemed irremediable by an OpenTelemetry + // component. + Handle(error) +} + +type ErrDelegator struct { + delegate unsafe.Pointer +} + +func (d *ErrDelegator) Handle(err error) { + d.getDelegate().Handle(err) +} + +func (d *ErrDelegator) getDelegate() ErrorHandler { + return *(*ErrorHandler)(atomic.LoadPointer(&d.delegate)) +} + +// setDelegate sets the ErrorHandler delegate. +func (d *ErrDelegator) setDelegate(eh ErrorHandler) { + atomic.StorePointer(&d.delegate, unsafe.Pointer(&eh)) +} + +func defaultErrorHandler() *ErrDelegator { + d := &ErrDelegator{} + d.setDelegate(&ErrLogger{l: log.New(os.Stderr, "", log.LstdFlags)}) + return d +} + +// ErrLogger logs errors if no delegate is set, otherwise they are delegated. +type ErrLogger struct { + l *log.Logger +} + +// Handle logs err if no delegate is set, otherwise it is delegated. +func (h *ErrLogger) Handle(err error) { + h.l.Print(err) +} + +// GetErrorHandler returns the global ErrorHandler instance. +// +// The default ErrorHandler instance returned will log all errors to STDERR +// until an override ErrorHandler is set with SetErrorHandler. All +// ErrorHandler returned prior to this will automatically forward errors to +// the set instance instead of logging. +// +// Subsequent calls to SetErrorHandler after the first will not forward errors +// to the new ErrorHandler for prior returned instances. +func GetErrorHandler() ErrorHandler { + return GlobalErrorHandler +} + +// SetErrorHandler sets the global ErrorHandler to h. +// +// The first time this is called all ErrorHandler previously returned from +// GetErrorHandler will send errors to h instead of the default logging +// ErrorHandler. Subsequent calls will set the global ErrorHandler, but not +// delegate errors to h. +func SetErrorHandler(h ErrorHandler) { + GlobalErrorHandler.setDelegate(h) +} + +// Handle is a convenience function for ErrorHandler().Handle(err). +func Handle(err error) { + GetErrorHandler().Handle(err) +} diff --git a/vendor/go.opentelemetry.io/otel/internal/global/instruments.go b/vendor/go.opentelemetry.io/otel/internal/global/instruments.go new file mode 100644 index 0000000000..a33eded872 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/internal/global/instruments.go @@ -0,0 +1,359 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package global // import "go.opentelemetry.io/otel/internal/global" + +import ( + "context" + "sync/atomic" + + "go.opentelemetry.io/otel/metric" + "go.opentelemetry.io/otel/metric/embedded" +) + +// unwrapper unwraps to return the underlying instrument implementation. +type unwrapper interface { + Unwrap() metric.Observable +} + +type afCounter struct { + embedded.Float64ObservableCounter + metric.Float64Observable + + name string + opts []metric.Float64ObservableCounterOption + + delegate atomic.Value //metric.Float64ObservableCounter +} + +var _ unwrapper = (*afCounter)(nil) +var _ metric.Float64ObservableCounter = (*afCounter)(nil) + +func (i *afCounter) setDelegate(m metric.Meter) { + ctr, err := m.Float64ObservableCounter(i.name, i.opts...) + if err != nil { + GetErrorHandler().Handle(err) + return + } + i.delegate.Store(ctr) +} + +func (i *afCounter) Unwrap() metric.Observable { + if ctr := i.delegate.Load(); ctr != nil { + return ctr.(metric.Float64ObservableCounter) + } + return nil +} + +type afUpDownCounter struct { + embedded.Float64ObservableUpDownCounter + metric.Float64Observable + + name string + opts []metric.Float64ObservableUpDownCounterOption + + delegate atomic.Value //metric.Float64ObservableUpDownCounter +} + +var _ unwrapper = (*afUpDownCounter)(nil) +var _ metric.Float64ObservableUpDownCounter = (*afUpDownCounter)(nil) + +func (i *afUpDownCounter) setDelegate(m metric.Meter) { + ctr, err := m.Float64ObservableUpDownCounter(i.name, i.opts...) + if err != nil { + GetErrorHandler().Handle(err) + return + } + i.delegate.Store(ctr) +} + +func (i *afUpDownCounter) Unwrap() metric.Observable { + if ctr := i.delegate.Load(); ctr != nil { + return ctr.(metric.Float64ObservableUpDownCounter) + } + return nil +} + +type afGauge struct { + embedded.Float64ObservableGauge + metric.Float64Observable + + name string + opts []metric.Float64ObservableGaugeOption + + delegate atomic.Value //metric.Float64ObservableGauge +} + +var _ unwrapper = (*afGauge)(nil) +var _ metric.Float64ObservableGauge = (*afGauge)(nil) + +func (i *afGauge) setDelegate(m metric.Meter) { + ctr, err := m.Float64ObservableGauge(i.name, i.opts...) + if err != nil { + GetErrorHandler().Handle(err) + return + } + i.delegate.Store(ctr) +} + +func (i *afGauge) Unwrap() metric.Observable { + if ctr := i.delegate.Load(); ctr != nil { + return ctr.(metric.Float64ObservableGauge) + } + return nil +} + +type aiCounter struct { + embedded.Int64ObservableCounter + metric.Int64Observable + + name string + opts []metric.Int64ObservableCounterOption + + delegate atomic.Value //metric.Int64ObservableCounter +} + +var _ unwrapper = (*aiCounter)(nil) +var _ metric.Int64ObservableCounter = (*aiCounter)(nil) + +func (i *aiCounter) setDelegate(m metric.Meter) { + ctr, err := m.Int64ObservableCounter(i.name, i.opts...) + if err != nil { + GetErrorHandler().Handle(err) + return + } + i.delegate.Store(ctr) +} + +func (i *aiCounter) Unwrap() metric.Observable { + if ctr := i.delegate.Load(); ctr != nil { + return ctr.(metric.Int64ObservableCounter) + } + return nil +} + +type aiUpDownCounter struct { + embedded.Int64ObservableUpDownCounter + metric.Int64Observable + + name string + opts []metric.Int64ObservableUpDownCounterOption + + delegate atomic.Value //metric.Int64ObservableUpDownCounter +} + +var _ unwrapper = (*aiUpDownCounter)(nil) +var _ metric.Int64ObservableUpDownCounter = (*aiUpDownCounter)(nil) + +func (i *aiUpDownCounter) setDelegate(m metric.Meter) { + ctr, err := m.Int64ObservableUpDownCounter(i.name, i.opts...) + if err != nil { + GetErrorHandler().Handle(err) + return + } + i.delegate.Store(ctr) +} + +func (i *aiUpDownCounter) Unwrap() metric.Observable { + if ctr := i.delegate.Load(); ctr != nil { + return ctr.(metric.Int64ObservableUpDownCounter) + } + return nil +} + +type aiGauge struct { + embedded.Int64ObservableGauge + metric.Int64Observable + + name string + opts []metric.Int64ObservableGaugeOption + + delegate atomic.Value //metric.Int64ObservableGauge +} + +var _ unwrapper = (*aiGauge)(nil) +var _ metric.Int64ObservableGauge = (*aiGauge)(nil) + +func (i *aiGauge) setDelegate(m metric.Meter) { + ctr, err := m.Int64ObservableGauge(i.name, i.opts...) + if err != nil { + GetErrorHandler().Handle(err) + return + } + i.delegate.Store(ctr) +} + +func (i *aiGauge) Unwrap() metric.Observable { + if ctr := i.delegate.Load(); ctr != nil { + return ctr.(metric.Int64ObservableGauge) + } + return nil +} + +// Sync Instruments. +type sfCounter struct { + embedded.Float64Counter + + name string + opts []metric.Float64CounterOption + + delegate atomic.Value //metric.Float64Counter +} + +var _ metric.Float64Counter = (*sfCounter)(nil) + +func (i *sfCounter) setDelegate(m metric.Meter) { + ctr, err := m.Float64Counter(i.name, i.opts...) + if err != nil { + GetErrorHandler().Handle(err) + return + } + i.delegate.Store(ctr) +} + +func (i *sfCounter) Add(ctx context.Context, incr float64, opts ...metric.AddOption) { + if ctr := i.delegate.Load(); ctr != nil { + ctr.(metric.Float64Counter).Add(ctx, incr, opts...) + } +} + +type sfUpDownCounter struct { + embedded.Float64UpDownCounter + + name string + opts []metric.Float64UpDownCounterOption + + delegate atomic.Value //metric.Float64UpDownCounter +} + +var _ metric.Float64UpDownCounter = (*sfUpDownCounter)(nil) + +func (i *sfUpDownCounter) setDelegate(m metric.Meter) { + ctr, err := m.Float64UpDownCounter(i.name, i.opts...) + if err != nil { + GetErrorHandler().Handle(err) + return + } + i.delegate.Store(ctr) +} + +func (i *sfUpDownCounter) Add(ctx context.Context, incr float64, opts ...metric.AddOption) { + if ctr := i.delegate.Load(); ctr != nil { + ctr.(metric.Float64UpDownCounter).Add(ctx, incr, opts...) + } +} + +type sfHistogram struct { + embedded.Float64Histogram + + name string + opts []metric.Float64HistogramOption + + delegate atomic.Value //metric.Float64Histogram +} + +var _ metric.Float64Histogram = (*sfHistogram)(nil) + +func (i *sfHistogram) setDelegate(m metric.Meter) { + ctr, err := m.Float64Histogram(i.name, i.opts...) + if err != nil { + GetErrorHandler().Handle(err) + return + } + i.delegate.Store(ctr) +} + +func (i *sfHistogram) Record(ctx context.Context, x float64, opts ...metric.RecordOption) { + if ctr := i.delegate.Load(); ctr != nil { + ctr.(metric.Float64Histogram).Record(ctx, x, opts...) + } +} + +type siCounter struct { + embedded.Int64Counter + + name string + opts []metric.Int64CounterOption + + delegate atomic.Value //metric.Int64Counter +} + +var _ metric.Int64Counter = (*siCounter)(nil) + +func (i *siCounter) setDelegate(m metric.Meter) { + ctr, err := m.Int64Counter(i.name, i.opts...) + if err != nil { + GetErrorHandler().Handle(err) + return + } + i.delegate.Store(ctr) +} + +func (i *siCounter) Add(ctx context.Context, x int64, opts ...metric.AddOption) { + if ctr := i.delegate.Load(); ctr != nil { + ctr.(metric.Int64Counter).Add(ctx, x, opts...) + } +} + +type siUpDownCounter struct { + embedded.Int64UpDownCounter + + name string + opts []metric.Int64UpDownCounterOption + + delegate atomic.Value //metric.Int64UpDownCounter +} + +var _ metric.Int64UpDownCounter = (*siUpDownCounter)(nil) + +func (i *siUpDownCounter) setDelegate(m metric.Meter) { + ctr, err := m.Int64UpDownCounter(i.name, i.opts...) + if err != nil { + GetErrorHandler().Handle(err) + return + } + i.delegate.Store(ctr) +} + +func (i *siUpDownCounter) Add(ctx context.Context, x int64, opts ...metric.AddOption) { + if ctr := i.delegate.Load(); ctr != nil { + ctr.(metric.Int64UpDownCounter).Add(ctx, x, opts...) + } +} + +type siHistogram struct { + embedded.Int64Histogram + + name string + opts []metric.Int64HistogramOption + + delegate atomic.Value //metric.Int64Histogram +} + +var _ metric.Int64Histogram = (*siHistogram)(nil) + +func (i *siHistogram) setDelegate(m metric.Meter) { + ctr, err := m.Int64Histogram(i.name, i.opts...) + if err != nil { + GetErrorHandler().Handle(err) + return + } + i.delegate.Store(ctr) +} + +func (i *siHistogram) Record(ctx context.Context, x int64, opts ...metric.RecordOption) { + if ctr := i.delegate.Load(); ctr != nil { + ctr.(metric.Int64Histogram).Record(ctx, x, opts...) + } +} diff --git a/vendor/go.opentelemetry.io/otel/internal/global/internal_logging.go b/vendor/go.opentelemetry.io/otel/internal/global/internal_logging.go index ccb3258711..5951fd06d4 100644 --- a/vendor/go.opentelemetry.io/otel/internal/global/internal_logging.go +++ b/vendor/go.opentelemetry.io/otel/internal/global/internal_logging.go @@ -17,47 +17,54 @@ package global // import "go.opentelemetry.io/otel/internal/global" import ( "log" "os" - "sync" + "sync/atomic" + "unsafe" "github.com/go-logr/logr" "github.com/go-logr/stdr" ) -// globalLogger is the logging interface used within the otel api and sdk provide deatails of the internals. +// globalLogger is the logging interface used within the otel api and sdk provide details of the internals. // // The default logger uses stdr which is backed by the standard `log.Logger` // interface. This logger will only show messages at the Error Level. -var globalLogger logr.Logger = stdr.New(log.New(os.Stderr, "", log.LstdFlags|log.Lshortfile)) -var globalLoggerLock = &sync.RWMutex{} +var globalLogger unsafe.Pointer + +func init() { + SetLogger(stdr.New(log.New(os.Stderr, "", log.LstdFlags|log.Lshortfile))) +} // SetLogger overrides the globalLogger with l. // -// To see Info messages use a logger with `l.V(1).Enabled() == true` -// To see Debug messages use a logger with `l.V(5).Enabled() == true`. +// To see Warn messages use a logger with `l.V(1).Enabled() == true` +// To see Info messages use a logger with `l.V(4).Enabled() == true` +// To see Debug messages use a logger with `l.V(8).Enabled() == true`. func SetLogger(l logr.Logger) { - globalLoggerLock.Lock() - defer globalLoggerLock.Unlock() - globalLogger = l + atomic.StorePointer(&globalLogger, unsafe.Pointer(&l)) +} + +func getLogger() logr.Logger { + return *(*logr.Logger)(atomic.LoadPointer(&globalLogger)) } // Info prints messages about the general state of the API or SDK. -// This should usually be less then 5 messages a minute. +// This should usually be less than 5 messages a minute. func Info(msg string, keysAndValues ...interface{}) { - globalLoggerLock.RLock() - defer globalLoggerLock.RUnlock() - globalLogger.V(1).Info(msg, keysAndValues...) + getLogger().V(4).Info(msg, keysAndValues...) } // Error prints messages about exceptional states of the API or SDK. func Error(err error, msg string, keysAndValues ...interface{}) { - globalLoggerLock.RLock() - defer globalLoggerLock.RUnlock() - globalLogger.Error(err, msg, keysAndValues...) + getLogger().Error(err, msg, keysAndValues...) } // Debug prints messages about all internal changes in the API or SDK. func Debug(msg string, keysAndValues ...interface{}) { - globalLoggerLock.RLock() - defer globalLoggerLock.RUnlock() - globalLogger.V(5).Info(msg, keysAndValues...) + getLogger().V(8).Info(msg, keysAndValues...) +} + +// Warn prints messages about warnings in the API or SDK. +// Not an error but is likely more important than an informational event. +func Warn(msg string, keysAndValues ...interface{}) { + getLogger().V(1).Info(msg, keysAndValues...) } diff --git a/vendor/go.opentelemetry.io/otel/internal/global/meter.go b/vendor/go.opentelemetry.io/otel/internal/global/meter.go new file mode 100644 index 0000000000..0097db478c --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/internal/global/meter.go @@ -0,0 +1,354 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package global // import "go.opentelemetry.io/otel/internal/global" + +import ( + "container/list" + "sync" + "sync/atomic" + + "go.opentelemetry.io/otel/metric" + "go.opentelemetry.io/otel/metric/embedded" +) + +// meterProvider is a placeholder for a configured SDK MeterProvider. +// +// All MeterProvider functionality is forwarded to a delegate once +// configured. +type meterProvider struct { + embedded.MeterProvider + + mtx sync.Mutex + meters map[il]*meter + + delegate metric.MeterProvider +} + +// setDelegate configures p to delegate all MeterProvider functionality to +// provider. +// +// All Meters provided prior to this function call are switched out to be +// Meters provided by provider. All instruments and callbacks are recreated and +// delegated. +// +// It is guaranteed by the caller that this happens only once. +func (p *meterProvider) setDelegate(provider metric.MeterProvider) { + p.mtx.Lock() + defer p.mtx.Unlock() + + p.delegate = provider + + if len(p.meters) == 0 { + return + } + + for _, meter := range p.meters { + meter.setDelegate(provider) + } + + p.meters = nil +} + +// Meter implements MeterProvider. +func (p *meterProvider) Meter(name string, opts ...metric.MeterOption) metric.Meter { + p.mtx.Lock() + defer p.mtx.Unlock() + + if p.delegate != nil { + return p.delegate.Meter(name, opts...) + } + + // At this moment it is guaranteed that no sdk is installed, save the meter in the meters map. + + c := metric.NewMeterConfig(opts...) + key := il{ + name: name, + version: c.InstrumentationVersion(), + } + + if p.meters == nil { + p.meters = make(map[il]*meter) + } + + if val, ok := p.meters[key]; ok { + return val + } + + t := &meter{name: name, opts: opts} + p.meters[key] = t + return t +} + +// meter is a placeholder for a metric.Meter. +// +// All Meter functionality is forwarded to a delegate once configured. +// Otherwise, all functionality is forwarded to a NoopMeter. +type meter struct { + embedded.Meter + + name string + opts []metric.MeterOption + + mtx sync.Mutex + instruments []delegatedInstrument + + registry list.List + + delegate atomic.Value // metric.Meter +} + +type delegatedInstrument interface { + setDelegate(metric.Meter) +} + +// setDelegate configures m to delegate all Meter functionality to Meters +// created by provider. +// +// All subsequent calls to the Meter methods will be passed to the delegate. +// +// It is guaranteed by the caller that this happens only once. +func (m *meter) setDelegate(provider metric.MeterProvider) { + meter := provider.Meter(m.name, m.opts...) + m.delegate.Store(meter) + + m.mtx.Lock() + defer m.mtx.Unlock() + + for _, inst := range m.instruments { + inst.setDelegate(meter) + } + + for e := m.registry.Front(); e != nil; e = e.Next() { + r := e.Value.(*registration) + r.setDelegate(meter) + m.registry.Remove(e) + } + + m.instruments = nil + m.registry.Init() +} + +func (m *meter) Int64Counter(name string, options ...metric.Int64CounterOption) (metric.Int64Counter, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + return del.Int64Counter(name, options...) + } + m.mtx.Lock() + defer m.mtx.Unlock() + i := &siCounter{name: name, opts: options} + m.instruments = append(m.instruments, i) + return i, nil +} + +func (m *meter) Int64UpDownCounter(name string, options ...metric.Int64UpDownCounterOption) (metric.Int64UpDownCounter, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + return del.Int64UpDownCounter(name, options...) + } + m.mtx.Lock() + defer m.mtx.Unlock() + i := &siUpDownCounter{name: name, opts: options} + m.instruments = append(m.instruments, i) + return i, nil +} + +func (m *meter) Int64Histogram(name string, options ...metric.Int64HistogramOption) (metric.Int64Histogram, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + return del.Int64Histogram(name, options...) + } + m.mtx.Lock() + defer m.mtx.Unlock() + i := &siHistogram{name: name, opts: options} + m.instruments = append(m.instruments, i) + return i, nil +} + +func (m *meter) Int64ObservableCounter(name string, options ...metric.Int64ObservableCounterOption) (metric.Int64ObservableCounter, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + return del.Int64ObservableCounter(name, options...) + } + m.mtx.Lock() + defer m.mtx.Unlock() + i := &aiCounter{name: name, opts: options} + m.instruments = append(m.instruments, i) + return i, nil +} + +func (m *meter) Int64ObservableUpDownCounter(name string, options ...metric.Int64ObservableUpDownCounterOption) (metric.Int64ObservableUpDownCounter, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + return del.Int64ObservableUpDownCounter(name, options...) + } + m.mtx.Lock() + defer m.mtx.Unlock() + i := &aiUpDownCounter{name: name, opts: options} + m.instruments = append(m.instruments, i) + return i, nil +} + +func (m *meter) Int64ObservableGauge(name string, options ...metric.Int64ObservableGaugeOption) (metric.Int64ObservableGauge, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + return del.Int64ObservableGauge(name, options...) + } + m.mtx.Lock() + defer m.mtx.Unlock() + i := &aiGauge{name: name, opts: options} + m.instruments = append(m.instruments, i) + return i, nil +} + +func (m *meter) Float64Counter(name string, options ...metric.Float64CounterOption) (metric.Float64Counter, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + return del.Float64Counter(name, options...) + } + m.mtx.Lock() + defer m.mtx.Unlock() + i := &sfCounter{name: name, opts: options} + m.instruments = append(m.instruments, i) + return i, nil +} + +func (m *meter) Float64UpDownCounter(name string, options ...metric.Float64UpDownCounterOption) (metric.Float64UpDownCounter, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + return del.Float64UpDownCounter(name, options...) + } + m.mtx.Lock() + defer m.mtx.Unlock() + i := &sfUpDownCounter{name: name, opts: options} + m.instruments = append(m.instruments, i) + return i, nil +} + +func (m *meter) Float64Histogram(name string, options ...metric.Float64HistogramOption) (metric.Float64Histogram, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + return del.Float64Histogram(name, options...) + } + m.mtx.Lock() + defer m.mtx.Unlock() + i := &sfHistogram{name: name, opts: options} + m.instruments = append(m.instruments, i) + return i, nil +} + +func (m *meter) Float64ObservableCounter(name string, options ...metric.Float64ObservableCounterOption) (metric.Float64ObservableCounter, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + return del.Float64ObservableCounter(name, options...) + } + m.mtx.Lock() + defer m.mtx.Unlock() + i := &afCounter{name: name, opts: options} + m.instruments = append(m.instruments, i) + return i, nil +} + +func (m *meter) Float64ObservableUpDownCounter(name string, options ...metric.Float64ObservableUpDownCounterOption) (metric.Float64ObservableUpDownCounter, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + return del.Float64ObservableUpDownCounter(name, options...) + } + m.mtx.Lock() + defer m.mtx.Unlock() + i := &afUpDownCounter{name: name, opts: options} + m.instruments = append(m.instruments, i) + return i, nil +} + +func (m *meter) Float64ObservableGauge(name string, options ...metric.Float64ObservableGaugeOption) (metric.Float64ObservableGauge, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + return del.Float64ObservableGauge(name, options...) + } + m.mtx.Lock() + defer m.mtx.Unlock() + i := &afGauge{name: name, opts: options} + m.instruments = append(m.instruments, i) + return i, nil +} + +// RegisterCallback captures the function that will be called during Collect. +func (m *meter) RegisterCallback(f metric.Callback, insts ...metric.Observable) (metric.Registration, error) { + if del, ok := m.delegate.Load().(metric.Meter); ok { + insts = unwrapInstruments(insts) + return del.RegisterCallback(f, insts...) + } + + m.mtx.Lock() + defer m.mtx.Unlock() + + reg := ®istration{instruments: insts, function: f} + e := m.registry.PushBack(reg) + reg.unreg = func() error { + m.mtx.Lock() + _ = m.registry.Remove(e) + m.mtx.Unlock() + return nil + } + return reg, nil +} + +type wrapped interface { + unwrap() metric.Observable +} + +func unwrapInstruments(instruments []metric.Observable) []metric.Observable { + out := make([]metric.Observable, 0, len(instruments)) + + for _, inst := range instruments { + if in, ok := inst.(wrapped); ok { + out = append(out, in.unwrap()) + } else { + out = append(out, inst) + } + } + + return out +} + +type registration struct { + embedded.Registration + + instruments []metric.Observable + function metric.Callback + + unreg func() error + unregMu sync.Mutex +} + +func (c *registration) setDelegate(m metric.Meter) { + insts := unwrapInstruments(c.instruments) + + c.unregMu.Lock() + defer c.unregMu.Unlock() + + if c.unreg == nil { + // Unregister already called. + return + } + + reg, err := m.RegisterCallback(c.function, insts...) + if err != nil { + GetErrorHandler().Handle(err) + } + + c.unreg = reg.Unregister +} + +func (c *registration) Unregister() error { + c.unregMu.Lock() + defer c.unregMu.Unlock() + if c.unreg == nil { + // Unregister already called. + return nil + } + + var err error + err, c.unreg = c.unreg(), nil + return err +} diff --git a/vendor/go.opentelemetry.io/otel/internal/global/state.go b/vendor/go.opentelemetry.io/otel/internal/global/state.go index 1ad38f828e..7985005bcb 100644 --- a/vendor/go.opentelemetry.io/otel/internal/global/state.go +++ b/vendor/go.opentelemetry.io/otel/internal/global/state.go @@ -19,6 +19,7 @@ import ( "sync" "sync/atomic" + "go.opentelemetry.io/otel/metric" "go.opentelemetry.io/otel/propagation" "go.opentelemetry.io/otel/trace" ) @@ -31,14 +32,20 @@ type ( propagatorsHolder struct { tm propagation.TextMapPropagator } + + meterProviderHolder struct { + mp metric.MeterProvider + } ) var ( - globalTracer = defaultTracerValue() - globalPropagators = defaultPropagatorsValue() + globalTracer = defaultTracerValue() + globalPropagators = defaultPropagatorsValue() + globalMeterProvider = defaultMeterProvider() delegateTraceOnce sync.Once delegateTextMapPropagatorOnce sync.Once + delegateMeterOnce sync.Once ) // TracerProvider is the internal implementation for global.TracerProvider. @@ -102,6 +109,34 @@ func SetTextMapPropagator(p propagation.TextMapPropagator) { globalPropagators.Store(propagatorsHolder{tm: p}) } +// MeterProvider is the internal implementation for global.MeterProvider. +func MeterProvider() metric.MeterProvider { + return globalMeterProvider.Load().(meterProviderHolder).mp +} + +// SetMeterProvider is the internal implementation for global.SetMeterProvider. +func SetMeterProvider(mp metric.MeterProvider) { + current := MeterProvider() + if _, cOk := current.(*meterProvider); cOk { + if _, mpOk := mp.(*meterProvider); mpOk && current == mp { + // Do not assign the default delegating MeterProvider to delegate + // to itself. + Error( + errors.New("no delegate configured in meter provider"), + "Setting meter provider to it's current value. No delegate will be configured", + ) + return + } + } + + delegateMeterOnce.Do(func() { + if def, ok := current.(*meterProvider); ok { + def.setDelegate(mp) + } + }) + globalMeterProvider.Store(meterProviderHolder{mp: mp}) +} + func defaultTracerValue() *atomic.Value { v := &atomic.Value{} v.Store(tracerProviderHolder{tp: &tracerProvider{}}) @@ -113,3 +148,9 @@ func defaultPropagatorsValue() *atomic.Value { v.Store(propagatorsHolder{tm: newTextMapPropagator()}) return v } + +func defaultMeterProvider() *atomic.Value { + v := &atomic.Value{} + v.Store(meterProviderHolder{mp: &meterProvider{}}) + return v +} diff --git a/vendor/go.opentelemetry.io/otel/metric.go b/vendor/go.opentelemetry.io/otel/metric.go new file mode 100644 index 0000000000..f955171951 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/metric.go @@ -0,0 +1,53 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package otel // import "go.opentelemetry.io/otel" + +import ( + "go.opentelemetry.io/otel/internal/global" + "go.opentelemetry.io/otel/metric" +) + +// Meter returns a Meter from the global MeterProvider. The name must be the +// name of the library providing instrumentation. This name may be the same as +// the instrumented code only if that code provides built-in instrumentation. +// If the name is empty, then a implementation defined default name will be +// used instead. +// +// If this is called before a global MeterProvider is registered the returned +// Meter will be a No-op implementation of a Meter. When a global MeterProvider +// is registered for the first time, the returned Meter, and all the +// instruments it has created or will create, are recreated automatically from +// the new MeterProvider. +// +// This is short for GetMeterProvider().Meter(name). +func Meter(name string, opts ...metric.MeterOption) metric.Meter { + return GetMeterProvider().Meter(name, opts...) +} + +// GetMeterProvider returns the registered global meter provider. +// +// If no global GetMeterProvider has been registered, a No-op GetMeterProvider +// implementation is returned. When a global GetMeterProvider is registered for +// the first time, the returned GetMeterProvider, and all the Meters it has +// created or will create, are recreated automatically from the new +// GetMeterProvider. +func GetMeterProvider() metric.MeterProvider { + return global.MeterProvider() +} + +// SetMeterProvider registers mp as the global MeterProvider. +func SetMeterProvider(mp metric.MeterProvider) { + global.SetMeterProvider(mp) +} diff --git a/vendor/go.opentelemetry.io/otel/metric/LICENSE b/vendor/go.opentelemetry.io/otel/metric/LICENSE new file mode 100644 index 0000000000..261eeb9e9f --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/metric/LICENSE @@ -0,0 +1,201 @@ + Apache License + Version 2.0, January 2004 + http://www.apache.org/licenses/ + + TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION + + 1. Definitions. + + "License" shall mean the terms and conditions for use, reproduction, + and distribution as defined by Sections 1 through 9 of this document. + + "Licensor" shall mean the copyright owner or entity authorized by + the copyright owner that is granting the License. + + "Legal Entity" shall mean the union of the acting entity and all + other entities that control, are controlled by, or are under common + control with that entity. For the purposes of this definition, + "control" means (i) the power, direct or indirect, to cause the + direction or management of such entity, whether by contract or + otherwise, or (ii) ownership of fifty percent (50%) or more of the + outstanding shares, or (iii) beneficial ownership of such entity. + + "You" (or "Your") shall mean an individual or Legal Entity + exercising permissions granted by this License. + + "Source" form shall mean the preferred form for making modifications, + including but not limited to software source code, documentation + source, and configuration files. + + "Object" form shall mean any form resulting from mechanical + transformation or translation of a Source form, including but + not limited to compiled object code, generated documentation, + and conversions to other media types. + + "Work" shall mean the work of authorship, whether in Source or + Object form, made available under the License, as indicated by a + copyright notice that is included in or attached to the work + (an example is provided in the Appendix below). + + "Derivative Works" shall mean any work, whether in Source or Object + form, that is based on (or derived from) the Work and for which the + editorial revisions, annotations, elaborations, or other modifications + represent, as a whole, an original work of authorship. For the purposes + of this License, Derivative Works shall not include works that remain + separable from, or merely link (or bind by name) to the interfaces of, + the Work and Derivative Works thereof. + + "Contribution" shall mean any work of authorship, including + the original version of the Work and any modifications or additions + to that Work or Derivative Works thereof, that is intentionally + submitted to Licensor for inclusion in the Work by the copyright owner + or by an individual or Legal Entity authorized to submit on behalf of + the copyright owner. For the purposes of this definition, "submitted" + means any form of electronic, verbal, or written communication sent + to the Licensor or its representatives, including but not limited to + communication on electronic mailing lists, source code control systems, + and issue tracking systems that are managed by, or on behalf of, the + Licensor for the purpose of discussing and improving the Work, but + excluding communication that is conspicuously marked or otherwise + designated in writing by the copyright owner as "Not a Contribution." + + "Contributor" shall mean Licensor and any individual or Legal Entity + on behalf of whom a Contribution has been received by Licensor and + subsequently incorporated within the Work. + + 2. Grant of Copyright License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + copyright license to reproduce, prepare Derivative Works of, + publicly display, publicly perform, sublicense, and distribute the + Work and such Derivative Works in Source or Object form. + + 3. Grant of Patent License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + (except as stated in this section) patent license to make, have made, + use, offer to sell, sell, import, and otherwise transfer the Work, + where such license applies only to those patent claims licensable + by such Contributor that are necessarily infringed by their + Contribution(s) alone or by combination of their Contribution(s) + with the Work to which such Contribution(s) was submitted. If You + institute patent litigation against any entity (including a + cross-claim or counterclaim in a lawsuit) alleging that the Work + or a Contribution incorporated within the Work constitutes direct + or contributory patent infringement, then any patent licenses + granted to You under this License for that Work shall terminate + as of the date such litigation is filed. + + 4. Redistribution. You may reproduce and distribute copies of the + Work or Derivative Works thereof in any medium, with or without + modifications, and in Source or Object form, provided that You + meet the following conditions: + + (a) You must give any other recipients of the Work or + Derivative Works a copy of this License; and + + (b) You must cause any modified files to carry prominent notices + stating that You changed the files; and + + (c) You must retain, in the Source form of any Derivative Works + that You distribute, all copyright, patent, trademark, and + attribution notices from the Source form of the Work, + excluding those notices that do not pertain to any part of + the Derivative Works; and + + (d) If the Work includes a "NOTICE" text file as part of its + distribution, then any Derivative Works that You distribute must + include a readable copy of the attribution notices contained + within such NOTICE file, excluding those notices that do not + pertain to any part of the Derivative Works, in at least one + of the following places: within a NOTICE text file distributed + as part of the Derivative Works; within the Source form or + documentation, if provided along with the Derivative Works; or, + within a display generated by the Derivative Works, if and + wherever such third-party notices normally appear. The contents + of the NOTICE file are for informational purposes only and + do not modify the License. You may add Your own attribution + notices within Derivative Works that You distribute, alongside + or as an addendum to the NOTICE text from the Work, provided + that such additional attribution notices cannot be construed + as modifying the License. + + You may add Your own copyright statement to Your modifications and + may provide additional or different license terms and conditions + for use, reproduction, or distribution of Your modifications, or + for any such Derivative Works as a whole, provided Your use, + reproduction, and distribution of the Work otherwise complies with + the conditions stated in this License. + + 5. Submission of Contributions. Unless You explicitly state otherwise, + any Contribution intentionally submitted for inclusion in the Work + by You to the Licensor shall be under the terms and conditions of + this License, without any additional terms or conditions. + Notwithstanding the above, nothing herein shall supersede or modify + the terms of any separate license agreement you may have executed + with Licensor regarding such Contributions. + + 6. Trademarks. This License does not grant permission to use the trade + names, trademarks, service marks, or product names of the Licensor, + except as required for reasonable and customary use in describing the + origin of the Work and reproducing the content of the NOTICE file. + + 7. Disclaimer of Warranty. Unless required by applicable law or + agreed to in writing, Licensor provides the Work (and each + Contributor provides its Contributions) on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or + implied, including, without limitation, any warranties or conditions + of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A + PARTICULAR PURPOSE. You are solely responsible for determining the + appropriateness of using or redistributing the Work and assume any + risks associated with Your exercise of permissions under this License. + + 8. Limitation of Liability. In no event and under no legal theory, + whether in tort (including negligence), contract, or otherwise, + unless required by applicable law (such as deliberate and grossly + negligent acts) or agreed to in writing, shall any Contributor be + liable to You for damages, including any direct, indirect, special, + incidental, or consequential damages of any character arising as a + result of this License or out of the use or inability to use the + Work (including but not limited to damages for loss of goodwill, + work stoppage, computer failure or malfunction, or any and all + other commercial damages or losses), even if such Contributor + has been advised of the possibility of such damages. + + 9. Accepting Warranty or Additional Liability. While redistributing + the Work or Derivative Works thereof, You may choose to offer, + and charge a fee for, acceptance of support, warranty, indemnity, + or other liability obligations and/or rights consistent with this + License. However, in accepting such obligations, You may act only + on Your own behalf and on Your sole responsibility, not on behalf + of any other Contributor, and only if You agree to indemnify, + defend, and hold each Contributor harmless for any liability + incurred by, or claims asserted against, such Contributor by reason + of your accepting any such warranty or additional liability. + + END OF TERMS AND CONDITIONS + + APPENDIX: How to apply the Apache License to your work. + + To apply the Apache License to your work, attach the following + boilerplate notice, with the fields enclosed by brackets "[]" + replaced with your own identifying information. (Don't include + the brackets!) The text should be enclosed in the appropriate + comment syntax for the file format. We also recommend that a + file or class name and description of purpose be included on the + same "printed page" as the copyright notice for easier + identification within third-party archives. + + Copyright [yyyy] [name of copyright owner] + + Licensed under the Apache License, Version 2.0 (the "License"); + you may not use this file except in compliance with the License. + You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + + Unless required by applicable law or agreed to in writing, software + distributed under the License is distributed on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + See the License for the specific language governing permissions and + limitations under the License. diff --git a/vendor/go.opentelemetry.io/otel/metric/asyncfloat64.go b/vendor/go.opentelemetry.io/otel/metric/asyncfloat64.go new file mode 100644 index 0000000000..072baa8e8d --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/metric/asyncfloat64.go @@ -0,0 +1,271 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package metric // import "go.opentelemetry.io/otel/metric" + +import ( + "context" + + "go.opentelemetry.io/otel/metric/embedded" +) + +// Float64Observable describes a set of instruments used asynchronously to +// record float64 measurements once per collection cycle. Observations of +// these instruments are only made within a callback. +// +// Warning: Methods may be added to this interface in minor releases. +type Float64Observable interface { + Observable + + float64Observable() +} + +// Float64ObservableCounter is an instrument used to asynchronously record +// increasing float64 measurements once per collection cycle. Observations are +// only made within a callback for this instrument. The value observed is +// assumed the to be the cumulative sum of the count. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for +// unimplemented methods. +type Float64ObservableCounter interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Float64ObservableCounter + + Float64Observable +} + +// Float64ObservableCounterConfig contains options for asynchronous counter +// instruments that record int64 values. +type Float64ObservableCounterConfig struct { + description string + unit string + callbacks []Float64Callback +} + +// NewFloat64ObservableCounterConfig returns a new +// [Float64ObservableCounterConfig] with all opts applied. +func NewFloat64ObservableCounterConfig(opts ...Float64ObservableCounterOption) Float64ObservableCounterConfig { + var config Float64ObservableCounterConfig + for _, o := range opts { + config = o.applyFloat64ObservableCounter(config) + } + return config +} + +// Description returns the configured description. +func (c Float64ObservableCounterConfig) Description() string { + return c.description +} + +// Unit returns the configured unit. +func (c Float64ObservableCounterConfig) Unit() string { + return c.unit +} + +// Callbacks returns the configured callbacks. +func (c Float64ObservableCounterConfig) Callbacks() []Float64Callback { + return c.callbacks +} + +// Float64ObservableCounterOption applies options to a +// [Float64ObservableCounterConfig]. See [Float64ObservableOption] and +// [InstrumentOption] for other options that can be used as a +// Float64ObservableCounterOption. +type Float64ObservableCounterOption interface { + applyFloat64ObservableCounter(Float64ObservableCounterConfig) Float64ObservableCounterConfig +} + +// Float64ObservableUpDownCounter is an instrument used to asynchronously +// record float64 measurements once per collection cycle. Observations are only +// made within a callback for this instrument. The value observed is assumed +// the to be the cumulative sum of the count. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Float64ObservableUpDownCounter interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Float64ObservableUpDownCounter + + Float64Observable +} + +// Float64ObservableUpDownCounterConfig contains options for asynchronous +// counter instruments that record int64 values. +type Float64ObservableUpDownCounterConfig struct { + description string + unit string + callbacks []Float64Callback +} + +// NewFloat64ObservableUpDownCounterConfig returns a new +// [Float64ObservableUpDownCounterConfig] with all opts applied. +func NewFloat64ObservableUpDownCounterConfig(opts ...Float64ObservableUpDownCounterOption) Float64ObservableUpDownCounterConfig { + var config Float64ObservableUpDownCounterConfig + for _, o := range opts { + config = o.applyFloat64ObservableUpDownCounter(config) + } + return config +} + +// Description returns the configured description. +func (c Float64ObservableUpDownCounterConfig) Description() string { + return c.description +} + +// Unit returns the configured unit. +func (c Float64ObservableUpDownCounterConfig) Unit() string { + return c.unit +} + +// Callbacks returns the configured callbacks. +func (c Float64ObservableUpDownCounterConfig) Callbacks() []Float64Callback { + return c.callbacks +} + +// Float64ObservableUpDownCounterOption applies options to a +// [Float64ObservableUpDownCounterConfig]. See [Float64ObservableOption] and +// [InstrumentOption] for other options that can be used as a +// Float64ObservableUpDownCounterOption. +type Float64ObservableUpDownCounterOption interface { + applyFloat64ObservableUpDownCounter(Float64ObservableUpDownCounterConfig) Float64ObservableUpDownCounterConfig +} + +// Float64ObservableGauge is an instrument used to asynchronously record +// instantaneous float64 measurements once per collection cycle. Observations +// are only made within a callback for this instrument. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Float64ObservableGauge interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Float64ObservableGauge + + Float64Observable +} + +// Float64ObservableGaugeConfig contains options for asynchronous counter +// instruments that record int64 values. +type Float64ObservableGaugeConfig struct { + description string + unit string + callbacks []Float64Callback +} + +// NewFloat64ObservableGaugeConfig returns a new [Float64ObservableGaugeConfig] +// with all opts applied. +func NewFloat64ObservableGaugeConfig(opts ...Float64ObservableGaugeOption) Float64ObservableGaugeConfig { + var config Float64ObservableGaugeConfig + for _, o := range opts { + config = o.applyFloat64ObservableGauge(config) + } + return config +} + +// Description returns the configured description. +func (c Float64ObservableGaugeConfig) Description() string { + return c.description +} + +// Unit returns the configured unit. +func (c Float64ObservableGaugeConfig) Unit() string { + return c.unit +} + +// Callbacks returns the configured callbacks. +func (c Float64ObservableGaugeConfig) Callbacks() []Float64Callback { + return c.callbacks +} + +// Float64ObservableGaugeOption applies options to a +// [Float64ObservableGaugeConfig]. See [Float64ObservableOption] and +// [InstrumentOption] for other options that can be used as a +// Float64ObservableGaugeOption. +type Float64ObservableGaugeOption interface { + applyFloat64ObservableGauge(Float64ObservableGaugeConfig) Float64ObservableGaugeConfig +} + +// Float64Observer is a recorder of float64 measurements. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Float64Observer interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Float64Observer + + // Observe records the float64 value. + // + // Use the WithAttributeSet (or, if performance is not a concern, + // the WithAttributes) option to include measurement attributes. + Observe(value float64, options ...ObserveOption) +} + +// Float64Callback is a function registered with a Meter that makes +// observations for a Float64Observerable instrument it is registered with. +// Calls to the Float64Observer record measurement values for the +// Float64Observable. +// +// The function needs to complete in a finite amount of time and the deadline +// of the passed context is expected to be honored. +// +// The function needs to make unique observations across all registered +// Float64Callbacks. Meaning, it should not report measurements with the same +// attributes as another Float64Callbacks also registered for the same +// instrument. +// +// The function needs to be concurrent safe. +type Float64Callback func(context.Context, Float64Observer) error + +// Float64ObservableOption applies options to float64 Observer instruments. +type Float64ObservableOption interface { + Float64ObservableCounterOption + Float64ObservableUpDownCounterOption + Float64ObservableGaugeOption +} + +type float64CallbackOpt struct { + cback Float64Callback +} + +func (o float64CallbackOpt) applyFloat64ObservableCounter(cfg Float64ObservableCounterConfig) Float64ObservableCounterConfig { + cfg.callbacks = append(cfg.callbacks, o.cback) + return cfg +} + +func (o float64CallbackOpt) applyFloat64ObservableUpDownCounter(cfg Float64ObservableUpDownCounterConfig) Float64ObservableUpDownCounterConfig { + cfg.callbacks = append(cfg.callbacks, o.cback) + return cfg +} + +func (o float64CallbackOpt) applyFloat64ObservableGauge(cfg Float64ObservableGaugeConfig) Float64ObservableGaugeConfig { + cfg.callbacks = append(cfg.callbacks, o.cback) + return cfg +} + +// WithFloat64Callback adds callback to be called for an instrument. +func WithFloat64Callback(callback Float64Callback) Float64ObservableOption { + return float64CallbackOpt{callback} +} diff --git a/vendor/go.opentelemetry.io/otel/metric/asyncint64.go b/vendor/go.opentelemetry.io/otel/metric/asyncint64.go new file mode 100644 index 0000000000..9bd6ebf020 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/metric/asyncint64.go @@ -0,0 +1,269 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package metric // import "go.opentelemetry.io/otel/metric" + +import ( + "context" + + "go.opentelemetry.io/otel/metric/embedded" +) + +// Int64Observable describes a set of instruments used asynchronously to record +// int64 measurements once per collection cycle. Observations of these +// instruments are only made within a callback. +// +// Warning: Methods may be added to this interface in minor releases. +type Int64Observable interface { + Observable + + int64Observable() +} + +// Int64ObservableCounter is an instrument used to asynchronously record +// increasing int64 measurements once per collection cycle. Observations are +// only made within a callback for this instrument. The value observed is +// assumed the to be the cumulative sum of the count. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Int64ObservableCounter interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Int64ObservableCounter + + Int64Observable +} + +// Int64ObservableCounterConfig contains options for asynchronous counter +// instruments that record int64 values. +type Int64ObservableCounterConfig struct { + description string + unit string + callbacks []Int64Callback +} + +// NewInt64ObservableCounterConfig returns a new [Int64ObservableCounterConfig] +// with all opts applied. +func NewInt64ObservableCounterConfig(opts ...Int64ObservableCounterOption) Int64ObservableCounterConfig { + var config Int64ObservableCounterConfig + for _, o := range opts { + config = o.applyInt64ObservableCounter(config) + } + return config +} + +// Description returns the configured description. +func (c Int64ObservableCounterConfig) Description() string { + return c.description +} + +// Unit returns the configured unit. +func (c Int64ObservableCounterConfig) Unit() string { + return c.unit +} + +// Callbacks returns the configured callbacks. +func (c Int64ObservableCounterConfig) Callbacks() []Int64Callback { + return c.callbacks +} + +// Int64ObservableCounterOption applies options to a +// [Int64ObservableCounterConfig]. See [Int64ObservableOption] and +// [InstrumentOption] for other options that can be used as an +// Int64ObservableCounterOption. +type Int64ObservableCounterOption interface { + applyInt64ObservableCounter(Int64ObservableCounterConfig) Int64ObservableCounterConfig +} + +// Int64ObservableUpDownCounter is an instrument used to asynchronously record +// int64 measurements once per collection cycle. Observations are only made +// within a callback for this instrument. The value observed is assumed the to +// be the cumulative sum of the count. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Int64ObservableUpDownCounter interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Int64ObservableUpDownCounter + + Int64Observable +} + +// Int64ObservableUpDownCounterConfig contains options for asynchronous counter +// instruments that record int64 values. +type Int64ObservableUpDownCounterConfig struct { + description string + unit string + callbacks []Int64Callback +} + +// NewInt64ObservableUpDownCounterConfig returns a new +// [Int64ObservableUpDownCounterConfig] with all opts applied. +func NewInt64ObservableUpDownCounterConfig(opts ...Int64ObservableUpDownCounterOption) Int64ObservableUpDownCounterConfig { + var config Int64ObservableUpDownCounterConfig + for _, o := range opts { + config = o.applyInt64ObservableUpDownCounter(config) + } + return config +} + +// Description returns the configured description. +func (c Int64ObservableUpDownCounterConfig) Description() string { + return c.description +} + +// Unit returns the configured unit. +func (c Int64ObservableUpDownCounterConfig) Unit() string { + return c.unit +} + +// Callbacks returns the configured callbacks. +func (c Int64ObservableUpDownCounterConfig) Callbacks() []Int64Callback { + return c.callbacks +} + +// Int64ObservableUpDownCounterOption applies options to a +// [Int64ObservableUpDownCounterConfig]. See [Int64ObservableOption] and +// [InstrumentOption] for other options that can be used as an +// Int64ObservableUpDownCounterOption. +type Int64ObservableUpDownCounterOption interface { + applyInt64ObservableUpDownCounter(Int64ObservableUpDownCounterConfig) Int64ObservableUpDownCounterConfig +} + +// Int64ObservableGauge is an instrument used to asynchronously record +// instantaneous int64 measurements once per collection cycle. Observations are +// only made within a callback for this instrument. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Int64ObservableGauge interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Int64ObservableGauge + + Int64Observable +} + +// Int64ObservableGaugeConfig contains options for asynchronous counter +// instruments that record int64 values. +type Int64ObservableGaugeConfig struct { + description string + unit string + callbacks []Int64Callback +} + +// NewInt64ObservableGaugeConfig returns a new [Int64ObservableGaugeConfig] +// with all opts applied. +func NewInt64ObservableGaugeConfig(opts ...Int64ObservableGaugeOption) Int64ObservableGaugeConfig { + var config Int64ObservableGaugeConfig + for _, o := range opts { + config = o.applyInt64ObservableGauge(config) + } + return config +} + +// Description returns the configured description. +func (c Int64ObservableGaugeConfig) Description() string { + return c.description +} + +// Unit returns the configured unit. +func (c Int64ObservableGaugeConfig) Unit() string { + return c.unit +} + +// Callbacks returns the configured callbacks. +func (c Int64ObservableGaugeConfig) Callbacks() []Int64Callback { + return c.callbacks +} + +// Int64ObservableGaugeOption applies options to a +// [Int64ObservableGaugeConfig]. See [Int64ObservableOption] and +// [InstrumentOption] for other options that can be used as an +// Int64ObservableGaugeOption. +type Int64ObservableGaugeOption interface { + applyInt64ObservableGauge(Int64ObservableGaugeConfig) Int64ObservableGaugeConfig +} + +// Int64Observer is a recorder of int64 measurements. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Int64Observer interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Int64Observer + + // Observe records the int64 value. + // + // Use the WithAttributeSet (or, if performance is not a concern, + // the WithAttributes) option to include measurement attributes. + Observe(value int64, options ...ObserveOption) +} + +// Int64Callback is a function registered with a Meter that makes observations +// for an Int64Observerable instrument it is registered with. Calls to the +// Int64Observer record measurement values for the Int64Observable. +// +// The function needs to complete in a finite amount of time and the deadline +// of the passed context is expected to be honored. +// +// The function needs to make unique observations across all registered +// Int64Callbacks. Meaning, it should not report measurements with the same +// attributes as another Int64Callbacks also registered for the same +// instrument. +// +// The function needs to be concurrent safe. +type Int64Callback func(context.Context, Int64Observer) error + +// Int64ObservableOption applies options to int64 Observer instruments. +type Int64ObservableOption interface { + Int64ObservableCounterOption + Int64ObservableUpDownCounterOption + Int64ObservableGaugeOption +} + +type int64CallbackOpt struct { + cback Int64Callback +} + +func (o int64CallbackOpt) applyInt64ObservableCounter(cfg Int64ObservableCounterConfig) Int64ObservableCounterConfig { + cfg.callbacks = append(cfg.callbacks, o.cback) + return cfg +} + +func (o int64CallbackOpt) applyInt64ObservableUpDownCounter(cfg Int64ObservableUpDownCounterConfig) Int64ObservableUpDownCounterConfig { + cfg.callbacks = append(cfg.callbacks, o.cback) + return cfg +} + +func (o int64CallbackOpt) applyInt64ObservableGauge(cfg Int64ObservableGaugeConfig) Int64ObservableGaugeConfig { + cfg.callbacks = append(cfg.callbacks, o.cback) + return cfg +} + +// WithInt64Callback adds callback to be called for an instrument. +func WithInt64Callback(callback Int64Callback) Int64ObservableOption { + return int64CallbackOpt{callback} +} diff --git a/vendor/go.opentelemetry.io/otel/metric/config.go b/vendor/go.opentelemetry.io/otel/metric/config.go new file mode 100644 index 0000000000..778ad2d748 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/metric/config.go @@ -0,0 +1,92 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package metric // import "go.opentelemetry.io/otel/metric" + +import "go.opentelemetry.io/otel/attribute" + +// MeterConfig contains options for Meters. +type MeterConfig struct { + instrumentationVersion string + schemaURL string + attrs attribute.Set + + // Ensure forward compatibility by explicitly making this not comparable. + noCmp [0]func() //nolint: unused // This is indeed used. +} + +// InstrumentationVersion returns the version of the library providing +// instrumentation. +func (cfg MeterConfig) InstrumentationVersion() string { + return cfg.instrumentationVersion +} + +// InstrumentationAttributes returns the attributes associated with the library +// providing instrumentation. +func (cfg MeterConfig) InstrumentationAttributes() attribute.Set { + return cfg.attrs +} + +// SchemaURL is the schema_url of the library providing instrumentation. +func (cfg MeterConfig) SchemaURL() string { + return cfg.schemaURL +} + +// MeterOption is an interface for applying Meter options. +type MeterOption interface { + // applyMeter is used to set a MeterOption value of a MeterConfig. + applyMeter(MeterConfig) MeterConfig +} + +// NewMeterConfig creates a new MeterConfig and applies +// all the given options. +func NewMeterConfig(opts ...MeterOption) MeterConfig { + var config MeterConfig + for _, o := range opts { + config = o.applyMeter(config) + } + return config +} + +type meterOptionFunc func(MeterConfig) MeterConfig + +func (fn meterOptionFunc) applyMeter(cfg MeterConfig) MeterConfig { + return fn(cfg) +} + +// WithInstrumentationVersion sets the instrumentation version. +func WithInstrumentationVersion(version string) MeterOption { + return meterOptionFunc(func(config MeterConfig) MeterConfig { + config.instrumentationVersion = version + return config + }) +} + +// WithInstrumentationAttributes sets the instrumentation attributes. +// +// The passed attributes will be de-duplicated. +func WithInstrumentationAttributes(attr ...attribute.KeyValue) MeterOption { + return meterOptionFunc(func(config MeterConfig) MeterConfig { + config.attrs = attribute.NewSet(attr...) + return config + }) +} + +// WithSchemaURL sets the schema URL. +func WithSchemaURL(schemaURL string) MeterOption { + return meterOptionFunc(func(config MeterConfig) MeterConfig { + config.schemaURL = schemaURL + return config + }) +} diff --git a/vendor/go.opentelemetry.io/otel/metric/doc.go b/vendor/go.opentelemetry.io/otel/metric/doc.go new file mode 100644 index 0000000000..ae24e448d9 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/metric/doc.go @@ -0,0 +1,170 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +/* +Package metric provides the OpenTelemetry API used to measure metrics about +source code operation. + +This API is separate from its implementation so the instrumentation built from +it is reusable. See [go.opentelemetry.io/otel/sdk/metric] for the official +OpenTelemetry implementation of this API. + +All measurements made with this package are made via instruments. These +instruments are created by a [Meter] which itself is created by a +[MeterProvider]. Applications need to accept a [MeterProvider] implementation +as a starting point when instrumenting. This can be done directly, or by using +the OpenTelemetry global MeterProvider via [GetMeterProvider]. Using an +appropriately named [Meter] from the accepted [MeterProvider], instrumentation +can then be built from the [Meter]'s instruments. + +# Instruments + +Each instrument is designed to make measurements of a particular type. Broadly, +all instruments fall into two overlapping logical categories: asynchronous or +synchronous, and int64 or float64. + +All synchronous instruments ([Int64Counter], [Int64UpDownCounter], +[Int64Histogram], [Float64Counter], [Float64UpDownCounter], and +[Float64Histogram]) are used to measure the operation and performance of source +code during the source code execution. These instruments only make measurements +when the source code they instrument is run. + +All asynchronous instruments ([Int64ObservableCounter], +[Int64ObservableUpDownCounter], [Int64ObservableGauge], +[Float64ObservableCounter], [Float64ObservableUpDownCounter], and +[Float64ObservableGauge]) are used to measure metrics outside of the execution +of source code. They are said to make "observations" via a callback function +called once every measurement collection cycle. + +Each instrument is also grouped by the value type it measures. Either int64 or +float64. The value being measured will dictate which instrument in these +categories to use. + +Outside of these two broad categories, instruments are described by the +function they are designed to serve. All Counters ([Int64Counter], +[Float64Counter], [Int64ObservableCounter], and [Float64ObservableCounter]) are +designed to measure values that never decrease in value, but instead only +incrementally increase in value. UpDownCounters ([Int64UpDownCounter], +[Float64UpDownCounter], [Int64ObservableUpDownCounter], and +[Float64ObservableUpDownCounter]) on the other hand, are designed to measure +values that can increase and decrease. When more information needs to be +conveyed about all the synchronous measurements made during a collection cycle, +a Histogram ([Int64Histogram] and [Float64Histogram]) should be used. Finally, +when just the most recent measurement needs to be conveyed about an +asynchronous measurement, a Gauge ([Int64ObservableGauge] and +[Float64ObservableGauge]) should be used. + +See the [OpenTelemetry documentation] for more information about instruments +and their intended use. + +# Measurements + +Measurements are made by recording values and information about the values with +an instrument. How these measurements are recorded depends on the instrument. + +Measurements for synchronous instruments ([Int64Counter], [Int64UpDownCounter], +[Int64Histogram], [Float64Counter], [Float64UpDownCounter], and +[Float64Histogram]) are recorded using the instrument methods directly. All +counter instruments have an Add method that is used to measure an increment +value, and all histogram instruments have a Record method to measure a data +point. + +Asynchronous instruments ([Int64ObservableCounter], +[Int64ObservableUpDownCounter], [Int64ObservableGauge], +[Float64ObservableCounter], [Float64ObservableUpDownCounter], and +[Float64ObservableGauge]) record measurements within a callback function. The +callback is registered with the Meter which ensures the callback is called once +per collection cycle. A callback can be registered two ways: during the +instrument's creation using an option, or later using the RegisterCallback +method of the [Meter] that created the instrument. + +If the following criteria are met, an option ([WithInt64Callback] or +[WithFloat64Callback]) can be used during the asynchronous instrument's +creation to register a callback ([Int64Callback] or [Float64Callback], +respectively): + + - The measurement process is known when the instrument is created + - Only that instrument will make a measurement within the callback + - The callback never needs to be unregistered + +If the criteria are not met, use the RegisterCallback method of the [Meter] that +created the instrument to register a [Callback]. + +# API Implementations + +This package does not conform to the standard Go versioning policy, all of its +interfaces may have methods added to them without a package major version bump. +This non-standard API evolution could surprise an uninformed implementation +author. They could unknowingly build their implementation in a way that would +result in a runtime panic for their users that update to the new API. + +The API is designed to help inform an instrumentation author about this +non-standard API evolution. It requires them to choose a default behavior for +unimplemented interface methods. There are three behavior choices they can +make: + + - Compilation failure + - Panic + - Default to another implementation + +All interfaces in this API embed a corresponding interface from +[go.opentelemetry.io/otel/metric/embedded]. If an author wants the default +behavior of their implementations to be a compilation failure, signaling to +their users they need to update to the latest version of that implementation, +they need to embed the corresponding interface from +[go.opentelemetry.io/otel/metric/embedded] in their implementation. For +example, + + import "go.opentelemetry.io/otel/metric/embedded" + + type MeterProvider struct { + embedded.MeterProvider + // ... + } + +If an author wants the default behavior of their implementations to a panic, +they need to embed the API interface directly. + + import "go.opentelemetry.io/otel/metric" + + type MeterProvider struct { + metric.MeterProvider + // ... + } + +This is not a recommended behavior as it could lead to publishing packages that +contain runtime panics when users update other package that use newer versions +of [go.opentelemetry.io/otel/metric]. + +Finally, an author can embed another implementation in theirs. The embedded +implementation will be used for methods not defined by the author. For example, +an author who want to default to silently dropping the call can use +[go.opentelemetry.io/otel/metric/noop]: + + import "go.opentelemetry.io/otel/metric/noop" + + type MeterProvider struct { + noop.MeterProvider + // ... + } + +It is strongly recommended that authors only embed +[go.opentelemetry.io/otel/metric/noop] if they choose this default behavior. +That implementation is the only one OpenTelemetry authors can guarantee will +fully implement all the API interfaces when a user updates their API. + +[OpenTelemetry documentation]: https://opentelemetry.io/docs/concepts/signals/metrics/ +[GetMeterProvider]: https://pkg.go.dev/go.opentelemetry.io/otel#GetMeterProvider +*/ +package metric // import "go.opentelemetry.io/otel/metric" diff --git a/vendor/go.opentelemetry.io/otel/metric/embedded/embedded.go b/vendor/go.opentelemetry.io/otel/metric/embedded/embedded.go new file mode 100644 index 0000000000..ae0bdbd2e6 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/metric/embedded/embedded.go @@ -0,0 +1,234 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +// Package embedded provides interfaces embedded within the [OpenTelemetry +// metric API]. +// +// Implementers of the [OpenTelemetry metric API] can embed the relevant type +// from this package into their implementation directly. Doing so will result +// in a compilation error for users when the [OpenTelemetry metric API] is +// extended (which is something that can happen without a major version bump of +// the API package). +// +// [OpenTelemetry metric API]: https://pkg.go.dev/go.opentelemetry.io/otel/metric +package embedded // import "go.opentelemetry.io/otel/metric/embedded" + +// MeterProvider is embedded in +// [go.opentelemetry.io/otel/metric.MeterProvider]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.MeterProvider] if you want users to +// experience a compilation error, signaling they need to update to your latest +// implementation, when the [go.opentelemetry.io/otel/metric.MeterProvider] +// interface is extended (which is something that can happen without a major +// version bump of the API package). +type MeterProvider interface{ meterProvider() } + +// Meter is embedded in [go.opentelemetry.io/otel/metric.Meter]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Meter] if you want users to experience a +// compilation error, signaling they need to update to your latest +// implementation, when the [go.opentelemetry.io/otel/metric.Meter] interface +// is extended (which is something that can happen without a major version bump +// of the API package). +type Meter interface{ meter() } + +// Float64Observer is embedded in +// [go.opentelemetry.io/otel/metric.Float64Observer]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Float64Observer] if you want +// users to experience a compilation error, signaling they need to update to +// your latest implementation, when the +// [go.opentelemetry.io/otel/metric.Float64Observer] interface is +// extended (which is something that can happen without a major version bump of +// the API package). +type Float64Observer interface{ float64Observer() } + +// Int64Observer is embedded in +// [go.opentelemetry.io/otel/metric.Int64Observer]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Int64Observer] if you want users +// to experience a compilation error, signaling they need to update to your +// latest implementation, when the +// [go.opentelemetry.io/otel/metric.Int64Observer] interface is +// extended (which is something that can happen without a major version bump of +// the API package). +type Int64Observer interface{ int64Observer() } + +// Observer is embedded in [go.opentelemetry.io/otel/metric.Observer]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Observer] if you want users to experience a +// compilation error, signaling they need to update to your latest +// implementation, when the [go.opentelemetry.io/otel/metric.Observer] +// interface is extended (which is something that can happen without a major +// version bump of the API package). +type Observer interface{ observer() } + +// Registration is embedded in [go.opentelemetry.io/otel/metric.Registration]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Registration] if you want users to +// experience a compilation error, signaling they need to update to your latest +// implementation, when the [go.opentelemetry.io/otel/metric.Registration] +// interface is extended (which is something that can happen without a major +// version bump of the API package). +type Registration interface{ registration() } + +// Float64Counter is embedded in +// [go.opentelemetry.io/otel/metric.Float64Counter]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Float64Counter] if you want +// users to experience a compilation error, signaling they need to update to +// your latest implementation, when the +// [go.opentelemetry.io/otel/metric.Float64Counter] interface is +// extended (which is something that can happen without a major version bump of +// the API package). +type Float64Counter interface{ float64Counter() } + +// Float64Histogram is embedded in +// [go.opentelemetry.io/otel/metric.Float64Histogram]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Float64Histogram] if you want +// users to experience a compilation error, signaling they need to update to +// your latest implementation, when the +// [go.opentelemetry.io/otel/metric.Float64Histogram] interface is +// extended (which is something that can happen without a major version bump of +// the API package). +type Float64Histogram interface{ float64Histogram() } + +// Float64ObservableCounter is embedded in +// [go.opentelemetry.io/otel/metric.Float64ObservableCounter]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Float64ObservableCounter] if you +// want users to experience a compilation error, signaling they need to update +// to your latest implementation, when the +// [go.opentelemetry.io/otel/metric.Float64ObservableCounter] +// interface is extended (which is something that can happen without a major +// version bump of the API package). +type Float64ObservableCounter interface{ float64ObservableCounter() } + +// Float64ObservableGauge is embedded in +// [go.opentelemetry.io/otel/metric.Float64ObservableGauge]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Float64ObservableGauge] if you +// want users to experience a compilation error, signaling they need to update +// to your latest implementation, when the +// [go.opentelemetry.io/otel/metric.Float64ObservableGauge] +// interface is extended (which is something that can happen without a major +// version bump of the API package). +type Float64ObservableGauge interface{ float64ObservableGauge() } + +// Float64ObservableUpDownCounter is embedded in +// [go.opentelemetry.io/otel/metric.Float64ObservableUpDownCounter]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Float64ObservableUpDownCounter] +// if you want users to experience a compilation error, signaling they need to +// update to your latest implementation, when the +// [go.opentelemetry.io/otel/metric.Float64ObservableUpDownCounter] +// interface is extended (which is something that can happen without a major +// version bump of the API package). +type Float64ObservableUpDownCounter interface{ float64ObservableUpDownCounter() } + +// Float64UpDownCounter is embedded in +// [go.opentelemetry.io/otel/metric.Float64UpDownCounter]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Float64UpDownCounter] if you +// want users to experience a compilation error, signaling they need to update +// to your latest implementation, when the +// [go.opentelemetry.io/otel/metric.Float64UpDownCounter] interface +// is extended (which is something that can happen without a major version bump +// of the API package). +type Float64UpDownCounter interface{ float64UpDownCounter() } + +// Int64Counter is embedded in +// [go.opentelemetry.io/otel/metric.Int64Counter]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Int64Counter] if you want users +// to experience a compilation error, signaling they need to update to your +// latest implementation, when the +// [go.opentelemetry.io/otel/metric.Int64Counter] interface is +// extended (which is something that can happen without a major version bump of +// the API package). +type Int64Counter interface{ int64Counter() } + +// Int64Histogram is embedded in +// [go.opentelemetry.io/otel/metric.Int64Histogram]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Int64Histogram] if you want +// users to experience a compilation error, signaling they need to update to +// your latest implementation, when the +// [go.opentelemetry.io/otel/metric.Int64Histogram] interface is +// extended (which is something that can happen without a major version bump of +// the API package). +type Int64Histogram interface{ int64Histogram() } + +// Int64ObservableCounter is embedded in +// [go.opentelemetry.io/otel/metric.Int64ObservableCounter]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Int64ObservableCounter] if you +// want users to experience a compilation error, signaling they need to update +// to your latest implementation, when the +// [go.opentelemetry.io/otel/metric.Int64ObservableCounter] +// interface is extended (which is something that can happen without a major +// version bump of the API package). +type Int64ObservableCounter interface{ int64ObservableCounter() } + +// Int64ObservableGauge is embedded in +// [go.opentelemetry.io/otel/metric.Int64ObservableGauge]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Int64ObservableGauge] if you +// want users to experience a compilation error, signaling they need to update +// to your latest implementation, when the +// [go.opentelemetry.io/otel/metric.Int64ObservableGauge] interface +// is extended (which is something that can happen without a major version bump +// of the API package). +type Int64ObservableGauge interface{ int64ObservableGauge() } + +// Int64ObservableUpDownCounter is embedded in +// [go.opentelemetry.io/otel/metric.Int64ObservableUpDownCounter]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Int64ObservableUpDownCounter] if +// you want users to experience a compilation error, signaling they need to +// update to your latest implementation, when the +// [go.opentelemetry.io/otel/metric.Int64ObservableUpDownCounter] +// interface is extended (which is something that can happen without a major +// version bump of the API package). +type Int64ObservableUpDownCounter interface{ int64ObservableUpDownCounter() } + +// Int64UpDownCounter is embedded in +// [go.opentelemetry.io/otel/metric.Int64UpDownCounter]. +// +// Embed this interface in your implementation of the +// [go.opentelemetry.io/otel/metric.Int64UpDownCounter] if you want +// users to experience a compilation error, signaling they need to update to +// your latest implementation, when the +// [go.opentelemetry.io/otel/metric.Int64UpDownCounter] interface is +// extended (which is something that can happen without a major version bump of +// the API package). +type Int64UpDownCounter interface{ int64UpDownCounter() } diff --git a/vendor/go.opentelemetry.io/otel/metric/instrument.go b/vendor/go.opentelemetry.io/otel/metric/instrument.go new file mode 100644 index 0000000000..0033c1e12d --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/metric/instrument.go @@ -0,0 +1,332 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package metric // import "go.opentelemetry.io/otel/metric" + +import "go.opentelemetry.io/otel/attribute" + +// Observable is used as a grouping mechanism for all instruments that are +// updated within a Callback. +type Observable interface { + observable() +} + +// InstrumentOption applies options to all instruments. +type InstrumentOption interface { + Int64CounterOption + Int64UpDownCounterOption + Int64HistogramOption + Int64ObservableCounterOption + Int64ObservableUpDownCounterOption + Int64ObservableGaugeOption + + Float64CounterOption + Float64UpDownCounterOption + Float64HistogramOption + Float64ObservableCounterOption + Float64ObservableUpDownCounterOption + Float64ObservableGaugeOption +} + +type descOpt string + +func (o descOpt) applyFloat64Counter(c Float64CounterConfig) Float64CounterConfig { + c.description = string(o) + return c +} + +func (o descOpt) applyFloat64UpDownCounter(c Float64UpDownCounterConfig) Float64UpDownCounterConfig { + c.description = string(o) + return c +} + +func (o descOpt) applyFloat64Histogram(c Float64HistogramConfig) Float64HistogramConfig { + c.description = string(o) + return c +} + +func (o descOpt) applyFloat64ObservableCounter(c Float64ObservableCounterConfig) Float64ObservableCounterConfig { + c.description = string(o) + return c +} + +func (o descOpt) applyFloat64ObservableUpDownCounter(c Float64ObservableUpDownCounterConfig) Float64ObservableUpDownCounterConfig { + c.description = string(o) + return c +} + +func (o descOpt) applyFloat64ObservableGauge(c Float64ObservableGaugeConfig) Float64ObservableGaugeConfig { + c.description = string(o) + return c +} + +func (o descOpt) applyInt64Counter(c Int64CounterConfig) Int64CounterConfig { + c.description = string(o) + return c +} + +func (o descOpt) applyInt64UpDownCounter(c Int64UpDownCounterConfig) Int64UpDownCounterConfig { + c.description = string(o) + return c +} + +func (o descOpt) applyInt64Histogram(c Int64HistogramConfig) Int64HistogramConfig { + c.description = string(o) + return c +} + +func (o descOpt) applyInt64ObservableCounter(c Int64ObservableCounterConfig) Int64ObservableCounterConfig { + c.description = string(o) + return c +} + +func (o descOpt) applyInt64ObservableUpDownCounter(c Int64ObservableUpDownCounterConfig) Int64ObservableUpDownCounterConfig { + c.description = string(o) + return c +} + +func (o descOpt) applyInt64ObservableGauge(c Int64ObservableGaugeConfig) Int64ObservableGaugeConfig { + c.description = string(o) + return c +} + +// WithDescription sets the instrument description. +func WithDescription(desc string) InstrumentOption { return descOpt(desc) } + +type unitOpt string + +func (o unitOpt) applyFloat64Counter(c Float64CounterConfig) Float64CounterConfig { + c.unit = string(o) + return c +} + +func (o unitOpt) applyFloat64UpDownCounter(c Float64UpDownCounterConfig) Float64UpDownCounterConfig { + c.unit = string(o) + return c +} + +func (o unitOpt) applyFloat64Histogram(c Float64HistogramConfig) Float64HistogramConfig { + c.unit = string(o) + return c +} + +func (o unitOpt) applyFloat64ObservableCounter(c Float64ObservableCounterConfig) Float64ObservableCounterConfig { + c.unit = string(o) + return c +} + +func (o unitOpt) applyFloat64ObservableUpDownCounter(c Float64ObservableUpDownCounterConfig) Float64ObservableUpDownCounterConfig { + c.unit = string(o) + return c +} + +func (o unitOpt) applyFloat64ObservableGauge(c Float64ObservableGaugeConfig) Float64ObservableGaugeConfig { + c.unit = string(o) + return c +} + +func (o unitOpt) applyInt64Counter(c Int64CounterConfig) Int64CounterConfig { + c.unit = string(o) + return c +} + +func (o unitOpt) applyInt64UpDownCounter(c Int64UpDownCounterConfig) Int64UpDownCounterConfig { + c.unit = string(o) + return c +} + +func (o unitOpt) applyInt64Histogram(c Int64HistogramConfig) Int64HistogramConfig { + c.unit = string(o) + return c +} + +func (o unitOpt) applyInt64ObservableCounter(c Int64ObservableCounterConfig) Int64ObservableCounterConfig { + c.unit = string(o) + return c +} + +func (o unitOpt) applyInt64ObservableUpDownCounter(c Int64ObservableUpDownCounterConfig) Int64ObservableUpDownCounterConfig { + c.unit = string(o) + return c +} + +func (o unitOpt) applyInt64ObservableGauge(c Int64ObservableGaugeConfig) Int64ObservableGaugeConfig { + c.unit = string(o) + return c +} + +// WithUnit sets the instrument unit. +func WithUnit(u string) InstrumentOption { return unitOpt(u) } + +// AddOption applies options to an addition measurement. See +// [MeasurementOption] for other options that can be used as an AddOption. +type AddOption interface { + applyAdd(AddConfig) AddConfig +} + +// AddConfig contains options for an addition measurement. +type AddConfig struct { + attrs attribute.Set +} + +// NewAddConfig returns a new [AddConfig] with all opts applied. +func NewAddConfig(opts []AddOption) AddConfig { + config := AddConfig{attrs: *attribute.EmptySet()} + for _, o := range opts { + config = o.applyAdd(config) + } + return config +} + +// Attributes returns the configured attribute set. +func (c AddConfig) Attributes() attribute.Set { + return c.attrs +} + +// RecordOption applies options to an addition measurement. See +// [MeasurementOption] for other options that can be used as a RecordOption. +type RecordOption interface { + applyRecord(RecordConfig) RecordConfig +} + +// RecordConfig contains options for a recorded measurement. +type RecordConfig struct { + attrs attribute.Set +} + +// NewRecordConfig returns a new [RecordConfig] with all opts applied. +func NewRecordConfig(opts []RecordOption) RecordConfig { + config := RecordConfig{attrs: *attribute.EmptySet()} + for _, o := range opts { + config = o.applyRecord(config) + } + return config +} + +// Attributes returns the configured attribute set. +func (c RecordConfig) Attributes() attribute.Set { + return c.attrs +} + +// ObserveOption applies options to an addition measurement. See +// [MeasurementOption] for other options that can be used as a ObserveOption. +type ObserveOption interface { + applyObserve(ObserveConfig) ObserveConfig +} + +// ObserveConfig contains options for an observed measurement. +type ObserveConfig struct { + attrs attribute.Set +} + +// NewObserveConfig returns a new [ObserveConfig] with all opts applied. +func NewObserveConfig(opts []ObserveOption) ObserveConfig { + config := ObserveConfig{attrs: *attribute.EmptySet()} + for _, o := range opts { + config = o.applyObserve(config) + } + return config +} + +// Attributes returns the configured attribute set. +func (c ObserveConfig) Attributes() attribute.Set { + return c.attrs +} + +// MeasurementOption applies options to all instrument measurement. +type MeasurementOption interface { + AddOption + RecordOption + ObserveOption +} + +type attrOpt struct { + set attribute.Set +} + +// mergeSets returns the union of keys between a and b. Any duplicate keys will +// use the value associated with b. +func mergeSets(a, b attribute.Set) attribute.Set { + // NewMergeIterator uses the first value for any duplicates. + iter := attribute.NewMergeIterator(&b, &a) + merged := make([]attribute.KeyValue, 0, a.Len()+b.Len()) + for iter.Next() { + merged = append(merged, iter.Attribute()) + } + return attribute.NewSet(merged...) +} + +func (o attrOpt) applyAdd(c AddConfig) AddConfig { + switch { + case o.set.Len() == 0: + case c.attrs.Len() == 0: + c.attrs = o.set + default: + c.attrs = mergeSets(c.attrs, o.set) + } + return c +} + +func (o attrOpt) applyRecord(c RecordConfig) RecordConfig { + switch { + case o.set.Len() == 0: + case c.attrs.Len() == 0: + c.attrs = o.set + default: + c.attrs = mergeSets(c.attrs, o.set) + } + return c +} + +func (o attrOpt) applyObserve(c ObserveConfig) ObserveConfig { + switch { + case o.set.Len() == 0: + case c.attrs.Len() == 0: + c.attrs = o.set + default: + c.attrs = mergeSets(c.attrs, o.set) + } + return c +} + +// WithAttributeSet sets the attribute Set associated with a measurement is +// made with. +// +// If multiple WithAttributeSet or WithAttributes options are passed the +// attributes will be merged together in the order they are passed. Attributes +// with duplicate keys will use the last value passed. +func WithAttributeSet(attributes attribute.Set) MeasurementOption { + return attrOpt{set: attributes} +} + +// WithAttributes converts attributes into an attribute Set and sets the Set to +// be associated with a measurement. This is shorthand for: +// +// cp := make([]attribute.KeyValue, len(attributes)) +// copy(cp, attributes) +// WithAttributes(attribute.NewSet(cp...)) +// +// [attribute.NewSet] may modify the passed attributes so this will make a copy +// of attributes before creating a set in order to ensure this function is +// concurrent safe. This makes this option function less optimized in +// comparison to [WithAttributeSet]. Therefore, [WithAttributeSet] should be +// preferred for performance sensitive code. +// +// See [WithAttributeSet] for information about how multiple WithAttributes are +// merged. +func WithAttributes(attributes ...attribute.KeyValue) MeasurementOption { + cp := make([]attribute.KeyValue, len(attributes)) + copy(cp, attributes) + return attrOpt{set: attribute.NewSet(cp...)} +} diff --git a/vendor/go.opentelemetry.io/otel/metric/meter.go b/vendor/go.opentelemetry.io/otel/metric/meter.go new file mode 100644 index 0000000000..8e1917c321 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/metric/meter.go @@ -0,0 +1,210 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package metric // import "go.opentelemetry.io/otel/metric" + +import ( + "context" + + "go.opentelemetry.io/otel/metric/embedded" +) + +// MeterProvider provides access to named Meter instances, for instrumenting +// an application or package. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type MeterProvider interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.MeterProvider + + // Meter returns a new Meter with the provided name and configuration. + // + // A Meter should be scoped at most to a single package. The name needs to + // be unique so it does not collide with other names used by + // an application, nor other applications. To achieve this, the import path + // of the instrumentation package is recommended to be used as name. + // + // If the name is empty, then an implementation defined default name will + // be used instead. + Meter(name string, opts ...MeterOption) Meter +} + +// Meter provides access to instrument instances for recording metrics. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Meter interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Meter + + // Int64Counter returns a new Int64Counter instrument identified by name + // and configured with options. The instrument is used to synchronously + // record increasing int64 measurements during a computational operation. + Int64Counter(name string, options ...Int64CounterOption) (Int64Counter, error) + // Int64UpDownCounter returns a new Int64UpDownCounter instrument + // identified by name and configured with options. The instrument is used + // to synchronously record int64 measurements during a computational + // operation. + Int64UpDownCounter(name string, options ...Int64UpDownCounterOption) (Int64UpDownCounter, error) + // Int64Histogram returns a new Int64Histogram instrument identified by + // name and configured with options. The instrument is used to + // synchronously record the distribution of int64 measurements during a + // computational operation. + Int64Histogram(name string, options ...Int64HistogramOption) (Int64Histogram, error) + // Int64ObservableCounter returns a new Int64ObservableCounter identified + // by name and configured with options. The instrument is used to + // asynchronously record increasing int64 measurements once per a + // measurement collection cycle. + // + // Measurements for the returned instrument are made via a callback. Use + // the WithInt64Callback option to register the callback here, or use the + // RegisterCallback method of this Meter to register one later. See the + // Measurements section of the package documentation for more information. + Int64ObservableCounter(name string, options ...Int64ObservableCounterOption) (Int64ObservableCounter, error) + // Int64ObservableUpDownCounter returns a new Int64ObservableUpDownCounter + // instrument identified by name and configured with options. The + // instrument is used to asynchronously record int64 measurements once per + // a measurement collection cycle. + // + // Measurements for the returned instrument are made via a callback. Use + // the WithInt64Callback option to register the callback here, or use the + // RegisterCallback method of this Meter to register one later. See the + // Measurements section of the package documentation for more information. + Int64ObservableUpDownCounter(name string, options ...Int64ObservableUpDownCounterOption) (Int64ObservableUpDownCounter, error) + // Int64ObservableGauge returns a new Int64ObservableGauge instrument + // identified by name and configured with options. The instrument is used + // to asynchronously record instantaneous int64 measurements once per a + // measurement collection cycle. + // + // Measurements for the returned instrument are made via a callback. Use + // the WithInt64Callback option to register the callback here, or use the + // RegisterCallback method of this Meter to register one later. See the + // Measurements section of the package documentation for more information. + Int64ObservableGauge(name string, options ...Int64ObservableGaugeOption) (Int64ObservableGauge, error) + + // Float64Counter returns a new Float64Counter instrument identified by + // name and configured with options. The instrument is used to + // synchronously record increasing float64 measurements during a + // computational operation. + Float64Counter(name string, options ...Float64CounterOption) (Float64Counter, error) + // Float64UpDownCounter returns a new Float64UpDownCounter instrument + // identified by name and configured with options. The instrument is used + // to synchronously record float64 measurements during a computational + // operation. + Float64UpDownCounter(name string, options ...Float64UpDownCounterOption) (Float64UpDownCounter, error) + // Float64Histogram returns a new Float64Histogram instrument identified by + // name and configured with options. The instrument is used to + // synchronously record the distribution of float64 measurements during a + // computational operation. + Float64Histogram(name string, options ...Float64HistogramOption) (Float64Histogram, error) + // Float64ObservableCounter returns a new Float64ObservableCounter + // instrument identified by name and configured with options. The + // instrument is used to asynchronously record increasing float64 + // measurements once per a measurement collection cycle. + // + // Measurements for the returned instrument are made via a callback. Use + // the WithFloat64Callback option to register the callback here, or use the + // RegisterCallback method of this Meter to register one later. See the + // Measurements section of the package documentation for more information. + Float64ObservableCounter(name string, options ...Float64ObservableCounterOption) (Float64ObservableCounter, error) + // Float64ObservableUpDownCounter returns a new + // Float64ObservableUpDownCounter instrument identified by name and + // configured with options. The instrument is used to asynchronously record + // float64 measurements once per a measurement collection cycle. + // + // Measurements for the returned instrument are made via a callback. Use + // the WithFloat64Callback option to register the callback here, or use the + // RegisterCallback method of this Meter to register one later. See the + // Measurements section of the package documentation for more information. + Float64ObservableUpDownCounter(name string, options ...Float64ObservableUpDownCounterOption) (Float64ObservableUpDownCounter, error) + // Float64ObservableGauge returns a new Float64ObservableGauge instrument + // identified by name and configured with options. The instrument is used + // to asynchronously record instantaneous float64 measurements once per a + // measurement collection cycle. + // + // Measurements for the returned instrument are made via a callback. Use + // the WithFloat64Callback option to register the callback here, or use the + // RegisterCallback method of this Meter to register one later. See the + // Measurements section of the package documentation for more information. + Float64ObservableGauge(name string, options ...Float64ObservableGaugeOption) (Float64ObservableGauge, error) + + // RegisterCallback registers f to be called during the collection of a + // measurement cycle. + // + // If Unregister of the returned Registration is called, f needs to be + // unregistered and not called during collection. + // + // The instruments f is registered with are the only instruments that f may + // observe values for. + // + // If no instruments are passed, f should not be registered nor called + // during collection. + RegisterCallback(f Callback, instruments ...Observable) (Registration, error) +} + +// Callback is a function registered with a Meter that makes observations for +// the set of instruments it is registered with. The Observer parameter is used +// to record measurement observations for these instruments. +// +// The function needs to complete in a finite amount of time and the deadline +// of the passed context is expected to be honored. +// +// The function needs to make unique observations across all registered +// Callbacks. Meaning, it should not report measurements for an instrument with +// the same attributes as another Callback will report. +// +// The function needs to be concurrent safe. +type Callback func(context.Context, Observer) error + +// Observer records measurements for multiple instruments in a Callback. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Observer interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Observer + + // ObserveFloat64 records the float64 value for obsrv. + ObserveFloat64(obsrv Float64Observable, value float64, opts ...ObserveOption) + // ObserveInt64 records the int64 value for obsrv. + ObserveInt64(obsrv Int64Observable, value int64, opts ...ObserveOption) +} + +// Registration is an token representing the unique registration of a callback +// for a set of instruments with a Meter. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Registration interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Registration + + // Unregister removes the callback registration from a Meter. + // + // This method needs to be idempotent and concurrent safe. + Unregister() error +} diff --git a/vendor/go.opentelemetry.io/otel/metric/syncfloat64.go b/vendor/go.opentelemetry.io/otel/metric/syncfloat64.go new file mode 100644 index 0000000000..f0b063721d --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/metric/syncfloat64.go @@ -0,0 +1,179 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package metric // import "go.opentelemetry.io/otel/metric" + +import ( + "context" + + "go.opentelemetry.io/otel/metric/embedded" +) + +// Float64Counter is an instrument that records increasing float64 values. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Float64Counter interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Float64Counter + + // Add records a change to the counter. + // + // Use the WithAttributeSet (or, if performance is not a concern, + // the WithAttributes) option to include measurement attributes. + Add(ctx context.Context, incr float64, options ...AddOption) +} + +// Float64CounterConfig contains options for synchronous counter instruments that +// record int64 values. +type Float64CounterConfig struct { + description string + unit string +} + +// NewFloat64CounterConfig returns a new [Float64CounterConfig] with all opts +// applied. +func NewFloat64CounterConfig(opts ...Float64CounterOption) Float64CounterConfig { + var config Float64CounterConfig + for _, o := range opts { + config = o.applyFloat64Counter(config) + } + return config +} + +// Description returns the configured description. +func (c Float64CounterConfig) Description() string { + return c.description +} + +// Unit returns the configured unit. +func (c Float64CounterConfig) Unit() string { + return c.unit +} + +// Float64CounterOption applies options to a [Float64CounterConfig]. See +// [InstrumentOption] for other options that can be used as a +// Float64CounterOption. +type Float64CounterOption interface { + applyFloat64Counter(Float64CounterConfig) Float64CounterConfig +} + +// Float64UpDownCounter is an instrument that records increasing or decreasing +// float64 values. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Float64UpDownCounter interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Float64UpDownCounter + + // Add records a change to the counter. + // + // Use the WithAttributeSet (or, if performance is not a concern, + // the WithAttributes) option to include measurement attributes. + Add(ctx context.Context, incr float64, options ...AddOption) +} + +// Float64UpDownCounterConfig contains options for synchronous counter +// instruments that record int64 values. +type Float64UpDownCounterConfig struct { + description string + unit string +} + +// NewFloat64UpDownCounterConfig returns a new [Float64UpDownCounterConfig] +// with all opts applied. +func NewFloat64UpDownCounterConfig(opts ...Float64UpDownCounterOption) Float64UpDownCounterConfig { + var config Float64UpDownCounterConfig + for _, o := range opts { + config = o.applyFloat64UpDownCounter(config) + } + return config +} + +// Description returns the configured description. +func (c Float64UpDownCounterConfig) Description() string { + return c.description +} + +// Unit returns the configured unit. +func (c Float64UpDownCounterConfig) Unit() string { + return c.unit +} + +// Float64UpDownCounterOption applies options to a +// [Float64UpDownCounterConfig]. See [InstrumentOption] for other options that +// can be used as a Float64UpDownCounterOption. +type Float64UpDownCounterOption interface { + applyFloat64UpDownCounter(Float64UpDownCounterConfig) Float64UpDownCounterConfig +} + +// Float64Histogram is an instrument that records a distribution of float64 +// values. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Float64Histogram interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Float64Histogram + + // Record adds an additional value to the distribution. + // + // Use the WithAttributeSet (or, if performance is not a concern, + // the WithAttributes) option to include measurement attributes. + Record(ctx context.Context, incr float64, options ...RecordOption) +} + +// Float64HistogramConfig contains options for synchronous counter instruments +// that record int64 values. +type Float64HistogramConfig struct { + description string + unit string +} + +// NewFloat64HistogramConfig returns a new [Float64HistogramConfig] with all +// opts applied. +func NewFloat64HistogramConfig(opts ...Float64HistogramOption) Float64HistogramConfig { + var config Float64HistogramConfig + for _, o := range opts { + config = o.applyFloat64Histogram(config) + } + return config +} + +// Description returns the configured description. +func (c Float64HistogramConfig) Description() string { + return c.description +} + +// Unit returns the configured unit. +func (c Float64HistogramConfig) Unit() string { + return c.unit +} + +// Float64HistogramOption applies options to a [Float64HistogramConfig]. See +// [InstrumentOption] for other options that can be used as a +// Float64HistogramOption. +type Float64HistogramOption interface { + applyFloat64Histogram(Float64HistogramConfig) Float64HistogramConfig +} diff --git a/vendor/go.opentelemetry.io/otel/metric/syncint64.go b/vendor/go.opentelemetry.io/otel/metric/syncint64.go new file mode 100644 index 0000000000..6f508eb66d --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/metric/syncint64.go @@ -0,0 +1,179 @@ +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package metric // import "go.opentelemetry.io/otel/metric" + +import ( + "context" + + "go.opentelemetry.io/otel/metric/embedded" +) + +// Int64Counter is an instrument that records increasing int64 values. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Int64Counter interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Int64Counter + + // Add records a change to the counter. + // + // Use the WithAttributeSet (or, if performance is not a concern, + // the WithAttributes) option to include measurement attributes. + Add(ctx context.Context, incr int64, options ...AddOption) +} + +// Int64CounterConfig contains options for synchronous counter instruments that +// record int64 values. +type Int64CounterConfig struct { + description string + unit string +} + +// NewInt64CounterConfig returns a new [Int64CounterConfig] with all opts +// applied. +func NewInt64CounterConfig(opts ...Int64CounterOption) Int64CounterConfig { + var config Int64CounterConfig + for _, o := range opts { + config = o.applyInt64Counter(config) + } + return config +} + +// Description returns the configured description. +func (c Int64CounterConfig) Description() string { + return c.description +} + +// Unit returns the configured unit. +func (c Int64CounterConfig) Unit() string { + return c.unit +} + +// Int64CounterOption applies options to a [Int64CounterConfig]. See +// [InstrumentOption] for other options that can be used as an +// Int64CounterOption. +type Int64CounterOption interface { + applyInt64Counter(Int64CounterConfig) Int64CounterConfig +} + +// Int64UpDownCounter is an instrument that records increasing or decreasing +// int64 values. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Int64UpDownCounter interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Int64UpDownCounter + + // Add records a change to the counter. + // + // Use the WithAttributeSet (or, if performance is not a concern, + // the WithAttributes) option to include measurement attributes. + Add(ctx context.Context, incr int64, options ...AddOption) +} + +// Int64UpDownCounterConfig contains options for synchronous counter +// instruments that record int64 values. +type Int64UpDownCounterConfig struct { + description string + unit string +} + +// NewInt64UpDownCounterConfig returns a new [Int64UpDownCounterConfig] with +// all opts applied. +func NewInt64UpDownCounterConfig(opts ...Int64UpDownCounterOption) Int64UpDownCounterConfig { + var config Int64UpDownCounterConfig + for _, o := range opts { + config = o.applyInt64UpDownCounter(config) + } + return config +} + +// Description returns the configured description. +func (c Int64UpDownCounterConfig) Description() string { + return c.description +} + +// Unit returns the configured unit. +func (c Int64UpDownCounterConfig) Unit() string { + return c.unit +} + +// Int64UpDownCounterOption applies options to a [Int64UpDownCounterConfig]. +// See [InstrumentOption] for other options that can be used as an +// Int64UpDownCounterOption. +type Int64UpDownCounterOption interface { + applyInt64UpDownCounter(Int64UpDownCounterConfig) Int64UpDownCounterConfig +} + +// Int64Histogram is an instrument that records a distribution of int64 +// values. +// +// Warning: Methods may be added to this interface in minor releases. See +// package documentation on API implementation for information on how to set +// default behavior for unimplemented methods. +type Int64Histogram interface { + // Users of the interface can ignore this. This embedded type is only used + // by implementations of this interface. See the "API Implementations" + // section of the package documentation for more information. + embedded.Int64Histogram + + // Record adds an additional value to the distribution. + // + // Use the WithAttributeSet (or, if performance is not a concern, + // the WithAttributes) option to include measurement attributes. + Record(ctx context.Context, incr int64, options ...RecordOption) +} + +// Int64HistogramConfig contains options for synchronous counter instruments +// that record int64 values. +type Int64HistogramConfig struct { + description string + unit string +} + +// NewInt64HistogramConfig returns a new [Int64HistogramConfig] with all opts +// applied. +func NewInt64HistogramConfig(opts ...Int64HistogramOption) Int64HistogramConfig { + var config Int64HistogramConfig + for _, o := range opts { + config = o.applyInt64Histogram(config) + } + return config +} + +// Description returns the configured description. +func (c Int64HistogramConfig) Description() string { + return c.description +} + +// Unit returns the configured unit. +func (c Int64HistogramConfig) Unit() string { + return c.unit +} + +// Int64HistogramOption applies options to a [Int64HistogramConfig]. See +// [InstrumentOption] for other options that can be used as an +// Int64HistogramOption. +type Int64HistogramOption interface { + applyInt64Histogram(Int64HistogramConfig) Int64HistogramConfig +} diff --git a/vendor/go.opentelemetry.io/otel/requirements.txt b/vendor/go.opentelemetry.io/otel/requirements.txt new file mode 100644 index 0000000000..407f17489c --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/requirements.txt @@ -0,0 +1 @@ +codespell==2.2.4 diff --git a/vendor/go.opentelemetry.io/otel/trace/config.go b/vendor/go.opentelemetry.io/otel/trace/config.go index f058cc781e..cb3efbb9ad 100644 --- a/vendor/go.opentelemetry.io/otel/trace/config.go +++ b/vendor/go.opentelemetry.io/otel/trace/config.go @@ -25,6 +25,7 @@ type TracerConfig struct { instrumentationVersion string // Schema URL of the telemetry emitted by the Tracer. schemaURL string + attrs attribute.Set } // InstrumentationVersion returns the version of the library providing instrumentation. @@ -32,6 +33,12 @@ func (t *TracerConfig) InstrumentationVersion() string { return t.instrumentationVersion } +// InstrumentationAttributes returns the attributes associated with the library +// providing instrumentation. +func (t *TracerConfig) InstrumentationAttributes() attribute.Set { + return t.attrs +} + // SchemaURL returns the Schema URL of the telemetry emitted by the Tracer. func (t *TracerConfig) SchemaURL() string { return t.schemaURL @@ -307,6 +314,16 @@ func WithInstrumentationVersion(version string) TracerOption { }) } +// WithInstrumentationAttributes sets the instrumentation attributes. +// +// The passed attributes will be de-duplicated. +func WithInstrumentationAttributes(attr ...attribute.KeyValue) TracerOption { + return tracerOptionFunc(func(config TracerConfig) TracerConfig { + config.attrs = attribute.NewSet(attr...) + return config + }) +} + // WithSchemaURL sets the schema URL for the Tracer. func WithSchemaURL(schemaURL string) TracerOption { return tracerOptionFunc(func(cfg TracerConfig) TracerConfig { diff --git a/vendor/go.opentelemetry.io/otel/trace/noop.go b/vendor/go.opentelemetry.io/otel/trace/noop.go index 73950f2077..7cf6c7f3ef 100644 --- a/vendor/go.opentelemetry.io/otel/trace/noop.go +++ b/vendor/go.opentelemetry.io/otel/trace/noop.go @@ -37,7 +37,7 @@ func (p noopTracerProvider) Tracer(string, ...TracerOption) Tracer { return noopTracer{} } -// noopTracer is an implementation of Tracer that preforms no operations. +// noopTracer is an implementation of Tracer that performs no operations. type noopTracer struct{} var _ Tracer = noopTracer{} @@ -53,7 +53,7 @@ func (t noopTracer) Start(ctx context.Context, name string, _ ...SpanStartOption return ContextWithSpan(ctx, span), span } -// noopSpan is an implementation of Span that preforms no operations. +// noopSpan is an implementation of Span that performs no operations. type noopSpan struct{} var _ Span = noopSpan{} diff --git a/vendor/go.opentelemetry.io/otel/version.go b/vendor/go.opentelemetry.io/otel/version.go index 00b79bcc25..c2217a28d6 100644 --- a/vendor/go.opentelemetry.io/otel/version.go +++ b/vendor/go.opentelemetry.io/otel/version.go @@ -16,5 +16,5 @@ package otel // import "go.opentelemetry.io/otel" // Version is the current release version of OpenTelemetry in use. func Version() string { - return "1.11.2" + return "1.16.0" } diff --git a/vendor/go.opentelemetry.io/otel/versions.yaml b/vendor/go.opentelemetry.io/otel/versions.yaml index 611879def4..9dc47532bc 100644 --- a/vendor/go.opentelemetry.io/otel/versions.yaml +++ b/vendor/go.opentelemetry.io/otel/versions.yaml @@ -14,10 +14,11 @@ module-sets: stable-v1: - version: v1.11.2 + version: v1.16.0 modules: - go.opentelemetry.io/otel - go.opentelemetry.io/otel/bridge/opentracing + - go.opentelemetry.io/otel/bridge/opentracing/test - go.opentelemetry.io/otel/example/fib - go.opentelemetry.io/otel/example/jaeger - go.opentelemetry.io/otel/example/namedtracer @@ -25,16 +26,17 @@ module-sets: - go.opentelemetry.io/otel/example/passthrough - go.opentelemetry.io/otel/example/zipkin - go.opentelemetry.io/otel/exporters/jaeger - - go.opentelemetry.io/otel/exporters/zipkin + - go.opentelemetry.io/otel/exporters/otlp/internal/retry - go.opentelemetry.io/otel/exporters/otlp/otlptrace - go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc - go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp - - go.opentelemetry.io/otel/exporters/otlp/internal/retry - go.opentelemetry.io/otel/exporters/stdout/stdouttrace - - go.opentelemetry.io/otel/trace + - go.opentelemetry.io/otel/exporters/zipkin + - go.opentelemetry.io/otel/metric - go.opentelemetry.io/otel/sdk + - go.opentelemetry.io/otel/trace experimental-metrics: - version: v0.34.0 + version: v0.39.0 modules: - go.opentelemetry.io/otel/example/opencensus - go.opentelemetry.io/otel/example/prometheus @@ -43,13 +45,12 @@ module-sets: - go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetrichttp - go.opentelemetry.io/otel/exporters/prometheus - go.opentelemetry.io/otel/exporters/stdout/stdoutmetric - - go.opentelemetry.io/otel/metric - go.opentelemetry.io/otel/sdk/metric - go.opentelemetry.io/otel/bridge/opencensus - go.opentelemetry.io/otel/bridge/opencensus/test - go.opentelemetry.io/otel/example/view experimental-schema: - version: v0.0.3 + version: v0.0.4 modules: - go.opentelemetry.io/otel/schema excluded-modules: diff --git a/vendor/go.uber.org/atomic/CHANGELOG.md b/vendor/go.uber.org/atomic/CHANGELOG.md index 5fe03f21bd..6f87f33fa9 100644 --- a/vendor/go.uber.org/atomic/CHANGELOG.md +++ b/vendor/go.uber.org/atomic/CHANGELOG.md @@ -4,6 +4,16 @@ All notable changes to this project will be documented in this file. The format is based on [Keep a Changelog](https://keepachangelog.com/en/1.0.0/), and this project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.html). +## [1.11.0] - 2023-05-02 +### Fixed +- Fix initialization of `Value` wrappers. + +### Added +- Add `String` method to `atomic.Pointer[T]` type allowing users to safely print +underlying values of pointers. + +[1.11.0]: https://github.com/uber-go/atomic/compare/v1.10.0...v1.11.0 + ## [1.10.0] - 2022-08-11 ### Added - Add `atomic.Float32` type for atomic operations on `float32`. diff --git a/vendor/go.uber.org/atomic/bool.go b/vendor/go.uber.org/atomic/bool.go index dfa2085f49..f0a2ddd148 100644 --- a/vendor/go.uber.org/atomic/bool.go +++ b/vendor/go.uber.org/atomic/bool.go @@ -1,6 +1,6 @@ // @generated Code generated by gen-atomicwrapper. -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/go.uber.org/atomic/duration.go b/vendor/go.uber.org/atomic/duration.go index 6f4157445c..7c23868fc8 100644 --- a/vendor/go.uber.org/atomic/duration.go +++ b/vendor/go.uber.org/atomic/duration.go @@ -1,6 +1,6 @@ // @generated Code generated by gen-atomicwrapper. -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/go.uber.org/atomic/error.go b/vendor/go.uber.org/atomic/error.go index 27b23ea162..b7e3f1291a 100644 --- a/vendor/go.uber.org/atomic/error.go +++ b/vendor/go.uber.org/atomic/error.go @@ -1,6 +1,6 @@ // @generated Code generated by gen-atomicwrapper. -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal @@ -52,7 +52,17 @@ func (x *Error) Store(val error) { // CompareAndSwap is an atomic compare-and-swap for error values. func (x *Error) CompareAndSwap(old, new error) (swapped bool) { - return x.v.CompareAndSwap(packError(old), packError(new)) + if x.v.CompareAndSwap(packError(old), packError(new)) { + return true + } + + if old == _zeroError { + // If the old value is the empty value, then it's possible the + // underlying Value hasn't been set and is nil, so retry with nil. + return x.v.CompareAndSwap(nil, packError(new)) + } + + return false } // Swap atomically stores the given error and returns the old diff --git a/vendor/go.uber.org/atomic/float32.go b/vendor/go.uber.org/atomic/float32.go index 5d535a6d2a..62c36334fd 100644 --- a/vendor/go.uber.org/atomic/float32.go +++ b/vendor/go.uber.org/atomic/float32.go @@ -1,6 +1,6 @@ // @generated Code generated by gen-atomicwrapper. -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/go.uber.org/atomic/float64.go b/vendor/go.uber.org/atomic/float64.go index 11d5189a5f..5bc11caabe 100644 --- a/vendor/go.uber.org/atomic/float64.go +++ b/vendor/go.uber.org/atomic/float64.go @@ -1,6 +1,6 @@ // @generated Code generated by gen-atomicwrapper. -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/go.uber.org/atomic/int32.go b/vendor/go.uber.org/atomic/int32.go index b9a68f42ca..5320eac10f 100644 --- a/vendor/go.uber.org/atomic/int32.go +++ b/vendor/go.uber.org/atomic/int32.go @@ -1,6 +1,6 @@ // @generated Code generated by gen-atomicint. -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/go.uber.org/atomic/int64.go b/vendor/go.uber.org/atomic/int64.go index 78d260976f..460821d009 100644 --- a/vendor/go.uber.org/atomic/int64.go +++ b/vendor/go.uber.org/atomic/int64.go @@ -1,6 +1,6 @@ // @generated Code generated by gen-atomicint. -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/go.uber.org/atomic/pointer_go118.go b/vendor/go.uber.org/atomic/pointer_go118.go index e0f47dba46..1fb6c03b26 100644 --- a/vendor/go.uber.org/atomic/pointer_go118.go +++ b/vendor/go.uber.org/atomic/pointer_go118.go @@ -18,43 +18,14 @@ // OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN // THE SOFTWARE. -//go:build go1.18 && !go1.19 -// +build go1.18,!go1.19 +//go:build go1.18 +// +build go1.18 package atomic -import "unsafe" +import "fmt" -type Pointer[T any] struct { - _ nocmp // disallow non-atomic comparison - p UnsafePointer -} - -// NewPointer creates a new Pointer. -func NewPointer[T any](v *T) *Pointer[T] { - var p Pointer[T] - if v != nil { - p.p.Store(unsafe.Pointer(v)) - } - return &p -} - -// Load atomically loads the wrapped value. -func (p *Pointer[T]) Load() *T { - return (*T)(p.p.Load()) -} - -// Store atomically stores the passed value. -func (p *Pointer[T]) Store(val *T) { - p.p.Store(unsafe.Pointer(val)) -} - -// Swap atomically swaps the wrapped pointer and returns the old value. -func (p *Pointer[T]) Swap(val *T) (old *T) { - return (*T)(p.p.Swap(unsafe.Pointer(val))) -} - -// CompareAndSwap is an atomic compare-and-swap. -func (p *Pointer[T]) CompareAndSwap(old, new *T) (swapped bool) { - return p.p.CompareAndSwap(unsafe.Pointer(old), unsafe.Pointer(new)) +// String returns a human readable representation of a Pointer's underlying value. +func (p *Pointer[T]) String() string { + return fmt.Sprint(p.Load()) } diff --git a/vendor/go.uber.org/atomic/pointer_go118_pre119.go b/vendor/go.uber.org/atomic/pointer_go118_pre119.go new file mode 100644 index 0000000000..e0f47dba46 --- /dev/null +++ b/vendor/go.uber.org/atomic/pointer_go118_pre119.go @@ -0,0 +1,60 @@ +// Copyright (c) 2022 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +//go:build go1.18 && !go1.19 +// +build go1.18,!go1.19 + +package atomic + +import "unsafe" + +type Pointer[T any] struct { + _ nocmp // disallow non-atomic comparison + p UnsafePointer +} + +// NewPointer creates a new Pointer. +func NewPointer[T any](v *T) *Pointer[T] { + var p Pointer[T] + if v != nil { + p.p.Store(unsafe.Pointer(v)) + } + return &p +} + +// Load atomically loads the wrapped value. +func (p *Pointer[T]) Load() *T { + return (*T)(p.p.Load()) +} + +// Store atomically stores the passed value. +func (p *Pointer[T]) Store(val *T) { + p.p.Store(unsafe.Pointer(val)) +} + +// Swap atomically swaps the wrapped pointer and returns the old value. +func (p *Pointer[T]) Swap(val *T) (old *T) { + return (*T)(p.p.Swap(unsafe.Pointer(val))) +} + +// CompareAndSwap is an atomic compare-and-swap. +func (p *Pointer[T]) CompareAndSwap(old, new *T) (swapped bool) { + return p.p.CompareAndSwap(unsafe.Pointer(old), unsafe.Pointer(new)) +} diff --git a/vendor/go.uber.org/atomic/string.go b/vendor/go.uber.org/atomic/string.go index c4bea70f4d..061466c5bd 100644 --- a/vendor/go.uber.org/atomic/string.go +++ b/vendor/go.uber.org/atomic/string.go @@ -1,6 +1,6 @@ // @generated Code generated by gen-atomicwrapper. -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal @@ -42,24 +42,31 @@ func NewString(val string) *String { // Load atomically loads the wrapped string. func (x *String) Load() string { - if v := x.v.Load(); v != nil { - return v.(string) - } - return _zeroString + return unpackString(x.v.Load()) } // Store atomically stores the passed string. func (x *String) Store(val string) { - x.v.Store(val) + x.v.Store(packString(val)) } // CompareAndSwap is an atomic compare-and-swap for string values. func (x *String) CompareAndSwap(old, new string) (swapped bool) { - return x.v.CompareAndSwap(old, new) + if x.v.CompareAndSwap(packString(old), packString(new)) { + return true + } + + if old == _zeroString { + // If the old value is the empty value, then it's possible the + // underlying Value hasn't been set and is nil, so retry with nil. + return x.v.CompareAndSwap(nil, packString(new)) + } + + return false } // Swap atomically stores the given string and returns the old // value. func (x *String) Swap(val string) (old string) { - return x.v.Swap(val).(string) + return unpackString(x.v.Swap(packString(val))) } diff --git a/vendor/go.uber.org/atomic/string_ext.go b/vendor/go.uber.org/atomic/string_ext.go index 1f63dfd5b9..019109c86b 100644 --- a/vendor/go.uber.org/atomic/string_ext.go +++ b/vendor/go.uber.org/atomic/string_ext.go @@ -1,4 +1,4 @@ -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal @@ -20,7 +20,18 @@ package atomic -//go:generate bin/gen-atomicwrapper -name=String -type=string -wrapped=Value -compareandswap -swap -file=string.go +//go:generate bin/gen-atomicwrapper -name=String -type=string -wrapped Value -pack packString -unpack unpackString -compareandswap -swap -file=string.go + +func packString(s string) interface{} { + return s +} + +func unpackString(v interface{}) string { + if s, ok := v.(string); ok { + return s + } + return "" +} // String returns the wrapped value. func (s *String) String() string { diff --git a/vendor/go.uber.org/atomic/time.go b/vendor/go.uber.org/atomic/time.go index 1660feb142..cc2a230c00 100644 --- a/vendor/go.uber.org/atomic/time.go +++ b/vendor/go.uber.org/atomic/time.go @@ -1,6 +1,6 @@ // @generated Code generated by gen-atomicwrapper. -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/go.uber.org/atomic/uint32.go b/vendor/go.uber.org/atomic/uint32.go index d6f04a96dc..4adc294ac2 100644 --- a/vendor/go.uber.org/atomic/uint32.go +++ b/vendor/go.uber.org/atomic/uint32.go @@ -1,6 +1,6 @@ // @generated Code generated by gen-atomicint. -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/go.uber.org/atomic/uint64.go b/vendor/go.uber.org/atomic/uint64.go index 2574bdd5ec..0e2eddb303 100644 --- a/vendor/go.uber.org/atomic/uint64.go +++ b/vendor/go.uber.org/atomic/uint64.go @@ -1,6 +1,6 @@ // @generated Code generated by gen-atomicint. -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/go.uber.org/atomic/uintptr.go b/vendor/go.uber.org/atomic/uintptr.go index 81b275a7ad..7d5b000d61 100644 --- a/vendor/go.uber.org/atomic/uintptr.go +++ b/vendor/go.uber.org/atomic/uintptr.go @@ -1,6 +1,6 @@ // @generated Code generated by gen-atomicint. -// Copyright (c) 2020-2022 Uber Technologies, Inc. +// Copyright (c) 2020-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/go.uber.org/goleak/CHANGELOG.md b/vendor/go.uber.org/goleak/CHANGELOG.md index 761db2caa5..530f0a573f 100644 --- a/vendor/go.uber.org/goleak/CHANGELOG.md +++ b/vendor/go.uber.org/goleak/CHANGELOG.md @@ -4,6 +4,12 @@ All notable changes to this project will be documented in this file. The format is based on [Keep a Changelog](http://keepachangelog.com/en/1.0.0/) and this project adheres to [Semantic Versioning](http://semver.org/spec/v2.0.0.html). +## [1.2.1] +### Changed +- Drop golang/x/lint dependency. + +[1.2.1]: https://github.com/uber-go/goleak/compare/v1.2.0...v1.2.1 + ## [1.2.0] ### Added - Add Cleanup option that can be used for registering cleanup callbacks. (#78) @@ -47,5 +53,7 @@ Thanks to @denis-tingajkin for their contributions to this release. [1.0.0]: https://github.com/uber-go/goleak/compare/v0.10.0...v1.0.0 -## 0.10.0 +## [0.10.0] - Initial release. + +[0.10.0]: https://github.com/uber-go/goleak/compare/v0.10.0...HEAD \ No newline at end of file diff --git a/vendor/go.uber.org/goleak/Makefile b/vendor/go.uber.org/goleak/Makefile index 53763fa8d1..8dbf722656 100644 --- a/vendor/go.uber.org/goleak/Makefile +++ b/vendor/go.uber.org/goleak/Makefile @@ -1,6 +1,6 @@ export GOBIN ?= $(shell pwd)/bin -GOLINT = $(GOBIN)/golint +REVIVE = $(GOBIN)/revive GO_FILES := $(shell \ find . '(' -path '*/.*' -o -path './vendor' ')' -prune \ @@ -24,18 +24,18 @@ cover: go test -race -coverprofile=cover.out -coverpkg=./... ./... go tool cover -html=cover.out -o cover.html -$(GOLINT): - go install golang.org/x/lint/golint +$(REVIVE): + cd tools && go install github.com/mgechev/revive .PHONY: lint -lint: $(GOLINT) +lint: $(REVIVE) @rm -rf lint.log @echo "Checking formatting..." @gofmt -d -s $(GO_FILES) 2>&1 | tee lint.log @echo "Checking vet..." @go vet ./... 2>&1 | tee -a lint.log @echo "Checking lint..." - @$(GOLINT) ./... 2>&1 | tee -a lint.log + @$(REVIVE) -set_exit_status ./... 2>&1 | tee -a lint.log @echo "Checking for unresolved FIXMEs..." @git grep -i fixme | grep -v -e '^vendor/' -e '^Makefile' | tee -a lint.log @[ ! -s lint.log ] diff --git a/vendor/go.uber.org/goleak/README.md b/vendor/go.uber.org/goleak/README.md index fb92dabc56..a545b5e779 100644 --- a/vendor/go.uber.org/goleak/README.md +++ b/vendor/go.uber.org/goleak/README.md @@ -8,7 +8,9 @@ You can use `go get` to get the latest version: `go get -u go.uber.org/goleak` -`goleak` also supports semver releases. It is compatible with Go 1.5+. +`goleak` also supports semver releases. + +Note that go-leak only [supports][release] the two most recent minor versions of Go. ## Quick Start @@ -69,3 +71,4 @@ No breaking changes will be made to exported APIs before 2.0. [ci]: https://github.com/uber-go/goleak/actions/workflows/go.yml [cov-img]: https://codecov.io/gh/uber-go/goleak/branch/master/graph/badge.svg [cov]: https://codecov.io/gh/uber-go/goleak +[release]: https://go.dev/doc/devel/release#policy diff --git a/vendor/go.uber.org/goleak/internal/stack/doc.go b/vendor/go.uber.org/goleak/internal/stack/doc.go new file mode 100644 index 0000000000..9179a56549 --- /dev/null +++ b/vendor/go.uber.org/goleak/internal/stack/doc.go @@ -0,0 +1,22 @@ +// Copyright (c) 2017-2023 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +// Package stack is used for parsing stacks from `runtime.Stack`. +package stack diff --git a/vendor/go.uber.org/multierr/.travis.yml b/vendor/go.uber.org/multierr/.travis.yml deleted file mode 100644 index 8636ab42ad..0000000000 --- a/vendor/go.uber.org/multierr/.travis.yml +++ /dev/null @@ -1,23 +0,0 @@ -sudo: false -language: go -go_import_path: go.uber.org/multierr - -env: - global: - - GO111MODULE=on - -go: - - oldstable - - stable - -before_install: -- go version - -script: -- | - set -e - make lint - make cover - -after_success: -- bash <(curl -s https://codecov.io/bash) diff --git a/vendor/go.uber.org/multierr/CHANGELOG.md b/vendor/go.uber.org/multierr/CHANGELOG.md index 6f1db9ef4a..f8177b978c 100644 --- a/vendor/go.uber.org/multierr/CHANGELOG.md +++ b/vendor/go.uber.org/multierr/CHANGELOG.md @@ -1,6 +1,41 @@ Releases ======== +v1.11.0 (2023-03-28) +==================== +- `Errors` now supports any error that implements multiple-error + interface. +- Add `Every` function to allow checking if all errors in the chain + satisfies `errors.Is` against the target error. + +v1.10.0 (2023-03-08) +==================== + +- Comply with Go 1.20's multiple-error interface. +- Drop Go 1.18 support. + Per the support policy, only Go 1.19 and 1.20 are supported now. +- Drop all non-test external dependencies. + +v1.9.0 (2022-12-12) +=================== + +- Add `AppendFunc` that allow passsing functions to similar to + `AppendInvoke`. + +- Bump up yaml.v3 dependency to 3.0.1. + +v1.8.0 (2022-02-28) +=================== + +- `Combine`: perform zero allocations when there are no errors. + + +v1.7.0 (2021-05-06) +=================== + +- Add `AppendInvoke` to append into errors from `defer` blocks. + + v1.6.0 (2020-09-14) =================== diff --git a/vendor/go.uber.org/multierr/LICENSE.txt b/vendor/go.uber.org/multierr/LICENSE.txt index 858e02475f..413e30f7ce 100644 --- a/vendor/go.uber.org/multierr/LICENSE.txt +++ b/vendor/go.uber.org/multierr/LICENSE.txt @@ -1,4 +1,4 @@ -Copyright (c) 2017 Uber Technologies, Inc. +Copyright (c) 2017-2021 Uber Technologies, Inc. Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/go.uber.org/multierr/Makefile b/vendor/go.uber.org/multierr/Makefile index 316004400b..dcb6fe723c 100644 --- a/vendor/go.uber.org/multierr/Makefile +++ b/vendor/go.uber.org/multierr/Makefile @@ -34,9 +34,5 @@ lint: gofmt golint staticcheck .PHONY: cover cover: - go test -coverprofile=cover.out -coverpkg=./... -v ./... + go test -race -coverprofile=cover.out -coverpkg=./... -v ./... go tool cover -html=cover.out -o cover.html - -update-license: - @cd tools && go install go.uber.org/tools/update-license - @$(GOBIN)/update-license $(GO_FILES) diff --git a/vendor/go.uber.org/multierr/README.md b/vendor/go.uber.org/multierr/README.md index 751bd65e58..5ab6ac40f4 100644 --- a/vendor/go.uber.org/multierr/README.md +++ b/vendor/go.uber.org/multierr/README.md @@ -2,9 +2,29 @@ `multierr` allows combining one or more Go `error`s together. +## Features + +- **Idiomatic**: + multierr follows best practices in Go, and keeps your code idiomatic. + - It keeps the underlying error type hidden, + allowing you to deal in `error` values exclusively. + - It provides APIs to safely append into an error from a `defer` statement. +- **Performant**: + multierr is optimized for performance: + - It avoids allocations where possible. + - It utilizes slice resizing semantics to optimize common cases + like appending into the same error object from a loop. +- **Interoperable**: + multierr interoperates with the Go standard library's error APIs seamlessly: + - The `errors.Is` and `errors.As` functions *just work*. +- **Lightweight**: + multierr comes with virtually no dependencies. + ## Installation - go get -u go.uber.org/multierr +```bash +go get -u go.uber.org/multierr@latest +``` ## Status @@ -15,9 +35,9 @@ Stable: No breaking changes will be made before 2.0. Released under the [MIT License]. [MIT License]: LICENSE.txt -[doc-img]: https://godoc.org/go.uber.org/multierr?status.svg -[doc]: https://godoc.org/go.uber.org/multierr -[ci-img]: https://travis-ci.com/uber-go/multierr.svg?branch=master +[doc-img]: https://pkg.go.dev/badge/go.uber.org/multierr +[doc]: https://pkg.go.dev/go.uber.org/multierr +[ci-img]: https://github.com/uber-go/multierr/actions/workflows/go.yml/badge.svg [cov-img]: https://codecov.io/gh/uber-go/multierr/branch/master/graph/badge.svg -[ci]: https://travis-ci.com/uber-go/multierr +[ci]: https://github.com/uber-go/multierr/actions/workflows/go.yml [cov]: https://codecov.io/gh/uber-go/multierr diff --git a/vendor/go.uber.org/multierr/error.go b/vendor/go.uber.org/multierr/error.go index 5c9b67d537..3a828b2dff 100644 --- a/vendor/go.uber.org/multierr/error.go +++ b/vendor/go.uber.org/multierr/error.go @@ -1,4 +1,4 @@ -// Copyright (c) 2019 Uber Technologies, Inc. +// Copyright (c) 2017-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal @@ -20,54 +20,109 @@ // Package multierr allows combining one or more errors together. // -// Overview +// # Overview // // Errors can be combined with the use of the Combine function. // -// multierr.Combine( -// reader.Close(), -// writer.Close(), -// conn.Close(), -// ) +// multierr.Combine( +// reader.Close(), +// writer.Close(), +// conn.Close(), +// ) // // If only two errors are being combined, the Append function may be used // instead. // -// err = multierr.Append(reader.Close(), writer.Close()) -// -// This makes it possible to record resource cleanup failures from deferred -// blocks with the help of named return values. -// -// func sendRequest(req Request) (err error) { -// conn, err := openConnection() -// if err != nil { -// return err -// } -// defer func() { -// err = multierr.Append(err, conn.Close()) -// }() -// // ... -// } +// err = multierr.Append(reader.Close(), writer.Close()) // // The underlying list of errors for a returned error object may be retrieved // with the Errors function. // -// errors := multierr.Errors(err) -// if len(errors) > 0 { -// fmt.Println("The following errors occurred:", errors) -// } +// errors := multierr.Errors(err) +// if len(errors) > 0 { +// fmt.Println("The following errors occurred:", errors) +// } +// +// # Appending from a loop +// +// You sometimes need to append into an error from a loop. +// +// var err error +// for _, item := range items { +// err = multierr.Append(err, process(item)) +// } +// +// Cases like this may require knowledge of whether an individual instance +// failed. This usually requires introduction of a new variable. +// +// var err error +// for _, item := range items { +// if perr := process(item); perr != nil { +// log.Warn("skipping item", item) +// err = multierr.Append(err, perr) +// } +// } +// +// multierr includes AppendInto to simplify cases like this. +// +// var err error +// for _, item := range items { +// if multierr.AppendInto(&err, process(item)) { +// log.Warn("skipping item", item) +// } +// } +// +// This will append the error into the err variable, and return true if that +// individual error was non-nil. // -// Advanced Usage +// See [AppendInto] for more information. +// +// # Deferred Functions +// +// Go makes it possible to modify the return value of a function in a defer +// block if the function was using named returns. This makes it possible to +// record resource cleanup failures from deferred blocks. +// +// func sendRequest(req Request) (err error) { +// conn, err := openConnection() +// if err != nil { +// return err +// } +// defer func() { +// err = multierr.Append(err, conn.Close()) +// }() +// // ... +// } +// +// multierr provides the Invoker type and AppendInvoke function to make cases +// like the above simpler and obviate the need for a closure. The following is +// roughly equivalent to the example above. +// +// func sendRequest(req Request) (err error) { +// conn, err := openConnection() +// if err != nil { +// return err +// } +// defer multierr.AppendInvoke(&err, multierr.Close(conn)) +// // ... +// } +// +// See [AppendInvoke] and [Invoker] for more information. +// +// NOTE: If you're modifying an error from inside a defer, you MUST use a named +// return value for that function. +// +// # Advanced Usage // // Errors returned by Combine and Append MAY implement the following // interface. // -// type errorGroup interface { -// // Returns a slice containing the underlying list of errors. -// // -// // This slice MUST NOT be modified by the caller. -// Errors() []error -// } +// type errorGroup interface { +// // Returns a slice containing the underlying list of errors. +// // +// // This slice MUST NOT be modified by the caller. +// Errors() []error +// } // // Note that if you need access to list of errors behind a multierr error, you // should prefer using the Errors function. That said, if you need cheap @@ -76,23 +131,23 @@ // because errors returned by Combine and Append are not guaranteed to // implement this interface. // -// var errors []error -// group, ok := err.(errorGroup) -// if ok { -// errors = group.Errors() -// } else { -// errors = []error{err} -// } +// var errors []error +// group, ok := err.(errorGroup) +// if ok { +// errors = group.Errors() +// } else { +// errors = []error{err} +// } package multierr // import "go.uber.org/multierr" import ( "bytes" + "errors" "fmt" "io" "strings" "sync" - - "go.uber.org/atomic" + "sync/atomic" ) var ( @@ -132,34 +187,15 @@ type errorGroup interface { // Errors returns a slice containing zero or more errors that the supplied // error is composed of. If the error is nil, a nil slice is returned. // -// err := multierr.Append(r.Close(), w.Close()) -// errors := multierr.Errors(err) +// err := multierr.Append(r.Close(), w.Close()) +// errors := multierr.Errors(err) // // If the error is not composed of other errors, the returned slice contains // just the error that was passed in. // // Callers of this function are free to modify the returned slice. func Errors(err error) []error { - if err == nil { - return nil - } - - // Note that we're casting to multiError, not errorGroup. Our contract is - // that returned errors MAY implement errorGroup. Errors, however, only - // has special behavior for multierr-specific error objects. - // - // This behavior can be expanded in the future but I think it's prudent to - // start with as little as possible in terms of contract and possibility - // of misuse. - eg, ok := err.(*multiError) - if !ok { - return []error{err} - } - - errors := eg.Errors() - result := make([]error, len(errors)) - copy(result, errors) - return result + return extractErrors(err) } // multiError is an error that holds one or more errors. @@ -174,8 +210,6 @@ type multiError struct { errors []error } -var _ errorGroup = (*multiError)(nil) - // Errors returns the list of underlying errors. // // This slice MUST NOT be modified. @@ -201,6 +235,17 @@ func (merr *multiError) Error() string { return result } +// Every compares every error in the given err against the given target error +// using [errors.Is], and returns true only if every comparison returned true. +func Every(err error, target error) bool { + for _, e := range extractErrors(err) { + if !errors.Is(e, target) { + return false + } + } + return true +} + func (merr *multiError) Format(f fmt.State, c rune) { if c == 'v' && f.Flag('+') { merr.writeMultiline(f) @@ -292,6 +337,14 @@ func inspect(errors []error) (res inspectResult) { // fromSlice converts the given list of errors into a single error. func fromSlice(errors []error) error { + // Don't pay to inspect small slices. + switch len(errors) { + case 0: + return nil + case 1: + return errors[0] + } + res := inspect(errors) switch res.Count { case 0: @@ -301,8 +354,12 @@ func fromSlice(errors []error) error { return errors[res.FirstErrorIdx] case len(errors): if !res.ContainsMultiError { - // already flat - return &multiError{errors: errors} + // Error list is flat. Make a copy of it + // Otherwise "errors" escapes to the heap + // unconditionally for all other cases. + // This lets us optimize for the "no errors" case. + out := append(([]error)(nil), errors...) + return &multiError{errors: out} } } @@ -327,32 +384,32 @@ func fromSlice(errors []error) error { // If zero arguments were passed or if all items are nil, a nil error is // returned. // -// Combine(nil, nil) // == nil +// Combine(nil, nil) // == nil // // If only a single error was passed, it is returned as-is. // -// Combine(err) // == err +// Combine(err) // == err // // Combine skips over nil arguments so this function may be used to combine // together errors from operations that fail independently of each other. // -// multierr.Combine( -// reader.Close(), -// writer.Close(), -// pipe.Close(), -// ) +// multierr.Combine( +// reader.Close(), +// writer.Close(), +// pipe.Close(), +// ) // // If any of the passed errors is a multierr error, it will be flattened along // with the other errors. // -// multierr.Combine(multierr.Combine(err1, err2), err3) -// // is the same as -// multierr.Combine(err1, err2, err3) +// multierr.Combine(multierr.Combine(err1, err2), err3) +// // is the same as +// multierr.Combine(err1, err2, err3) // // The returned error formats into a readable multi-line error message if // formatted with %+v. // -// fmt.Sprintf("%+v", multierr.Combine(err1, err2)) +// fmt.Sprintf("%+v", multierr.Combine(err1, err2)) func Combine(errors ...error) error { return fromSlice(errors) } @@ -362,16 +419,19 @@ func Combine(errors ...error) error { // This function is a specialization of Combine for the common case where // there are only two errors. // -// err = multierr.Append(reader.Close(), writer.Close()) +// err = multierr.Append(reader.Close(), writer.Close()) // // The following pattern may also be used to record failure of deferred // operations without losing information about the original error. // -// func doSomething(..) (err error) { -// f := acquireResource() -// defer func() { -// err = multierr.Append(err, f.Close()) -// }() +// func doSomething(..) (err error) { +// f := acquireResource() +// defer func() { +// err = multierr.Append(err, f.Close()) +// }() +// +// Note that the variable MUST be a named return to append an error to it from +// the defer statement. See also [AppendInvoke]. func Append(left error, right error) error { switch { case left == nil: @@ -401,37 +461,37 @@ func Append(left error, right error) error { // AppendInto appends an error into the destination of an error pointer and // returns whether the error being appended was non-nil. // -// var err error -// multierr.AppendInto(&err, r.Close()) -// multierr.AppendInto(&err, w.Close()) +// var err error +// multierr.AppendInto(&err, r.Close()) +// multierr.AppendInto(&err, w.Close()) // // The above is equivalent to, // -// err := multierr.Append(r.Close(), w.Close()) +// err := multierr.Append(r.Close(), w.Close()) // // As AppendInto reports whether the provided error was non-nil, it may be // used to build a multierr error in a loop more ergonomically. For example: // -// var err error -// for line := range lines { -// var item Item -// if multierr.AppendInto(&err, parse(line, &item)) { -// continue -// } -// items = append(items, item) -// } -// -// Compare this with a verison that relies solely on Append: -// -// var err error -// for line := range lines { -// var item Item -// if parseErr := parse(line, &item); parseErr != nil { -// err = multierr.Append(err, parseErr) -// continue -// } -// items = append(items, item) -// } +// var err error +// for line := range lines { +// var item Item +// if multierr.AppendInto(&err, parse(line, &item)) { +// continue +// } +// items = append(items, item) +// } +// +// Compare this with a version that relies solely on Append: +// +// var err error +// for line := range lines { +// var item Item +// if parseErr := parse(line, &item); parseErr != nil { +// err = multierr.Append(err, parseErr) +// continue +// } +// items = append(items, item) +// } func AppendInto(into *error, err error) (errored bool) { if into == nil { // We panic if 'into' is nil. This is not documented above @@ -447,3 +507,140 @@ func AppendInto(into *error, err error) (errored bool) { *into = Append(*into, err) return true } + +// Invoker is an operation that may fail with an error. Use it with +// AppendInvoke to append the result of calling the function into an error. +// This allows you to conveniently defer capture of failing operations. +// +// See also, [Close] and [Invoke]. +type Invoker interface { + Invoke() error +} + +// Invoke wraps a function which may fail with an error to match the Invoker +// interface. Use it to supply functions matching this signature to +// AppendInvoke. +// +// For example, +// +// func processReader(r io.Reader) (err error) { +// scanner := bufio.NewScanner(r) +// defer multierr.AppendInvoke(&err, multierr.Invoke(scanner.Err)) +// for scanner.Scan() { +// // ... +// } +// // ... +// } +// +// In this example, the following line will construct the Invoker right away, +// but defer the invocation of scanner.Err() until the function returns. +// +// defer multierr.AppendInvoke(&err, multierr.Invoke(scanner.Err)) +// +// Note that the error you're appending to from the defer statement MUST be a +// named return. +type Invoke func() error + +// Invoke calls the supplied function and returns its result. +func (i Invoke) Invoke() error { return i() } + +// Close builds an Invoker that closes the provided io.Closer. Use it with +// AppendInvoke to close io.Closers and append their results into an error. +// +// For example, +// +// func processFile(path string) (err error) { +// f, err := os.Open(path) +// if err != nil { +// return err +// } +// defer multierr.AppendInvoke(&err, multierr.Close(f)) +// return processReader(f) +// } +// +// In this example, multierr.Close will construct the Invoker right away, but +// defer the invocation of f.Close until the function returns. +// +// defer multierr.AppendInvoke(&err, multierr.Close(f)) +// +// Note that the error you're appending to from the defer statement MUST be a +// named return. +func Close(closer io.Closer) Invoker { + return Invoke(closer.Close) +} + +// AppendInvoke appends the result of calling the given Invoker into the +// provided error pointer. Use it with named returns to safely defer +// invocation of fallible operations until a function returns, and capture the +// resulting errors. +// +// func doSomething(...) (err error) { +// // ... +// f, err := openFile(..) +// if err != nil { +// return err +// } +// +// // multierr will call f.Close() when this function returns and +// // if the operation fails, its append its error into the +// // returned error. +// defer multierr.AppendInvoke(&err, multierr.Close(f)) +// +// scanner := bufio.NewScanner(f) +// // Similarly, this scheduled scanner.Err to be called and +// // inspected when the function returns and append its error +// // into the returned error. +// defer multierr.AppendInvoke(&err, multierr.Invoke(scanner.Err)) +// +// // ... +// } +// +// NOTE: If used with a defer, the error variable MUST be a named return. +// +// Without defer, AppendInvoke behaves exactly like AppendInto. +// +// err := // ... +// multierr.AppendInvoke(&err, mutltierr.Invoke(foo)) +// +// // ...is roughly equivalent to... +// +// err := // ... +// multierr.AppendInto(&err, foo()) +// +// The advantage of the indirection introduced by Invoker is to make it easy +// to defer the invocation of a function. Without this indirection, the +// invoked function will be evaluated at the time of the defer block rather +// than when the function returns. +// +// // BAD: This is likely not what the caller intended. This will evaluate +// // foo() right away and append its result into the error when the +// // function returns. +// defer multierr.AppendInto(&err, foo()) +// +// // GOOD: This will defer invocation of foo unutil the function returns. +// defer multierr.AppendInvoke(&err, multierr.Invoke(foo)) +// +// multierr provides a few Invoker implementations out of the box for +// convenience. See [Invoker] for more information. +func AppendInvoke(into *error, invoker Invoker) { + AppendInto(into, invoker.Invoke()) +} + +// AppendFunc is a shorthand for [AppendInvoke]. +// It allows using function or method value directly +// without having to wrap it into an [Invoker] interface. +// +// func doSomething(...) (err error) { +// w, err := startWorker(...) +// if err != nil { +// return err +// } +// +// // multierr will call w.Stop() when this function returns and +// // if the operation fails, it appends its error into the +// // returned error. +// defer multierr.AppendFunc(&err, w.Stop) +// } +func AppendFunc(into *error, fn func() error) { + AppendInvoke(into, Invoke(fn)) +} diff --git a/vendor/go.uber.org/multierr/error_post_go120.go b/vendor/go.uber.org/multierr/error_post_go120.go new file mode 100644 index 0000000000..a173f9c251 --- /dev/null +++ b/vendor/go.uber.org/multierr/error_post_go120.go @@ -0,0 +1,48 @@ +// Copyright (c) 2017-2023 Uber Technologies, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +//go:build go1.20 +// +build go1.20 + +package multierr + +// Unwrap returns a list of errors wrapped by this multierr. +func (merr *multiError) Unwrap() []error { + return merr.Errors() +} + +type multipleErrors interface { + Unwrap() []error +} + +func extractErrors(err error) []error { + if err == nil { + return nil + } + + // check if the given err is an Unwrapable error that + // implements multipleErrors interface. + eg, ok := err.(multipleErrors) + if !ok { + return []error{err} + } + + return append(([]error)(nil), eg.Unwrap()...) +} diff --git a/vendor/go.uber.org/multierr/go113.go b/vendor/go.uber.org/multierr/error_pre_go120.go similarity index 66% rename from vendor/go.uber.org/multierr/go113.go rename to vendor/go.uber.org/multierr/error_pre_go120.go index 264b0eac0d..93872a3fcd 100644 --- a/vendor/go.uber.org/multierr/go113.go +++ b/vendor/go.uber.org/multierr/error_pre_go120.go @@ -1,4 +1,4 @@ -// Copyright (c) 2019 Uber Technologies, Inc. +// Copyright (c) 2017-2023 Uber Technologies, Inc. // // Permission is hereby granted, free of charge, to any person obtaining a copy // of this software and associated documentation files (the "Software"), to deal @@ -18,12 +18,19 @@ // OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN // THE SOFTWARE. -// +build go1.13 +//go:build !go1.20 +// +build !go1.20 package multierr import "errors" +// Versions of Go before 1.20 did not support the Unwrap() []error method. +// This provides a similar behavior by implementing the Is(..) and As(..) +// methods. +// See the errors.Join proposal for details: +// https://github.com/golang/go/issues/53435 + // As attempts to find the first error in the error list that matches the type // of the value that target points to. // @@ -50,3 +57,23 @@ func (merr *multiError) Is(target error) bool { } return false } + +func extractErrors(err error) []error { + if err == nil { + return nil + } + + // Note that we're casting to multiError, not errorGroup. Our contract is + // that returned errors MAY implement errorGroup. Errors, however, only + // has special behavior for multierr-specific error objects. + // + // This behavior can be expanded in the future but I think it's prudent to + // start with as little as possible in terms of contract and possibility + // of misuse. + eg, ok := err.(*multiError) + if !ok { + return []error{err} + } + + return append(([]error)(nil), eg.Errors()...) +} diff --git a/vendor/go.uber.org/multierr/glide.yaml b/vendor/go.uber.org/multierr/glide.yaml deleted file mode 100644 index 6ef084ec24..0000000000 --- a/vendor/go.uber.org/multierr/glide.yaml +++ /dev/null @@ -1,8 +0,0 @@ -package: go.uber.org/multierr -import: -- package: go.uber.org/atomic - version: ^1 -testImport: -- package: github.com/stretchr/testify - subpackages: - - assert diff --git a/vendor/golang.org/x/exp/slices/slices.go b/vendor/golang.org/x/exp/slices/slices.go index 01bed6c681..8a7cf20dbd 100644 --- a/vendor/golang.org/x/exp/slices/slices.go +++ b/vendor/golang.org/x/exp/slices/slices.go @@ -104,8 +104,8 @@ func CompareFunc[E1, E2 any](s1 []E1, s2 []E2, cmp func(E1, E2) int) int { // Index returns the index of the first occurrence of v in s, // or -1 if not present. func Index[E comparable](s []E, v E) int { - for i, vs := range s { - if v == vs { + for i := range s { + if v == s[i] { return i } } @@ -115,8 +115,8 @@ func Index[E comparable](s []E, v E) int { // IndexFunc returns the first index i satisfying f(s[i]), // or -1 if none do. func IndexFunc[E any](s []E, f func(E) bool) int { - for i, v := range s { - if f(v) { + for i := range s { + if f(s[i]) { return i } } @@ -168,6 +168,30 @@ func Delete[S ~[]E, E any](s S, i, j int) S { return append(s[:i], s[j:]...) } +// DeleteFunc removes any elements from s for which del returns true, +// returning the modified slice. +// When DeleteFunc removes m elements, it might not modify the elements +// s[len(s)-m:len(s)]. If those elements contain pointers you might consider +// zeroing those elements so that objects they reference can be garbage +// collected. +func DeleteFunc[S ~[]E, E any](s S, del func(E) bool) S { + // Don't start copying elements until we find one to delete. + for i, v := range s { + if del(v) { + j := i + for i++; i < len(s); i++ { + v = s[i] + if !del(v) { + s[j] = v + j++ + } + } + return s[:j] + } + } + return s +} + // Replace replaces the elements s[i:j] by the given v, and returns the // modified slice. Replace panics if s[i:j] is not a valid slice of s. func Replace[S ~[]E, E any](s S, i, j int, v ...E) S { @@ -199,17 +223,20 @@ func Clone[S ~[]E, E any](s S) S { // Compact replaces consecutive runs of equal elements with a single copy. // This is like the uniq command found on Unix. // Compact modifies the contents of the slice s; it does not create a new slice. +// When Compact discards m elements in total, it might not modify the elements +// s[len(s)-m:len(s)]. If those elements contain pointers you might consider +// zeroing those elements so that objects they reference can be garbage collected. func Compact[S ~[]E, E comparable](s S) S { if len(s) < 2 { return s } i := 1 - last := s[0] - for _, v := range s[1:] { - if v != last { - s[i] = v + for k := 1; k < len(s); k++ { + if s[k] != s[k-1] { + if i != k { + s[i] = s[k] + } i++ - last = v } } return s[:i] @@ -221,12 +248,12 @@ func CompactFunc[S ~[]E, E any](s S, eq func(E, E) bool) S { return s } i := 1 - last := s[0] - for _, v := range s[1:] { - if !eq(v, last) { - s[i] = v + for k := 1; k < len(s); k++ { + if !eq(s[k], s[k-1]) { + if i != k { + s[i] = s[k] + } i++ - last = v } } return s[:i] diff --git a/vendor/golang.org/x/exp/slices/sort.go b/vendor/golang.org/x/exp/slices/sort.go index 35a5d8f06d..231b6448ac 100644 --- a/vendor/golang.org/x/exp/slices/sort.go +++ b/vendor/golang.org/x/exp/slices/sort.go @@ -62,46 +62,47 @@ func IsSortedFunc[E any](x []E, less func(a, b E) bool) bool { // sort order; it also returns a bool saying whether the target is really found // in the slice. The slice must be sorted in increasing order. func BinarySearch[E constraints.Ordered](x []E, target E) (int, bool) { - // search returns the leftmost position where f returns true, or len(x) if f - // returns false for all x. This is the insertion position for target in x, - // and could point to an element that's either == target or not. - pos := search(len(x), func(i int) bool { return x[i] >= target }) - if pos >= len(x) || x[pos] != target { - return pos, false - } else { - return pos, true + // Inlining is faster than calling BinarySearchFunc with a lambda. + n := len(x) + // Define x[-1] < target and x[n] >= target. + // Invariant: x[i-1] < target, x[j] >= target. + i, j := 0, n + for i < j { + h := int(uint(i+j) >> 1) // avoid overflow when computing h + // i ≤ h < j + if x[h] < target { + i = h + 1 // preserves x[i-1] < target + } else { + j = h // preserves x[j] >= target + } } + // i == j, x[i-1] < target, and x[j] (= x[i]) >= target => answer is i. + return i, i < n && x[i] == target } // BinarySearchFunc works like BinarySearch, but uses a custom comparison -// function. The slice must be sorted in increasing order, where "increasing" is -// defined by cmp. cmp(a, b) is expected to return an integer comparing the two -// parameters: 0 if a == b, a negative number if a < b and a positive number if -// a > b. -func BinarySearchFunc[E any](x []E, target E, cmp func(E, E) int) (int, bool) { - pos := search(len(x), func(i int) bool { return cmp(x[i], target) >= 0 }) - if pos >= len(x) || cmp(x[pos], target) != 0 { - return pos, false - } else { - return pos, true - } -} - -func search(n int, f func(int) bool) int { - // Define f(-1) == false and f(n) == true. - // Invariant: f(i-1) == false, f(j) == true. +// function. The slice must be sorted in increasing order, where "increasing" +// is defined by cmp. cmp should return 0 if the slice element matches +// the target, a negative number if the slice element precedes the target, +// or a positive number if the slice element follows the target. +// cmp must implement the same ordering as the slice, such that if +// cmp(a, t) < 0 and cmp(b, t) >= 0, then a must precede b in the slice. +func BinarySearchFunc[E, T any](x []E, target T, cmp func(E, T) int) (int, bool) { + n := len(x) + // Define cmp(x[-1], target) < 0 and cmp(x[n], target) >= 0 . + // Invariant: cmp(x[i - 1], target) < 0, cmp(x[j], target) >= 0. i, j := 0, n for i < j { h := int(uint(i+j) >> 1) // avoid overflow when computing h // i ≤ h < j - if !f(h) { - i = h + 1 // preserves f(i-1) == false + if cmp(x[h], target) < 0 { + i = h + 1 // preserves cmp(x[i - 1], target) < 0 } else { - j = h // preserves f(j) == true + j = h // preserves cmp(x[j], target) >= 0 } } - // i == j, f(i-1) == false, and f(j) (= f(i)) == true => answer is i. - return i + // i == j, cmp(x[i-1], target) < 0, and cmp(x[j], target) (= cmp(x[i], target)) >= 0 => answer is i. + return i, i < n && cmp(x[i], target) == 0 } type sortedHint int // hint for pdqsort when choosing the pivot diff --git a/vendor/golang.org/x/mod/internal/lazyregexp/lazyre.go b/vendor/golang.org/x/mod/internal/lazyregexp/lazyre.go index 2681af35af..150f887e7a 100644 --- a/vendor/golang.org/x/mod/internal/lazyregexp/lazyre.go +++ b/vendor/golang.org/x/mod/internal/lazyregexp/lazyre.go @@ -13,7 +13,7 @@ import ( "sync" ) -// Regexp is a wrapper around regexp.Regexp, where the underlying regexp will be +// Regexp is a wrapper around [regexp.Regexp], where the underlying regexp will be // compiled the first time it is needed. type Regexp struct { str string diff --git a/vendor/golang.org/x/mod/module/module.go b/vendor/golang.org/x/mod/module/module.go index e9dec6e614..2a364b229b 100644 --- a/vendor/golang.org/x/mod/module/module.go +++ b/vendor/golang.org/x/mod/module/module.go @@ -4,7 +4,7 @@ // Package module defines the module.Version type along with support code. // -// The module.Version type is a simple Path, Version pair: +// The [module.Version] type is a simple Path, Version pair: // // type Version struct { // Path string @@ -12,7 +12,7 @@ // } // // There are no restrictions imposed directly by use of this structure, -// but additional checking functions, most notably Check, verify that +// but additional checking functions, most notably [Check], verify that // a particular path, version pair is valid. // // # Escaped Paths @@ -140,7 +140,7 @@ type ModuleError struct { Err error } -// VersionError returns a ModuleError derived from a Version and error, +// VersionError returns a [ModuleError] derived from a [Version] and error, // or err itself if it is already such an error. func VersionError(v Version, err error) error { var mErr *ModuleError @@ -169,7 +169,7 @@ func (e *ModuleError) Unwrap() error { return e.Err } // An InvalidVersionError indicates an error specific to a version, with the // module path unknown or specified externally. // -// A ModuleError may wrap an InvalidVersionError, but an InvalidVersionError +// A [ModuleError] may wrap an InvalidVersionError, but an InvalidVersionError // must not wrap a ModuleError. type InvalidVersionError struct { Version string @@ -193,8 +193,8 @@ func (e *InvalidVersionError) Error() string { func (e *InvalidVersionError) Unwrap() error { return e.Err } // An InvalidPathError indicates a module, import, or file path doesn't -// satisfy all naming constraints. See CheckPath, CheckImportPath, -// and CheckFilePath for specific restrictions. +// satisfy all naming constraints. See [CheckPath], [CheckImportPath], +// and [CheckFilePath] for specific restrictions. type InvalidPathError struct { Kind string // "module", "import", or "file" Path string @@ -294,7 +294,7 @@ func fileNameOK(r rune) bool { } // CheckPath checks that a module path is valid. -// A valid module path is a valid import path, as checked by CheckImportPath, +// A valid module path is a valid import path, as checked by [CheckImportPath], // with three additional constraints. // First, the leading path element (up to the first slash, if any), // by convention a domain name, must contain only lower-case ASCII letters, @@ -380,7 +380,7 @@ const ( // checkPath returns an error describing why the path is not valid. // Because these checks apply to module, import, and file paths, // and because other checks may be applied, the caller is expected to wrap -// this error with InvalidPathError. +// this error with [InvalidPathError]. func checkPath(path string, kind pathKind) error { if !utf8.ValidString(path) { return fmt.Errorf("invalid UTF-8") @@ -532,7 +532,7 @@ var badWindowsNames = []string{ // they require ".vN" instead of "/vN", and for all N, not just N >= 2. // SplitPathVersion returns with ok = false when presented with // a path whose last path element does not satisfy the constraints -// applied by CheckPath, such as "example.com/pkg/v1" or "example.com/pkg/v1.2". +// applied by [CheckPath], such as "example.com/pkg/v1" or "example.com/pkg/v1.2". func SplitPathVersion(path string) (prefix, pathMajor string, ok bool) { if strings.HasPrefix(path, "gopkg.in/") { return splitGopkgIn(path) @@ -582,7 +582,7 @@ func splitGopkgIn(path string) (prefix, pathMajor string, ok bool) { // MatchPathMajor reports whether the semantic version v // matches the path major version pathMajor. // -// MatchPathMajor returns true if and only if CheckPathMajor returns nil. +// MatchPathMajor returns true if and only if [CheckPathMajor] returns nil. func MatchPathMajor(v, pathMajor string) bool { return CheckPathMajor(v, pathMajor) == nil } @@ -622,7 +622,7 @@ func CheckPathMajor(v, pathMajor string) error { // PathMajorPrefix returns the major-version tag prefix implied by pathMajor. // An empty PathMajorPrefix allows either v0 or v1. // -// Note that MatchPathMajor may accept some versions that do not actually begin +// Note that [MatchPathMajor] may accept some versions that do not actually begin // with this prefix: namely, it accepts a 'v0.0.0-' prefix for a '.v1' // pathMajor, even though that pathMajor implies 'v1' tagging. func PathMajorPrefix(pathMajor string) string { @@ -643,7 +643,7 @@ func PathMajorPrefix(pathMajor string) string { } // CanonicalVersion returns the canonical form of the version string v. -// It is the same as semver.Canonical(v) except that it preserves the special build suffix "+incompatible". +// It is the same as [semver.Canonical] except that it preserves the special build suffix "+incompatible". func CanonicalVersion(v string) string { cv := semver.Canonical(v) if semver.Build(v) == "+incompatible" { @@ -652,8 +652,8 @@ func CanonicalVersion(v string) string { return cv } -// Sort sorts the list by Path, breaking ties by comparing Version fields. -// The Version fields are interpreted as semantic versions (using semver.Compare) +// Sort sorts the list by Path, breaking ties by comparing [Version] fields. +// The Version fields are interpreted as semantic versions (using [semver.Compare]) // optionally followed by a tie-breaking suffix introduced by a slash character, // like in "v0.0.1/go.mod". func Sort(list []Version) { @@ -793,7 +793,7 @@ func unescapeString(escaped string) (string, bool) { } // MatchPrefixPatterns reports whether any path prefix of target matches one of -// the glob patterns (as defined by path.Match) in the comma-separated globs +// the glob patterns (as defined by [path.Match]) in the comma-separated globs // list. This implements the algorithm used when matching a module path to the // GOPRIVATE environment variable, as described by 'go help module-private'. // diff --git a/vendor/golang.org/x/mod/module/pseudo.go b/vendor/golang.org/x/mod/module/pseudo.go index f04ad37886..9cf19d3254 100644 --- a/vendor/golang.org/x/mod/module/pseudo.go +++ b/vendor/golang.org/x/mod/module/pseudo.go @@ -125,7 +125,7 @@ func IsPseudoVersion(v string) bool { } // IsZeroPseudoVersion returns whether v is a pseudo-version with a zero base, -// timestamp, and revision, as returned by ZeroPseudoVersion. +// timestamp, and revision, as returned by [ZeroPseudoVersion]. func IsZeroPseudoVersion(v string) bool { return v == ZeroPseudoVersion(semver.Major(v)) } diff --git a/vendor/golang.org/x/mod/semver/semver.go b/vendor/golang.org/x/mod/semver/semver.go index a30a22bf20..9a2dfd33a7 100644 --- a/vendor/golang.org/x/mod/semver/semver.go +++ b/vendor/golang.org/x/mod/semver/semver.go @@ -140,7 +140,7 @@ func Compare(v, w string) int { // Max canonicalizes its arguments and then returns the version string // that compares greater. // -// Deprecated: use Compare instead. In most cases, returning a canonicalized +// Deprecated: use [Compare] instead. In most cases, returning a canonicalized // version is not expected or desired. func Max(v, w string) string { v = Canonical(v) @@ -151,7 +151,7 @@ func Max(v, w string) string { return w } -// ByVersion implements sort.Interface for sorting semantic version strings. +// ByVersion implements [sort.Interface] for sorting semantic version strings. type ByVersion []string func (vs ByVersion) Len() int { return len(vs) } @@ -164,7 +164,7 @@ func (vs ByVersion) Less(i, j int) bool { return vs[i] < vs[j] } -// Sort sorts a list of semantic version strings using ByVersion. +// Sort sorts a list of semantic version strings using [ByVersion]. func Sort(list []string) { sort.Sort(ByVersion(list)) } diff --git a/vendor/golang.org/x/net/http/httpproxy/proxy.go b/vendor/golang.org/x/net/http/httpproxy/proxy.go new file mode 100644 index 0000000000..c3bd9a1eeb --- /dev/null +++ b/vendor/golang.org/x/net/http/httpproxy/proxy.go @@ -0,0 +1,370 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package httpproxy provides support for HTTP proxy determination +// based on environment variables, as provided by net/http's +// ProxyFromEnvironment function. +// +// The API is not subject to the Go 1 compatibility promise and may change at +// any time. +package httpproxy + +import ( + "errors" + "fmt" + "net" + "net/url" + "os" + "strings" + "unicode/utf8" + + "golang.org/x/net/idna" +) + +// Config holds configuration for HTTP proxy settings. See +// FromEnvironment for details. +type Config struct { + // HTTPProxy represents the value of the HTTP_PROXY or + // http_proxy environment variable. It will be used as the proxy + // URL for HTTP requests unless overridden by NoProxy. + HTTPProxy string + + // HTTPSProxy represents the HTTPS_PROXY or https_proxy + // environment variable. It will be used as the proxy URL for + // HTTPS requests unless overridden by NoProxy. + HTTPSProxy string + + // NoProxy represents the NO_PROXY or no_proxy environment + // variable. It specifies a string that contains comma-separated values + // specifying hosts that should be excluded from proxying. Each value is + // represented by an IP address prefix (1.2.3.4), an IP address prefix in + // CIDR notation (1.2.3.4/8), a domain name, or a special DNS label (*). + // An IP address prefix and domain name can also include a literal port + // number (1.2.3.4:80). + // A domain name matches that name and all subdomains. A domain name with + // a leading "." matches subdomains only. For example "foo.com" matches + // "foo.com" and "bar.foo.com"; ".y.com" matches "x.y.com" but not "y.com". + // A single asterisk (*) indicates that no proxying should be done. + // A best effort is made to parse the string and errors are + // ignored. + NoProxy string + + // CGI holds whether the current process is running + // as a CGI handler (FromEnvironment infers this from the + // presence of a REQUEST_METHOD environment variable). + // When this is set, ProxyForURL will return an error + // when HTTPProxy applies, because a client could be + // setting HTTP_PROXY maliciously. See https://golang.org/s/cgihttpproxy. + CGI bool +} + +// config holds the parsed configuration for HTTP proxy settings. +type config struct { + // Config represents the original configuration as defined above. + Config + + // httpsProxy is the parsed URL of the HTTPSProxy if defined. + httpsProxy *url.URL + + // httpProxy is the parsed URL of the HTTPProxy if defined. + httpProxy *url.URL + + // ipMatchers represent all values in the NoProxy that are IP address + // prefixes or an IP address in CIDR notation. + ipMatchers []matcher + + // domainMatchers represent all values in the NoProxy that are a domain + // name or hostname & domain name + domainMatchers []matcher +} + +// FromEnvironment returns a Config instance populated from the +// environment variables HTTP_PROXY, HTTPS_PROXY and NO_PROXY (or the +// lowercase versions thereof). +// +// The environment values may be either a complete URL or a +// "host[:port]", in which case the "http" scheme is assumed. An error +// is returned if the value is a different form. +func FromEnvironment() *Config { + return &Config{ + HTTPProxy: getEnvAny("HTTP_PROXY", "http_proxy"), + HTTPSProxy: getEnvAny("HTTPS_PROXY", "https_proxy"), + NoProxy: getEnvAny("NO_PROXY", "no_proxy"), + CGI: os.Getenv("REQUEST_METHOD") != "", + } +} + +func getEnvAny(names ...string) string { + for _, n := range names { + if val := os.Getenv(n); val != "" { + return val + } + } + return "" +} + +// ProxyFunc returns a function that determines the proxy URL to use for +// a given request URL. Changing the contents of cfg will not affect +// proxy functions created earlier. +// +// A nil URL and nil error are returned if no proxy is defined in the +// environment, or a proxy should not be used for the given request, as +// defined by NO_PROXY. +// +// As a special case, if req.URL.Host is "localhost" or a loopback address +// (with or without a port number), then a nil URL and nil error will be returned. +func (cfg *Config) ProxyFunc() func(reqURL *url.URL) (*url.URL, error) { + // Preprocess the Config settings for more efficient evaluation. + cfg1 := &config{ + Config: *cfg, + } + cfg1.init() + return cfg1.proxyForURL +} + +func (cfg *config) proxyForURL(reqURL *url.URL) (*url.URL, error) { + var proxy *url.URL + if reqURL.Scheme == "https" { + proxy = cfg.httpsProxy + } else if reqURL.Scheme == "http" { + proxy = cfg.httpProxy + if proxy != nil && cfg.CGI { + return nil, errors.New("refusing to use HTTP_PROXY value in CGI environment; see golang.org/s/cgihttpproxy") + } + } + if proxy == nil { + return nil, nil + } + if !cfg.useProxy(canonicalAddr(reqURL)) { + return nil, nil + } + + return proxy, nil +} + +func parseProxy(proxy string) (*url.URL, error) { + if proxy == "" { + return nil, nil + } + + proxyURL, err := url.Parse(proxy) + if err != nil || + (proxyURL.Scheme != "http" && + proxyURL.Scheme != "https" && + proxyURL.Scheme != "socks5") { + // proxy was bogus. Try prepending "http://" to it and + // see if that parses correctly. If not, we fall + // through and complain about the original one. + if proxyURL, err := url.Parse("http://" + proxy); err == nil { + return proxyURL, nil + } + } + if err != nil { + return nil, fmt.Errorf("invalid proxy address %q: %v", proxy, err) + } + return proxyURL, nil +} + +// useProxy reports whether requests to addr should use a proxy, +// according to the NO_PROXY or no_proxy environment variable. +// addr is always a canonicalAddr with a host and port. +func (cfg *config) useProxy(addr string) bool { + if len(addr) == 0 { + return true + } + host, port, err := net.SplitHostPort(addr) + if err != nil { + return false + } + if host == "localhost" { + return false + } + ip := net.ParseIP(host) + if ip != nil { + if ip.IsLoopback() { + return false + } + } + + addr = strings.ToLower(strings.TrimSpace(host)) + + if ip != nil { + for _, m := range cfg.ipMatchers { + if m.match(addr, port, ip) { + return false + } + } + } + for _, m := range cfg.domainMatchers { + if m.match(addr, port, ip) { + return false + } + } + return true +} + +func (c *config) init() { + if parsed, err := parseProxy(c.HTTPProxy); err == nil { + c.httpProxy = parsed + } + if parsed, err := parseProxy(c.HTTPSProxy); err == nil { + c.httpsProxy = parsed + } + + for _, p := range strings.Split(c.NoProxy, ",") { + p = strings.ToLower(strings.TrimSpace(p)) + if len(p) == 0 { + continue + } + + if p == "*" { + c.ipMatchers = []matcher{allMatch{}} + c.domainMatchers = []matcher{allMatch{}} + return + } + + // IPv4/CIDR, IPv6/CIDR + if _, pnet, err := net.ParseCIDR(p); err == nil { + c.ipMatchers = append(c.ipMatchers, cidrMatch{cidr: pnet}) + continue + } + + // IPv4:port, [IPv6]:port + phost, pport, err := net.SplitHostPort(p) + if err == nil { + if len(phost) == 0 { + // There is no host part, likely the entry is malformed; ignore. + continue + } + if phost[0] == '[' && phost[len(phost)-1] == ']' { + phost = phost[1 : len(phost)-1] + } + } else { + phost = p + } + // IPv4, IPv6 + if pip := net.ParseIP(phost); pip != nil { + c.ipMatchers = append(c.ipMatchers, ipMatch{ip: pip, port: pport}) + continue + } + + if len(phost) == 0 { + // There is no host part, likely the entry is malformed; ignore. + continue + } + + // domain.com or domain.com:80 + // foo.com matches bar.foo.com + // .domain.com or .domain.com:port + // *.domain.com or *.domain.com:port + if strings.HasPrefix(phost, "*.") { + phost = phost[1:] + } + matchHost := false + if phost[0] != '.' { + matchHost = true + phost = "." + phost + } + if v, err := idnaASCII(phost); err == nil { + phost = v + } + c.domainMatchers = append(c.domainMatchers, domainMatch{host: phost, port: pport, matchHost: matchHost}) + } +} + +var portMap = map[string]string{ + "http": "80", + "https": "443", + "socks5": "1080", +} + +// canonicalAddr returns url.Host but always with a ":port" suffix +func canonicalAddr(url *url.URL) string { + addr := url.Hostname() + if v, err := idnaASCII(addr); err == nil { + addr = v + } + port := url.Port() + if port == "" { + port = portMap[url.Scheme] + } + return net.JoinHostPort(addr, port) +} + +// Given a string of the form "host", "host:port", or "[ipv6::address]:port", +// return true if the string includes a port. +func hasPort(s string) bool { return strings.LastIndex(s, ":") > strings.LastIndex(s, "]") } + +func idnaASCII(v string) (string, error) { + // TODO: Consider removing this check after verifying performance is okay. + // Right now punycode verification, length checks, context checks, and the + // permissible character tests are all omitted. It also prevents the ToASCII + // call from salvaging an invalid IDN, when possible. As a result it may be + // possible to have two IDNs that appear identical to the user where the + // ASCII-only version causes an error downstream whereas the non-ASCII + // version does not. + // Note that for correct ASCII IDNs ToASCII will only do considerably more + // work, but it will not cause an allocation. + if isASCII(v) { + return v, nil + } + return idna.Lookup.ToASCII(v) +} + +func isASCII(s string) bool { + for i := 0; i < len(s); i++ { + if s[i] >= utf8.RuneSelf { + return false + } + } + return true +} + +// matcher represents the matching rule for a given value in the NO_PROXY list +type matcher interface { + // match returns true if the host and optional port or ip and optional port + // are allowed + match(host, port string, ip net.IP) bool +} + +// allMatch matches on all possible inputs +type allMatch struct{} + +func (a allMatch) match(host, port string, ip net.IP) bool { + return true +} + +type cidrMatch struct { + cidr *net.IPNet +} + +func (m cidrMatch) match(host, port string, ip net.IP) bool { + return m.cidr.Contains(ip) +} + +type ipMatch struct { + ip net.IP + port string +} + +func (m ipMatch) match(host, port string, ip net.IP) bool { + if m.ip.Equal(ip) { + return m.port == "" || m.port == port + } + return false +} + +type domainMatch struct { + host string + port string + + matchHost bool +} + +func (m domainMatch) match(host, port string, ip net.IP) bool { + if strings.HasSuffix(host, m.host) || (m.matchHost && host == m.host[1:]) { + return m.port == "" || m.port == port + } + return false +} diff --git a/vendor/golang.org/x/oauth2/google/appengine_gen1.go b/vendor/golang.org/x/oauth2/google/appengine_gen1.go index 16c6c6b90c..e61587945b 100644 --- a/vendor/golang.org/x/oauth2/google/appengine_gen1.go +++ b/vendor/golang.org/x/oauth2/google/appengine_gen1.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build appengine -// +build appengine // This file applies to App Engine first generation runtimes (<= Go 1.9). diff --git a/vendor/golang.org/x/oauth2/google/appengine_gen2_flex.go b/vendor/golang.org/x/oauth2/google/appengine_gen2_flex.go index a7e27b3d29..9c79aa0a0c 100644 --- a/vendor/golang.org/x/oauth2/google/appengine_gen2_flex.go +++ b/vendor/golang.org/x/oauth2/google/appengine_gen2_flex.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !appengine -// +build !appengine // This file applies to App Engine second generation runtimes (>= Go 1.11) and App Engine flexible. diff --git a/vendor/golang.org/x/oauth2/internal/client_appengine.go b/vendor/golang.org/x/oauth2/internal/client_appengine.go index e1755d1d9a..d28140f789 100644 --- a/vendor/golang.org/x/oauth2/internal/client_appengine.go +++ b/vendor/golang.org/x/oauth2/internal/client_appengine.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build appengine -// +build appengine package internal diff --git a/vendor/golang.org/x/tools/internal/event/tag/tag.go b/vendor/golang.org/x/tools/internal/event/tag/tag.go new file mode 100644 index 0000000000..581b26c204 --- /dev/null +++ b/vendor/golang.org/x/tools/internal/event/tag/tag.go @@ -0,0 +1,59 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag provides the labels used for telemetry throughout gopls. +package tag + +import ( + "golang.org/x/tools/internal/event/keys" +) + +var ( + // create the label keys we use + Method = keys.NewString("method", "") + StatusCode = keys.NewString("status.code", "") + StatusMessage = keys.NewString("status.message", "") + RPCID = keys.NewString("id", "") + RPCDirection = keys.NewString("direction", "") + File = keys.NewString("file", "") + Directory = keys.New("directory", "") + URI = keys.New("URI", "") + Package = keys.NewString("package", "") // sorted comma-separated list of Package IDs + PackagePath = keys.NewString("package_path", "") + Query = keys.New("query", "") + Snapshot = keys.NewUInt64("snapshot", "") + Operation = keys.NewString("operation", "") + + Position = keys.New("position", "") + Category = keys.NewString("category", "") + PackageCount = keys.NewInt("packages", "") + Files = keys.New("files", "") + Port = keys.NewInt("port", "") + Type = keys.New("type", "") + HoverKind = keys.NewString("hoverkind", "") + + NewServer = keys.NewString("new_server", "A new server was added") + EndServer = keys.NewString("end_server", "A server was shut down") + + ServerID = keys.NewString("server", "The server ID an event is related to") + Logfile = keys.NewString("logfile", "") + DebugAddress = keys.NewString("debug_address", "") + GoplsPath = keys.NewString("gopls_path", "") + ClientID = keys.NewString("client_id", "") + + Level = keys.NewInt("level", "The logging level") +) + +var ( + // create the stats we measure + Started = keys.NewInt64("started", "Count of started RPCs.") + ReceivedBytes = keys.NewInt64("received_bytes", "Bytes received.") //, unit.Bytes) + SentBytes = keys.NewInt64("sent_bytes", "Bytes sent.") //, unit.Bytes) + Latency = keys.NewFloat64("latency_ms", "Elapsed time in milliseconds") //, unit.Milliseconds) +) + +const ( + Inbound = "in" + Outbound = "out" +) diff --git a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk.go b/vendor/golang.org/x/tools/internal/fastwalk/fastwalk.go index 798fe599be..c40c7e9310 100644 --- a/vendor/golang.org/x/tools/internal/fastwalk/fastwalk.go +++ b/vendor/golang.org/x/tools/internal/fastwalk/fastwalk.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// Package fastwalk provides a faster version of filepath.Walk for file system +// Package fastwalk provides a faster version of [filepath.Walk] for file system // scanning tools. package fastwalk @@ -23,31 +23,31 @@ var ErrTraverseLink = errors.New("fastwalk: traverse symlink, assuming target is // Child directories will still be traversed. var ErrSkipFiles = errors.New("fastwalk: skip remaining files in directory") -// Walk is a faster implementation of filepath.Walk. +// Walk is a faster implementation of [filepath.Walk]. // -// filepath.Walk's design necessarily calls os.Lstat on each file, +// [filepath.Walk]'s design necessarily calls [os.Lstat] on each file, // even if the caller needs less info. // Many tools need only the type of each file. // On some platforms, this information is provided directly by the readdir // system call, avoiding the need to stat each file individually. // fastwalk_unix.go contains a fork of the syscall routines. // -// See golang.org/issue/16399 +// See golang.org/issue/16399. // // Walk walks the file tree rooted at root, calling walkFn for // each file or directory in the tree, including root. // -// If fastWalk returns filepath.SkipDir, the directory is skipped. +// If Walk returns [filepath.SkipDir], the directory is skipped. // -// Unlike filepath.Walk: +// Unlike [filepath.Walk]: // - file stat calls must be done by the user. // The only provided metadata is the file type, which does not include // any permission bits. // - multiple goroutines stat the filesystem concurrently. The provided // walkFn must be safe for concurrent use. -// - fastWalk can follow symlinks if walkFn returns the TraverseLink +// - Walk can follow symlinks if walkFn returns the TraverseLink // sentinel error. It is the walkFn's responsibility to prevent -// fastWalk from going into symlink cycles. +// Walk from going into symlink cycles. func Walk(root string, walkFn func(path string, typ os.FileMode) error) error { // TODO(bradfitz): make numWorkers configurable? We used a // minimum of 4 to give the kernel more info about multiple diff --git a/vendor/golang.org/x/tools/internal/gocommand/invoke.go b/vendor/golang.org/x/tools/internal/gocommand/invoke.go index d50551693f..8d9fc98d8f 100644 --- a/vendor/golang.org/x/tools/internal/gocommand/invoke.go +++ b/vendor/golang.org/x/tools/internal/gocommand/invoke.go @@ -8,10 +8,12 @@ package gocommand import ( "bytes" "context" + "errors" "fmt" "io" "log" "os" + "reflect" "regexp" "runtime" "strconv" @@ -22,6 +24,9 @@ import ( exec "golang.org/x/sys/execabs" "golang.org/x/tools/internal/event" + "golang.org/x/tools/internal/event/keys" + "golang.org/x/tools/internal/event/label" + "golang.org/x/tools/internal/event/tag" ) // An Runner will run go command invocations and serialize @@ -51,9 +56,19 @@ func (runner *Runner) initialize() { // 1.14: go: updating go.mod: existing contents have changed since last read var modConcurrencyError = regexp.MustCompile(`go:.*go.mod.*contents have changed`) +// verb is an event label for the go command verb. +var verb = keys.NewString("verb", "go command verb") + +func invLabels(inv Invocation) []label.Label { + return []label.Label{verb.Of(inv.Verb), tag.Directory.Of(inv.WorkingDir)} +} + // Run is a convenience wrapper around RunRaw. // It returns only stdout and a "friendly" error. func (runner *Runner) Run(ctx context.Context, inv Invocation) (*bytes.Buffer, error) { + ctx, done := event.Start(ctx, "gocommand.Runner.Run", invLabels(inv)...) + defer done() + stdout, _, friendly, _ := runner.RunRaw(ctx, inv) return stdout, friendly } @@ -61,6 +76,9 @@ func (runner *Runner) Run(ctx context.Context, inv Invocation) (*bytes.Buffer, e // RunPiped runs the invocation serially, always waiting for any concurrent // invocations to complete first. func (runner *Runner) RunPiped(ctx context.Context, inv Invocation, stdout, stderr io.Writer) error { + ctx, done := event.Start(ctx, "gocommand.Runner.RunPiped", invLabels(inv)...) + defer done() + _, err := runner.runPiped(ctx, inv, stdout, stderr) return err } @@ -68,6 +86,8 @@ func (runner *Runner) RunPiped(ctx context.Context, inv Invocation, stdout, stde // RunRaw runs the invocation, serializing requests only if they fight over // go.mod changes. func (runner *Runner) RunRaw(ctx context.Context, inv Invocation) (*bytes.Buffer, *bytes.Buffer, error, error) { + ctx, done := event.Start(ctx, "gocommand.Runner.RunRaw", invLabels(inv)...) + defer done() // Make sure the runner is always initialized. runner.initialize() @@ -215,6 +235,18 @@ func (i *Invocation) run(ctx context.Context, stdout, stderr io.Writer) error { cmd := exec.Command("go", goArgs...) cmd.Stdout = stdout cmd.Stderr = stderr + + // cmd.WaitDelay was added only in go1.20 (see #50436). + if waitDelay := reflect.ValueOf(cmd).Elem().FieldByName("WaitDelay"); waitDelay.IsValid() { + // https://go.dev/issue/59541: don't wait forever copying stderr + // after the command has exited. + // After CL 484741 we copy stdout manually, so we we'll stop reading that as + // soon as ctx is done. However, we also don't want to wait around forever + // for stderr. Give a much-longer-than-reasonable delay and then assume that + // something has wedged in the kernel or runtime. + waitDelay.Set(reflect.ValueOf(30 * time.Second)) + } + // On darwin the cwd gets resolved to the real path, which breaks anything that // expects the working directory to keep the original path, including the // go command when dealing with modules. @@ -229,6 +261,7 @@ func (i *Invocation) run(ctx context.Context, stdout, stderr io.Writer) error { cmd.Env = append(cmd.Env, "PWD="+i.WorkingDir) cmd.Dir = i.WorkingDir } + defer func(start time.Time) { log("%s for %v", time.Since(start), cmdDebugStr(cmd)) }(time.Now()) return runCmdContext(ctx, cmd) @@ -242,10 +275,85 @@ var DebugHangingGoCommands = false // runCmdContext is like exec.CommandContext except it sends os.Interrupt // before os.Kill. -func runCmdContext(ctx context.Context, cmd *exec.Cmd) error { - if err := cmd.Start(); err != nil { +func runCmdContext(ctx context.Context, cmd *exec.Cmd) (err error) { + // If cmd.Stdout is not an *os.File, the exec package will create a pipe and + // copy it to the Writer in a goroutine until the process has finished and + // either the pipe reaches EOF or command's WaitDelay expires. + // + // However, the output from 'go list' can be quite large, and we don't want to + // keep reading (and allocating buffers) if we've already decided we don't + // care about the output. We don't want to wait for the process to finish, and + // we don't wait to wait for the WaitDelay to expire either. + // + // Instead, if cmd.Stdout requires a copying goroutine we explicitly replace + // it with a pipe (which is an *os.File), which we can close in order to stop + // copying output as soon as we realize we don't care about it. + var stdoutW *os.File + if cmd.Stdout != nil { + if _, ok := cmd.Stdout.(*os.File); !ok { + var stdoutR *os.File + stdoutR, stdoutW, err = os.Pipe() + if err != nil { + return err + } + prevStdout := cmd.Stdout + cmd.Stdout = stdoutW + + stdoutErr := make(chan error, 1) + go func() { + _, err := io.Copy(prevStdout, stdoutR) + if err != nil { + err = fmt.Errorf("copying stdout: %w", err) + } + stdoutErr <- err + }() + defer func() { + // We started a goroutine to copy a stdout pipe. + // Wait for it to finish, or terminate it if need be. + var err2 error + select { + case err2 = <-stdoutErr: + stdoutR.Close() + case <-ctx.Done(): + stdoutR.Close() + // Per https://pkg.go.dev/os#File.Close, the call to stdoutR.Close + // should cause the Read call in io.Copy to unblock and return + // immediately, but we still need to receive from stdoutErr to confirm + // that that has happened. + <-stdoutErr + err2 = ctx.Err() + } + if err == nil { + err = err2 + } + }() + + // Per https://pkg.go.dev/os/exec#Cmd, “If Stdout and Stderr are the + // same writer, and have a type that can be compared with ==, at most + // one goroutine at a time will call Write.” + // + // Since we're starting a goroutine that writes to cmd.Stdout, we must + // also update cmd.Stderr so that that still holds. + func() { + defer func() { recover() }() + if cmd.Stderr == prevStdout { + cmd.Stderr = cmd.Stdout + } + }() + } + } + + err = cmd.Start() + if stdoutW != nil { + // The child process has inherited the pipe file, + // so close the copy held in this process. + stdoutW.Close() + stdoutW = nil + } + if err != nil { return err } + resChan := make(chan error, 1) go func() { resChan <- cmd.Wait() @@ -253,11 +361,14 @@ func runCmdContext(ctx context.Context, cmd *exec.Cmd) error { // If we're interested in debugging hanging Go commands, stop waiting after a // minute and panic with interesting information. - if DebugHangingGoCommands { + debug := DebugHangingGoCommands + if debug { + timer := time.NewTimer(1 * time.Minute) + defer timer.Stop() select { case err := <-resChan: return err - case <-time.After(1 * time.Minute): + case <-timer.C: HandleHangingGoCommand(cmd.Process) case <-ctx.Done(): } @@ -270,30 +381,25 @@ func runCmdContext(ctx context.Context, cmd *exec.Cmd) error { } // Cancelled. Interrupt and see if it ends voluntarily. - cmd.Process.Signal(os.Interrupt) - select { - case err := <-resChan: - return err - case <-time.After(time.Second): + if err := cmd.Process.Signal(os.Interrupt); err == nil { + // (We used to wait only 1s but this proved + // fragile on loaded builder machines.) + timer := time.NewTimer(5 * time.Second) + defer timer.Stop() + select { + case err := <-resChan: + return err + case <-timer.C: + } } // Didn't shut down in response to interrupt. Kill it hard. // TODO(rfindley): per advice from bcmills@, it may be better to send SIGQUIT // on certain platforms, such as unix. - if err := cmd.Process.Kill(); err != nil && DebugHangingGoCommands { - // Don't panic here as this reliably fails on windows with EINVAL. + if err := cmd.Process.Kill(); err != nil && !errors.Is(err, os.ErrProcessDone) && debug { log.Printf("error killing the Go command: %v", err) } - // See above: don't wait indefinitely if we're debugging hanging Go commands. - if DebugHangingGoCommands { - select { - case err := <-resChan: - return err - case <-time.After(10 * time.Second): // a shorter wait as resChan should return quickly following Kill - HandleHangingGoCommand(cmd.Process) - } - } return <-resChan } diff --git a/vendor/golang.org/x/tools/internal/gocommand/version.go b/vendor/golang.org/x/tools/internal/gocommand/version.go index 307a76d474..446c5846a6 100644 --- a/vendor/golang.org/x/tools/internal/gocommand/version.go +++ b/vendor/golang.org/x/tools/internal/gocommand/version.go @@ -23,21 +23,11 @@ import ( func GoVersion(ctx context.Context, inv Invocation, r *Runner) (int, error) { inv.Verb = "list" inv.Args = []string{"-e", "-f", `{{context.ReleaseTags}}`, `--`, `unsafe`} - inv.Env = append(append([]string{}, inv.Env...), "GO111MODULE=off") - // Unset any unneeded flags, and remove them from BuildFlags, if they're - // present. - inv.ModFile = "" + inv.BuildFlags = nil // This is not a build command. inv.ModFlag = "" - var buildFlags []string - for _, flag := range inv.BuildFlags { - // Flags can be prefixed by one or two dashes. - f := strings.TrimPrefix(strings.TrimPrefix(flag, "-"), "-") - if strings.HasPrefix(f, "mod=") || strings.HasPrefix(f, "modfile=") { - continue - } - buildFlags = append(buildFlags, flag) - } - inv.BuildFlags = buildFlags + inv.ModFile = "" + inv.Env = append(inv.Env[:len(inv.Env):len(inv.Env)], "GO111MODULE=off") + stdoutBytes, err := r.Run(ctx, inv) if err != nil { return 0, err diff --git a/vendor/golang.org/x/tools/internal/imports/fix.go b/vendor/golang.org/x/tools/internal/imports/fix.go index 642a5ac2d7..d4f1b4e8a0 100644 --- a/vendor/golang.org/x/tools/internal/imports/fix.go +++ b/vendor/golang.org/x/tools/internal/imports/fix.go @@ -26,6 +26,7 @@ import ( "unicode/utf8" "golang.org/x/tools/go/ast/astutil" + "golang.org/x/tools/internal/event" "golang.org/x/tools/internal/gocommand" "golang.org/x/tools/internal/gopathwalk" ) @@ -414,9 +415,16 @@ func (p *pass) fix() ([]*ImportFix, bool) { }) } } + // Collecting fixes involved map iteration, so sort for stability. See + // golang/go#59976. + sortFixes(fixes) + // collect selected fixes in a separate slice, so that it can be sorted + // separately. Note that these fixes must occur after fixes to existing + // imports. TODO(rfindley): figure out why. + var selectedFixes []*ImportFix for _, imp := range selected { - fixes = append(fixes, &ImportFix{ + selectedFixes = append(selectedFixes, &ImportFix{ StmtInfo: ImportInfo{ Name: p.importSpecName(imp), ImportPath: imp.ImportPath, @@ -425,8 +433,25 @@ func (p *pass) fix() ([]*ImportFix, bool) { FixType: AddImport, }) } + sortFixes(selectedFixes) - return fixes, true + return append(fixes, selectedFixes...), true +} + +func sortFixes(fixes []*ImportFix) { + sort.Slice(fixes, func(i, j int) bool { + fi, fj := fixes[i], fixes[j] + if fi.StmtInfo.ImportPath != fj.StmtInfo.ImportPath { + return fi.StmtInfo.ImportPath < fj.StmtInfo.ImportPath + } + if fi.StmtInfo.Name != fj.StmtInfo.Name { + return fi.StmtInfo.Name < fj.StmtInfo.Name + } + if fi.IdentName != fj.IdentName { + return fi.IdentName < fj.IdentName + } + return fi.FixType < fj.FixType + }) } // importSpecName gets the import name of imp in the import spec. @@ -519,7 +544,7 @@ func (p *pass) addCandidate(imp *ImportInfo, pkg *packageInfo) { var fixImports = fixImportsDefault func fixImportsDefault(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) error { - fixes, err := getFixes(fset, f, filename, env) + fixes, err := getFixes(context.Background(), fset, f, filename, env) if err != nil { return err } @@ -529,7 +554,7 @@ func fixImportsDefault(fset *token.FileSet, f *ast.File, filename string, env *P // getFixes gets the import fixes that need to be made to f in order to fix the imports. // It does not modify the ast. -func getFixes(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) ([]*ImportFix, error) { +func getFixes(ctx context.Context, fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) ([]*ImportFix, error) { abs, err := filepath.Abs(filename) if err != nil { return nil, err @@ -583,7 +608,7 @@ func getFixes(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv // Go look for candidates in $GOPATH, etc. We don't necessarily load // the real exports of sibling imports, so keep assuming their contents. - if err := addExternalCandidates(p, p.missingRefs, filename); err != nil { + if err := addExternalCandidates(ctx, p, p.missingRefs, filename); err != nil { return nil, err } @@ -1031,7 +1056,10 @@ type scanCallback struct { exportsLoaded func(pkg *pkg, exports []string) } -func addExternalCandidates(pass *pass, refs references, filename string) error { +func addExternalCandidates(ctx context.Context, pass *pass, refs references, filename string) error { + ctx, done := event.Start(ctx, "imports.addExternalCandidates") + defer done() + var mu sync.Mutex found := make(map[string][]pkgDistance) callback := &scanCallback{ diff --git a/vendor/golang.org/x/tools/internal/imports/imports.go b/vendor/golang.org/x/tools/internal/imports/imports.go index 95a88383a7..58e637b90f 100644 --- a/vendor/golang.org/x/tools/internal/imports/imports.go +++ b/vendor/golang.org/x/tools/internal/imports/imports.go @@ -11,6 +11,7 @@ package imports import ( "bufio" "bytes" + "context" "fmt" "go/ast" "go/format" @@ -23,6 +24,7 @@ import ( "strings" "golang.org/x/tools/go/ast/astutil" + "golang.org/x/tools/internal/event" ) // Options is golang.org/x/tools/imports.Options with extra internal-only options. @@ -66,14 +68,17 @@ func Process(filename string, src []byte, opt *Options) (formatted []byte, err e // // Note that filename's directory influences which imports can be chosen, // so it is important that filename be accurate. -func FixImports(filename string, src []byte, opt *Options) (fixes []*ImportFix, err error) { +func FixImports(ctx context.Context, filename string, src []byte, opt *Options) (fixes []*ImportFix, err error) { + ctx, done := event.Start(ctx, "imports.FixImports") + defer done() + fileSet := token.NewFileSet() file, _, err := parse(fileSet, filename, src, opt) if err != nil { return nil, err } - return getFixes(fileSet, file, filename, opt.Env) + return getFixes(ctx, fileSet, file, filename, opt.Env) } // ApplyFixes applies all of the fixes to the file and formats it. extraMode diff --git a/vendor/golang.org/x/tools/internal/imports/mod.go b/vendor/golang.org/x/tools/internal/imports/mod.go index 7d99d04ca8..977d2389da 100644 --- a/vendor/golang.org/x/tools/internal/imports/mod.go +++ b/vendor/golang.org/x/tools/internal/imports/mod.go @@ -19,6 +19,7 @@ import ( "strings" "golang.org/x/mod/module" + "golang.org/x/tools/internal/event" "golang.org/x/tools/internal/gocommand" "golang.org/x/tools/internal/gopathwalk" ) @@ -37,7 +38,7 @@ type ModuleResolver struct { mains []*gocommand.ModuleJSON mainByDir map[string]*gocommand.ModuleJSON modsByModPath []*gocommand.ModuleJSON // All modules, ordered by # of path components in module Path... - modsByDir []*gocommand.ModuleJSON // ...or Dir. + modsByDir []*gocommand.ModuleJSON // ...or number of path components in their Dir. // moduleCacheCache stores information about the module cache. moduleCacheCache *dirInfoCache @@ -123,7 +124,7 @@ func (r *ModuleResolver) init() error { }) sort.Slice(r.modsByDir, func(i, j int) bool { count := func(x int) int { - return strings.Count(r.modsByDir[x].Dir, "/") + return strings.Count(r.modsByDir[x].Dir, string(filepath.Separator)) } return count(j) < count(i) // descending order }) @@ -327,6 +328,10 @@ func (r *ModuleResolver) findModuleByDir(dir string) *gocommand.ModuleJSON { // - in /vendor/ in -mod=vendor mode. // - nested module? Dunno. // Rumor has it that replace targets cannot contain other replace targets. + // + // Note that it is critical here that modsByDir is sorted to have deeper dirs + // first. This ensures that findModuleByDir finds the innermost module. + // See also golang/go#56291. for _, m := range r.modsByDir { if !strings.HasPrefix(dir, m.Dir) { continue @@ -424,6 +429,9 @@ func (r *ModuleResolver) loadPackageNames(importPaths []string, srcDir string) ( } func (r *ModuleResolver) scan(ctx context.Context, callback *scanCallback) error { + ctx, done := event.Start(ctx, "imports.ModuleResolver.scan") + defer done() + if err := r.init(); err != nil { return err } diff --git a/vendor/golang.org/x/tools/internal/typeparams/common.go b/vendor/golang.org/x/tools/internal/typeparams/common.go index 25a1426d30..b9e87c691a 100644 --- a/vendor/golang.org/x/tools/internal/typeparams/common.go +++ b/vendor/golang.org/x/tools/internal/typeparams/common.go @@ -87,7 +87,6 @@ func IsTypeParam(t types.Type) bool { func OriginMethod(fn *types.Func) *types.Func { recv := fn.Type().(*types.Signature).Recv() if recv == nil { - return fn } base := recv.Type() @@ -106,6 +105,26 @@ func OriginMethod(fn *types.Func) *types.Func { } orig := NamedTypeOrigin(named) gfn, _, _ := types.LookupFieldOrMethod(orig, true, fn.Pkg(), fn.Name()) + + // This is a fix for a gopls crash (#60628) due to a go/types bug (#60634). In: + // package p + // type T *int + // func (*T) f() {} + // LookupFieldOrMethod(T, true, p, f)=nil, but NewMethodSet(*T)={(*T).f}. + // Here we make them consistent by force. + // (The go/types bug is general, but this workaround is reached only + // for generic T thanks to the early return above.) + if gfn == nil { + mset := types.NewMethodSet(types.NewPointer(orig)) + for i := 0; i < mset.Len(); i++ { + m := mset.At(i) + if m.Obj().Id() == fn.Id() { + gfn = m.Obj() + break + } + } + } + return gfn.(*types.Func) } diff --git a/vendor/google.golang.org/api/internal/version.go b/vendor/google.golang.org/api/internal/version.go index 54d30ef667..7a7266777b 100644 --- a/vendor/google.golang.org/api/internal/version.go +++ b/vendor/google.golang.org/api/internal/version.go @@ -5,4 +5,4 @@ package internal // Version is the current tagged release of the library. -const Version = "0.128.0" +const Version = "0.132.0" diff --git a/vendor/modules.txt b/vendor/modules.txt index 145f6c7086..622deabef2 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -1,4 +1,4 @@ -# cloud.google.com/go/compute v1.21.0 +# cloud.google.com/go/compute v1.22.0 ## explicit; go 1.19 cloud.google.com/go/compute/internal # cloud.google.com/go/compute/metadata v0.2.3 @@ -16,12 +16,13 @@ github.com/alecthomas/template/parse # github.com/alecthomas/units v0.0.0-20211218093645-b94a6e3cc137 ## explicit; go 1.15 github.com/alecthomas/units -# github.com/asaskevich/govalidator v0.0.0-20210307081110-f21760c49a8d +# github.com/asaskevich/govalidator v0.0.0-20230301143203-a9d515a09cc2 ## explicit; go 1.13 github.com/asaskevich/govalidator -# github.com/aws/aws-sdk-go v1.44.159 +# github.com/aws/aws-sdk-go v1.44.327 ## explicit; go 1.11 github.com/aws/aws-sdk-go/aws +github.com/aws/aws-sdk-go/aws/auth/bearer github.com/aws/aws-sdk-go/aws/awserr github.com/aws/aws-sdk-go/aws/awsutil github.com/aws/aws-sdk-go/aws/client @@ -59,6 +60,7 @@ github.com/aws/aws-sdk-go/private/protocol/restjson github.com/aws/aws-sdk-go/private/protocol/xml/xmlutil github.com/aws/aws-sdk-go/service/sso github.com/aws/aws-sdk-go/service/sso/ssoiface +github.com/aws/aws-sdk-go/service/ssooidc github.com/aws/aws-sdk-go/service/sts github.com/aws/aws-sdk-go/service/sts/stsiface # github.com/beorn7/perks v1.0.1 @@ -67,7 +69,7 @@ github.com/beorn7/perks/quantile # github.com/cespare/xxhash/v2 v2.2.0 ## explicit; go 1.11 github.com/cespare/xxhash/v2 -# github.com/davecgh/go-spew v1.1.1 +# github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc ## explicit github.com/davecgh/go-spew/spew # github.com/dennwc/varint v1.0.0 @@ -76,15 +78,16 @@ github.com/dennwc/varint # github.com/edsrzf/mmap-go v1.1.0 ## explicit; go 1.17 github.com/edsrzf/mmap-go -# github.com/efficientgo/core v1.0.0-rc.0 +# github.com/efficientgo/core v1.0.0-rc.2 ## explicit; go 1.17 github.com/efficientgo/core/backoff github.com/efficientgo/core/errcapture github.com/efficientgo/core/errors github.com/efficientgo/core/merrors -# github.com/efficientgo/e2e v0.14.0 +# github.com/efficientgo/e2e v0.14.1-0.20230710114240-c316eb95ae5b ## explicit; go 1.18 github.com/efficientgo/e2e +github.com/efficientgo/e2e/host github.com/efficientgo/e2e/interactive github.com/efficientgo/e2e/monitoring github.com/efficientgo/e2e/monitoring/matchers @@ -119,10 +122,10 @@ github.com/fsnotify/fsnotify ## explicit; go 1.17 github.com/go-kit/log github.com/go-kit/log/level -# github.com/go-logfmt/logfmt v0.5.1 +# github.com/go-logfmt/logfmt v0.6.0 ## explicit; go 1.17 github.com/go-logfmt/logfmt -# github.com/go-logr/logr v1.2.3 +# github.com/go-logr/logr v1.2.4 ## explicit; go 1.16 github.com/go-logr/logr github.com/go-logr/logr/funcr @@ -142,29 +145,29 @@ github.com/go-openapi/analysis/internal/flatten/operations github.com/go-openapi/analysis/internal/flatten/replace github.com/go-openapi/analysis/internal/flatten/schutils github.com/go-openapi/analysis/internal/flatten/sortref -# github.com/go-openapi/errors v0.20.3 +# github.com/go-openapi/errors v0.20.4 ## explicit; go 1.14 github.com/go-openapi/errors -# github.com/go-openapi/jsonpointer v0.19.5 -## explicit; go 1.13 +# github.com/go-openapi/jsonpointer v0.20.0 +## explicit; go 1.18 github.com/go-openapi/jsonpointer -# github.com/go-openapi/jsonreference v0.20.0 +# github.com/go-openapi/jsonreference v0.20.2 ## explicit; go 1.13 github.com/go-openapi/jsonreference github.com/go-openapi/jsonreference/internal # github.com/go-openapi/loads v0.21.2 ## explicit; go 1.13 github.com/go-openapi/loads -# github.com/go-openapi/spec v0.20.7 +# github.com/go-openapi/spec v0.20.9 ## explicit; go 1.13 github.com/go-openapi/spec -# github.com/go-openapi/strfmt v0.21.3 -## explicit; go 1.13 +# github.com/go-openapi/strfmt v0.21.7 +## explicit; go 1.19 github.com/go-openapi/strfmt -# github.com/go-openapi/swag v0.22.3 +# github.com/go-openapi/swag v0.22.4 ## explicit; go 1.18 github.com/go-openapi/swag -# github.com/go-openapi/validate v0.22.0 +# github.com/go-openapi/validate v0.22.1 ## explicit; go 1.14 github.com/go-openapi/validate # github.com/gogo/protobuf v1.3.2 @@ -234,7 +237,7 @@ github.com/google/shlex # github.com/google/uuid v1.3.0 ## explicit github.com/google/uuid -# github.com/googleapis/enterprise-certificate-proxy v0.2.4 +# github.com/googleapis/enterprise-certificate-proxy v0.2.5 ## explicit; go 1.19 github.com/googleapis/enterprise-certificate-proxy/client github.com/googleapis/enterprise-certificate-proxy/client/util @@ -267,6 +270,9 @@ github.com/jpillora/backoff # github.com/json-iterator/go v1.1.12 ## explicit; go 1.12 github.com/json-iterator/go +# github.com/klauspost/cpuid/v2 v2.2.5 +## explicit; go 1.15 +github.com/klauspost/cpuid/v2 # github.com/mailru/easyjson v0.7.7 ## explicit; go 1.12 github.com/mailru/easyjson/buffer @@ -275,6 +281,9 @@ github.com/mailru/easyjson/jwriter # github.com/matttproud/golang_protobuf_extensions v1.0.4 ## explicit; go 1.9 github.com/matttproud/golang_protobuf_extensions/pbutil +# github.com/minio/sha256-simd v1.0.1 +## explicit; go 1.17 +github.com/minio/sha256-simd # github.com/mitchellh/mapstructure v1.5.0 ## explicit; go 1.14 github.com/mitchellh/mapstructure @@ -303,13 +312,13 @@ github.com/oklog/ulid # github.com/pkg/errors v0.9.1 ## explicit github.com/pkg/errors -# github.com/pmezard/go-difflib v1.0.0 +# github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 ## explicit github.com/pmezard/go-difflib/difflib # github.com/prometheus/alertmanager v0.25.1 ## explicit; go 1.18 github.com/prometheus/alertmanager/api/v2/models -# github.com/prometheus/client_golang v1.14.0 +# github.com/prometheus/client_golang v1.16.0 ## explicit; go 1.17 github.com/prometheus/client_golang/api github.com/prometheus/client_golang/api/prometheus/v1 @@ -320,10 +329,10 @@ github.com/prometheus/client_golang/prometheus/promauto github.com/prometheus/client_golang/prometheus/promhttp github.com/prometheus/client_golang/prometheus/testutil github.com/prometheus/client_golang/prometheus/testutil/promlint -# github.com/prometheus/client_model v0.3.0 -## explicit; go 1.9 +# github.com/prometheus/client_model v0.4.0 +## explicit; go 1.18 github.com/prometheus/client_model/go -# github.com/prometheus/common v0.41.0 +# github.com/prometheus/common v0.44.0 ## explicit; go 1.18 github.com/prometheus/common/config github.com/prometheus/common/expfmt @@ -337,8 +346,8 @@ github.com/prometheus/common/assets # github.com/prometheus/common/sigv4 v0.1.0 ## explicit; go 1.15 github.com/prometheus/common/sigv4 -# github.com/prometheus/procfs v0.8.0 -## explicit; go 1.17 +# github.com/prometheus/procfs v0.11.1 +## explicit; go 1.19 github.com/prometheus/procfs github.com/prometheus/procfs/internal/fs github.com/prometheus/procfs/internal/util @@ -383,16 +392,16 @@ github.com/prometheus/prometheus/util/testutil # github.com/spf13/pflag v1.0.5 ## explicit; go 1.12 github.com/spf13/pflag -# github.com/stretchr/testify v1.8.1 -## explicit; go 1.13 +# github.com/stretchr/testify v1.8.4 +## explicit; go 1.20 github.com/stretchr/testify/assert github.com/stretchr/testify/require -# github.com/thanos-io/thanos v0.25.2 -## explicit; go 1.17 +# github.com/thanos-io/thanos v0.32.5 +## explicit; go 1.18 github.com/thanos-io/thanos/pkg/errutil github.com/thanos-io/thanos/pkg/reloader github.com/thanos-io/thanos/pkg/runutil -# go.mongodb.org/mongo-driver v1.11.0 +# go.mongodb.org/mongo-driver v1.12.0 ## explicit; go 1.13 go.mongodb.org/mongo-driver/bson go.mongodb.org/mongo-driver/bson/bsoncodec @@ -420,8 +429,8 @@ go.opencensus.io/trace go.opencensus.io/trace/internal go.opencensus.io/trace/propagation go.opencensus.io/trace/tracestate -# go.opentelemetry.io/otel v1.11.2 -## explicit; go 1.18 +# go.opentelemetry.io/otel v1.16.0 +## explicit; go 1.19 go.opentelemetry.io/otel go.opentelemetry.io/otel/attribute go.opentelemetry.io/otel/baggage @@ -431,18 +440,22 @@ go.opentelemetry.io/otel/internal/attribute go.opentelemetry.io/otel/internal/baggage go.opentelemetry.io/otel/internal/global go.opentelemetry.io/otel/propagation -# go.opentelemetry.io/otel/trace v1.11.2 -## explicit; go 1.18 +# go.opentelemetry.io/otel/metric v1.16.0 +## explicit; go 1.19 +go.opentelemetry.io/otel/metric +go.opentelemetry.io/otel/metric/embedded +# go.opentelemetry.io/otel/trace v1.16.0 +## explicit; go 1.19 go.opentelemetry.io/otel/trace -# go.uber.org/atomic v1.10.0 +# go.uber.org/atomic v1.11.0 ## explicit; go 1.18 go.uber.org/atomic -# go.uber.org/goleak v1.2.0 +# go.uber.org/goleak v1.2.1 ## explicit; go 1.18 go.uber.org/goleak go.uber.org/goleak/internal/stack -# go.uber.org/multierr v1.6.0 -## explicit; go 1.12 +# go.uber.org/multierr v1.11.0 +## explicit; go 1.19 go.uber.org/multierr # go.uber.org/zap v1.24.0 ## explicit; go 1.19 @@ -462,11 +475,11 @@ golang.org/x/crypto/cryptobyte/asn1 golang.org/x/crypto/hkdf golang.org/x/crypto/internal/alias golang.org/x/crypto/internal/poly1305 -# golang.org/x/exp v0.0.0-20221212164502-fae10dda9338 -## explicit; go 1.18 +# golang.org/x/exp v0.0.0-20230713183714-613f0c0eb8a1 +## explicit; go 1.20 golang.org/x/exp/constraints golang.org/x/exp/slices -# golang.org/x/mod v0.9.0 +# golang.org/x/mod v0.12.0 ## explicit; go 1.17 golang.org/x/mod/internal/lazyregexp golang.org/x/mod/module @@ -475,6 +488,7 @@ golang.org/x/mod/semver ## explicit; go 1.17 golang.org/x/net/context golang.org/x/net/http/httpguts +golang.org/x/net/http/httpproxy golang.org/x/net/http2 golang.org/x/net/http2/hpack golang.org/x/net/idna @@ -482,8 +496,8 @@ golang.org/x/net/internal/socks golang.org/x/net/internal/timeseries golang.org/x/net/proxy golang.org/x/net/trace -# golang.org/x/oauth2 v0.10.0 -## explicit; go 1.17 +# golang.org/x/oauth2 v0.11.0 +## explicit; go 1.18 golang.org/x/oauth2 golang.org/x/oauth2/authhandler golang.org/x/oauth2/clientcredentials @@ -515,7 +529,7 @@ golang.org/x/text/unicode/norm # golang.org/x/time v0.3.0 ## explicit golang.org/x/time/rate -# golang.org/x/tools v0.6.0 +# golang.org/x/tools v0.11.0 ## explicit; go 1.18 golang.org/x/tools/go/ast/astutil golang.org/x/tools/imports @@ -523,6 +537,7 @@ golang.org/x/tools/internal/event golang.org/x/tools/internal/event/core golang.org/x/tools/internal/event/keys golang.org/x/tools/internal/event/label +golang.org/x/tools/internal/event/tag golang.org/x/tools/internal/fastwalk golang.org/x/tools/internal/gocommand golang.org/x/tools/internal/gopathwalk @@ -531,7 +546,7 @@ golang.org/x/tools/internal/typeparams # gomodules.xyz/jsonpatch/v2 v2.2.0 ## explicit; go 1.12 gomodules.xyz/jsonpatch/v2 -# google.golang.org/api v0.128.0 +# google.golang.org/api v0.132.0 ## explicit; go 1.19 google.golang.org/api/googleapi google.golang.org/api/googleapi/transport @@ -559,12 +574,12 @@ google.golang.org/appengine/internal/socket google.golang.org/appengine/internal/urlfetch google.golang.org/appengine/socket google.golang.org/appengine/urlfetch -# google.golang.org/genproto v0.0.0-20230711160842-782d3b101e98 +# google.golang.org/genproto v0.0.0-20230717213848-3f92550aa753 ## explicit; go 1.19 google.golang.org/genproto/googleapis/monitoring/v3 google.golang.org/genproto/googleapis/type/calendarperiod google.golang.org/genproto/internal -# google.golang.org/genproto/googleapis/api v0.0.0-20230711160842-782d3b101e98 +# google.golang.org/genproto/googleapis/api v0.0.0-20230717213848-3f92550aa753 ## explicit; go 1.19 google.golang.org/genproto/googleapis/api google.golang.org/genproto/googleapis/api/annotations @@ -572,7 +587,7 @@ google.golang.org/genproto/googleapis/api/distribution google.golang.org/genproto/googleapis/api/label google.golang.org/genproto/googleapis/api/metric google.golang.org/genproto/googleapis/api/monitoredres -# google.golang.org/genproto/googleapis/rpc v0.0.0-20230711160842-782d3b101e98 +# google.golang.org/genproto/googleapis/rpc v0.0.0-20230717213848-3f92550aa753 ## explicit; go 1.19 google.golang.org/genproto/googleapis/rpc/code google.golang.org/genproto/googleapis/rpc/errdetails